US20210253667A1 - Polypeptides and uses thereof for treatment of autoimmune disorders and infection - Google Patents
Polypeptides and uses thereof for treatment of autoimmune disorders and infection Download PDFInfo
- Publication number
- US20210253667A1 US20210253667A1 US16/951,130 US202016951130A US2021253667A1 US 20210253667 A1 US20210253667 A1 US 20210253667A1 US 202016951130 A US202016951130 A US 202016951130A US 2021253667 A1 US2021253667 A1 US 2021253667A1
- Authority
- US
- United States
- Prior art keywords
- disease
- syndrome
- autoimmune
- psoriasis
- cells
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 208000015181 infectious disease Diseases 0.000 title claims abstract description 53
- 238000011282 treatment Methods 0.000 title claims abstract description 47
- 108090000765 processed proteins & peptides Proteins 0.000 title claims description 284
- 102000004196 processed proteins & peptides Human genes 0.000 title claims description 242
- 229920001184 polypeptide Polymers 0.000 title claims description 214
- 208000023275 Autoimmune disease Diseases 0.000 title claims description 21
- 102000037865 fusion proteins Human genes 0.000 claims abstract description 155
- 108020001507 fusion proteins Proteins 0.000 claims abstract description 155
- 238000000034 method Methods 0.000 claims abstract description 101
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims abstract description 83
- 208000035475 disorder Diseases 0.000 claims abstract description 34
- 239000008194 pharmaceutical composition Substances 0.000 claims abstract description 34
- 210000004027 cell Anatomy 0.000 claims description 132
- 239000003814 drug Substances 0.000 claims description 81
- 150000001413 amino acids Chemical group 0.000 claims description 61
- 201000010099 disease Diseases 0.000 claims description 49
- 229940124597 therapeutic agent Drugs 0.000 claims description 49
- 230000000694 effects Effects 0.000 claims description 44
- 230000004927 fusion Effects 0.000 claims description 32
- 201000006417 multiple sclerosis Diseases 0.000 claims description 32
- 201000004681 Psoriasis Diseases 0.000 claims description 29
- 210000003289 regulatory T cell Anatomy 0.000 claims description 26
- 102100040247 Tumor necrosis factor Human genes 0.000 claims description 24
- 229940079593 drug Drugs 0.000 claims description 23
- 230000001684 chronic effect Effects 0.000 claims description 22
- 230000002757 inflammatory effect Effects 0.000 claims description 22
- 230000004054 inflammatory process Effects 0.000 claims description 22
- 206010061218 Inflammation Diseases 0.000 claims description 21
- 238000004519 manufacturing process Methods 0.000 claims description 20
- 230000001603 reducing effect Effects 0.000 claims description 20
- 230000000770 proinflammatory effect Effects 0.000 claims description 19
- 210000004241 Th2 cell Anatomy 0.000 claims description 18
- 206010039073 rheumatoid arthritis Diseases 0.000 claims description 18
- 230000028327 secretion Effects 0.000 claims description 18
- 201000000596 systemic lupus erythematosus Diseases 0.000 claims description 17
- 206010059176 Juvenile idiopathic arthritis Diseases 0.000 claims description 16
- 230000037361 pathway Effects 0.000 claims description 16
- 239000000126 substance Substances 0.000 claims description 16
- 210000002865 immune cell Anatomy 0.000 claims description 15
- 208000011580 syndromic disease Diseases 0.000 claims description 15
- 206010037575 Pustular psoriasis Diseases 0.000 claims description 14
- 206010067584 Type 1 diabetes mellitus Diseases 0.000 claims description 14
- 201000002215 juvenile rheumatoid arthritis Diseases 0.000 claims description 14
- 208000021386 Sjogren Syndrome Diseases 0.000 claims description 13
- 230000001154 acute effect Effects 0.000 claims description 13
- 230000001363 autoimmune Effects 0.000 claims description 13
- 230000004069 differentiation Effects 0.000 claims description 13
- 208000022559 Inflammatory bowel disease Diseases 0.000 claims description 12
- 208000003456 Juvenile Arthritis Diseases 0.000 claims description 11
- 206010047115 Vasculitis Diseases 0.000 claims description 11
- 208000036142 Viral infection Diseases 0.000 claims description 11
- 230000009385 viral infection Effects 0.000 claims description 11
- 108090000174 Interleukin-10 Proteins 0.000 claims description 10
- 206010046851 Uveitis Diseases 0.000 claims description 10
- 208000022993 cryopyrin-associated periodic syndrome Diseases 0.000 claims description 10
- 230000035755 proliferation Effects 0.000 claims description 10
- 201000005569 Gout Diseases 0.000 claims description 9
- 201000001263 Psoriatic Arthritis Diseases 0.000 claims description 9
- 208000036824 Psoriatic arthropathy Diseases 0.000 claims description 9
- 230000002519 immonomodulatory effect Effects 0.000 claims description 9
- 230000001506 immunosuppresive effect Effects 0.000 claims description 9
- 208000035186 Hemolytic Autoimmune Anemia Diseases 0.000 claims description 8
- 206010036105 Polyneuropathy Diseases 0.000 claims description 8
- 206010042953 Systemic sclerosis Diseases 0.000 claims description 8
- 208000007118 chronic progressive multiple sclerosis Diseases 0.000 claims description 8
- 230000016396 cytokine production Effects 0.000 claims description 8
- 238000011161 development Methods 0.000 claims description 8
- 208000008795 neuromyelitis optica Diseases 0.000 claims description 8
- 230000007824 polyneuropathy Effects 0.000 claims description 8
- 238000002054 transplantation Methods 0.000 claims description 8
- 206010009900 Colitis ulcerative Diseases 0.000 claims description 7
- 206010035664 Pneumonia Diseases 0.000 claims description 7
- 201000006704 Ulcerative Colitis Diseases 0.000 claims description 7
- 208000006454 hepatitis Diseases 0.000 claims description 7
- 206010025135 lupus erythematosus Diseases 0.000 claims description 7
- 208000008439 Biliary Liver Cirrhosis Diseases 0.000 claims description 6
- 208000033222 Biliary cirrhosis primary Diseases 0.000 claims description 6
- 206010012438 Dermatitis atopic Diseases 0.000 claims description 6
- 208000001640 Fibromyalgia Diseases 0.000 claims description 6
- 206010049567 Miller Fisher syndrome Diseases 0.000 claims description 6
- 206010034277 Pemphigoid Diseases 0.000 claims description 6
- 208000012654 Primary biliary cholangitis Diseases 0.000 claims description 6
- 201000009594 Systemic Scleroderma Diseases 0.000 claims description 6
- 201000008937 atopic dermatitis Diseases 0.000 claims description 6
- 208000024376 chronic urticaria Diseases 0.000 claims description 6
- 201000005518 mononeuropathy Diseases 0.000 claims description 6
- 208000002574 reactive arthritis Diseases 0.000 claims description 6
- 238000011476 stem cell transplantation Methods 0.000 claims description 6
- 230000009885 systemic effect Effects 0.000 claims description 6
- 208000011231 Crohn disease Diseases 0.000 claims description 5
- 201000004624 Dermatitis Diseases 0.000 claims description 5
- 206010016207 Familial Mediterranean fever Diseases 0.000 claims description 5
- 206010016654 Fibrosis Diseases 0.000 claims description 5
- 206010017533 Fungal infection Diseases 0.000 claims description 5
- 206010062016 Immunosuppression Diseases 0.000 claims description 5
- 208000009525 Myocarditis Diseases 0.000 claims description 5
- 108060008683 Tumor Necrosis Factor Receptor Proteins 0.000 claims description 5
- 208000010668 atopic eczema Diseases 0.000 claims description 5
- 208000019425 cirrhosis of liver Diseases 0.000 claims description 5
- 231100000283 hepatitis Toxicity 0.000 claims description 5
- 208000026278 immune system disease Diseases 0.000 claims description 5
- 230000000366 juvenile effect Effects 0.000 claims description 5
- 210000004072 lung Anatomy 0.000 claims description 5
- 206010072221 mevalonate kinase deficiency Diseases 0.000 claims description 5
- 208000008494 pericarditis Diseases 0.000 claims description 5
- 230000000737 periodic effect Effects 0.000 claims description 5
- 208000033808 peripheral neuropathy Diseases 0.000 claims description 5
- 201000003068 rheumatic fever Diseases 0.000 claims description 5
- 201000000306 sarcoidosis Diseases 0.000 claims description 5
- 102000003298 tumor necrosis factor receptor Human genes 0.000 claims description 5
- 206010002556 Ankylosing Spondylitis Diseases 0.000 claims description 4
- 208000003343 Antiphospholipid Syndrome Diseases 0.000 claims description 4
- 206010003267 Arthritis reactive Diseases 0.000 claims description 4
- 206010008874 Chronic Fatigue Syndrome Diseases 0.000 claims description 4
- 208000015943 Coeliac disease Diseases 0.000 claims description 4
- 208000007465 Giant cell arteritis Diseases 0.000 claims description 4
- 206010072579 Granulomatosis with polyangiitis Diseases 0.000 claims description 4
- 208000035895 Guillain-Barré syndrome Diseases 0.000 claims description 4
- 208000030836 Hashimoto thyroiditis Diseases 0.000 claims description 4
- 206010020751 Hypersensitivity Diseases 0.000 claims description 4
- 206010022941 Iridocyclitis Diseases 0.000 claims description 4
- 208000031888 Mycoses Diseases 0.000 claims description 4
- 208000030852 Parasitic disease Diseases 0.000 claims description 4
- 208000031845 Pernicious anaemia Diseases 0.000 claims description 4
- 208000031981 Thrombocytopenic Idiopathic Purpura Diseases 0.000 claims description 4
- 206010052568 Urticaria chronic Diseases 0.000 claims description 4
- 201000004612 anterior uveitis Diseases 0.000 claims description 4
- 206010003246 arthritis Diseases 0.000 claims description 4
- 208000006673 asthma Diseases 0.000 claims description 4
- 201000000448 autoimmune hemolytic anemia Diseases 0.000 claims description 4
- 201000003710 autoimmune thrombocytopenic purpura Diseases 0.000 claims description 4
- 208000002849 chondrocalcinosis Diseases 0.000 claims description 4
- 208000019069 chronic childhood arthritis Diseases 0.000 claims description 4
- 230000007882 cirrhosis Effects 0.000 claims description 4
- 230000003210 demyelinating effect Effects 0.000 claims description 4
- 230000002575 demyelinative effect Effects 0.000 claims description 4
- 201000001981 dermatomyositis Diseases 0.000 claims description 4
- 208000015446 immunoglobulin a vasculitis Diseases 0.000 claims description 4
- 206010028417 myasthenia gravis Diseases 0.000 claims description 4
- 201000008482 osteoarthritis Diseases 0.000 claims description 4
- 230000002085 persistent effect Effects 0.000 claims description 4
- 208000008423 pleurisy Diseases 0.000 claims description 4
- 201000006292 polyarteritis nodosa Diseases 0.000 claims description 4
- 230000002265 prevention Effects 0.000 claims description 4
- 208000011797 pustulosis palmaris et plantaris Diseases 0.000 claims description 4
- 206010043207 temporal arteritis Diseases 0.000 claims description 4
- 208000035408 type 1 diabetes mellitus 1 Diseases 0.000 claims description 4
- 208000001839 Antisynthetase syndrome Diseases 0.000 claims description 3
- 206010053555 Arthritis bacterial Diseases 0.000 claims description 3
- 208000006740 Aseptic Meningitis Diseases 0.000 claims description 3
- 208000035143 Bacterial infection Diseases 0.000 claims description 3
- 208000009766 Blau syndrome Diseases 0.000 claims description 3
- 208000019736 Cranial nerve disease Diseases 0.000 claims description 3
- 208000007882 Gastritis Diseases 0.000 claims description 3
- 206010018634 Gouty Arthritis Diseases 0.000 claims description 3
- 201000004331 Henoch-Schoenlein purpura Diseases 0.000 claims description 3
- 206010019617 Henoch-Schonlein purpura Diseases 0.000 claims description 3
- 208000032672 Histiocytosis haematophagic Diseases 0.000 claims description 3
- 206010072010 Hyper IgD syndrome Diseases 0.000 claims description 3
- 208000018208 Hyperimmunoglobulinemia D with periodic fever Diseases 0.000 claims description 3
- 208000031814 IgA Vasculitis Diseases 0.000 claims description 3
- 208000004575 Infectious Arthritis Diseases 0.000 claims description 3
- 208000016604 Lyme disease Diseases 0.000 claims description 3
- 208000004987 Macrophage activation syndrome Diseases 0.000 claims description 3
- 206010027201 Meningitis aseptic Diseases 0.000 claims description 3
- 201000002795 Muckle-Wells syndrome Diseases 0.000 claims description 3
- 201000002481 Myositis Diseases 0.000 claims description 3
- 201000008470 PAPA syndrome Diseases 0.000 claims description 3
- 206010033645 Pancreatitis Diseases 0.000 claims description 3
- 206010072222 Pyogenic sterile arthritis pyoderma gangrenosum and acne syndrome Diseases 0.000 claims description 3
- 208000012322 Raynaud phenomenon Diseases 0.000 claims description 3
- 201000010848 Schnitzler Syndrome Diseases 0.000 claims description 3
- 206010039705 Scleritis Diseases 0.000 claims description 3
- 208000024780 Urticaria Diseases 0.000 claims description 3
- 208000002552 acute disseminated encephalomyelitis Diseases 0.000 claims description 3
- 208000026935 allergic disease Diseases 0.000 claims description 3
- 230000007815 allergy Effects 0.000 claims description 3
- 208000022362 bacterial infectious disease Diseases 0.000 claims description 3
- 208000014826 cranial nerve neuropathy Diseases 0.000 claims description 3
- 206010012601 diabetes mellitus Diseases 0.000 claims description 3
- 239000003085 diluting agent Substances 0.000 claims description 3
- 206010014665 endocarditis Diseases 0.000 claims description 3
- 208000007565 gingivitis Diseases 0.000 claims description 3
- 210000000056 organ Anatomy 0.000 claims description 3
- 230000036281 parasite infection Effects 0.000 claims description 3
- 201000001245 periodontitis Diseases 0.000 claims description 3
- 208000005987 polymyositis Diseases 0.000 claims description 3
- 230000000750 progressive effect Effects 0.000 claims description 3
- 208000022638 pyogenic arthritis-pyoderma gangrenosum-acne syndrome Diseases 0.000 claims description 3
- 201000001223 septic arthritis Diseases 0.000 claims description 3
- 208000017520 skin disease Diseases 0.000 claims description 3
- 208000033316 Acquired hemophilia A Diseases 0.000 claims description 2
- 208000026872 Addison Disease Diseases 0.000 claims description 2
- 206010001766 Alopecia totalis Diseases 0.000 claims description 2
- 206010001767 Alopecia universalis Diseases 0.000 claims description 2
- 208000002267 Anti-neutrophil cytoplasmic antibody-associated vasculitis Diseases 0.000 claims description 2
- 206010003253 Arthritis enteropathic Diseases 0.000 claims description 2
- 208000004300 Atrophic Gastritis Diseases 0.000 claims description 2
- 206010003827 Autoimmune hepatitis Diseases 0.000 claims description 2
- 208000000659 Autoimmune lymphoproliferative syndrome Diseases 0.000 claims description 2
- 206010061666 Autonomic neuropathy Diseases 0.000 claims description 2
- 201000002827 Balo concentric sclerosis Diseases 0.000 claims description 2
- 208000023328 Basedow disease Diseases 0.000 claims description 2
- 208000009137 Behcet syndrome Diseases 0.000 claims description 2
- 208000009299 Benign Mucous Membrane Pemphigoid Diseases 0.000 claims description 2
- 201000003274 CINCA syndrome Diseases 0.000 claims description 2
- 201000002829 CREST Syndrome Diseases 0.000 claims description 2
- 208000002177 Cataract Diseases 0.000 claims description 2
- 206010008690 Chondrocalcinosis pyrophosphate Diseases 0.000 claims description 2
- 208000002691 Choroiditis Diseases 0.000 claims description 2
- 208000030939 Chronic inflammatory demyelinating polyneuropathy Diseases 0.000 claims description 2
- 208000011038 Cold agglutinin disease Diseases 0.000 claims description 2
- 206010009868 Cold type haemolytic anaemia Diseases 0.000 claims description 2
- 206010009895 Colitis ischaemic Diseases 0.000 claims description 2
- 206010056979 Colitis microscopic Diseases 0.000 claims description 2
- 208000027932 Collagen disease Diseases 0.000 claims description 2
- 206010010252 Concentric sclerosis Diseases 0.000 claims description 2
- 208000019707 Cryoglobulinemic vasculitis Diseases 0.000 claims description 2
- 206010012455 Dermatitis exfoliative Diseases 0.000 claims description 2
- 208000004986 Diffuse Cerebral Sclerosis of Schilder Diseases 0.000 claims description 2
- 201000003066 Diffuse Scleroderma Diseases 0.000 claims description 2
- 208000006926 Discoid Lupus Erythematosus Diseases 0.000 claims description 2
- 206010060742 Endocrine ophthalmopathy Diseases 0.000 claims description 2
- 206010015278 Erythrodermic psoriasis Diseases 0.000 claims description 2
- 208000004332 Evans syndrome Diseases 0.000 claims description 2
- 208000035690 Familial cold urticaria Diseases 0.000 claims description 2
- 208000036495 Gastritis atrophic Diseases 0.000 claims description 2
- 208000010412 Glaucoma Diseases 0.000 claims description 2
- 208000024869 Goodpasture syndrome Diseases 0.000 claims description 2
- 208000009329 Graft vs Host Disease Diseases 0.000 claims description 2
- 208000015023 Graves' disease Diseases 0.000 claims description 2
- 206010019233 Headaches Diseases 0.000 claims description 2
- 208000018565 Hemochromatosis Diseases 0.000 claims description 2
- 101000611183 Homo sapiens Tumor necrosis factor Proteins 0.000 claims description 2
- 201000009794 Idiopathic Pulmonary Fibrosis Diseases 0.000 claims description 2
- 206010021245 Idiopathic thrombocytopenic purpura Diseases 0.000 claims description 2
- 208000010159 IgA glomerulonephritis Diseases 0.000 claims description 2
- 206010022557 Intermediate uveitis Diseases 0.000 claims description 2
- 208000029523 Interstitial Lung disease Diseases 0.000 claims description 2
- 208000012528 Juvenile dermatomyositis Diseases 0.000 claims description 2
- 208000000185 Localized scleroderma Diseases 0.000 claims description 2
- 208000005777 Lupus Nephritis Diseases 0.000 claims description 2
- 206010057481 Lupus pneumonitis Diseases 0.000 claims description 2
- 208000035180 MODY Diseases 0.000 claims description 2
- 208000003250 Mixed connective tissue disease Diseases 0.000 claims description 2
- 206010027918 Mononeuropathy multiplex Diseases 0.000 claims description 2
- 208000012192 Mucous membrane pemphigoid Diseases 0.000 claims description 2
- 206010028570 Myelopathy Diseases 0.000 claims description 2
- 206010064584 Myosclerosis Diseases 0.000 claims description 2
- 206010028665 Myxoedema Diseases 0.000 claims description 2
- 206010028703 Nail psoriasis Diseases 0.000 claims description 2
- 208000003435 Optic Neuritis Diseases 0.000 claims description 2
- 208000009360 Osteoarticular Tuberculosis Diseases 0.000 claims description 2
- 206010033661 Pancytopenia Diseases 0.000 claims description 2
- 208000004788 Pars Planitis Diseases 0.000 claims description 2
- 201000011152 Pemphigus Diseases 0.000 claims description 2
- 241000721454 Pemphigus Species 0.000 claims description 2
- 206010034464 Periarthritis Diseases 0.000 claims description 2
- 208000002151 Pleural effusion Diseases 0.000 claims description 2
- 206010036030 Polyarthritis Diseases 0.000 claims description 2
- 206010065159 Polychondritis Diseases 0.000 claims description 2
- 208000007048 Polymyalgia Rheumatica Diseases 0.000 claims description 2
- 208000003971 Posterior uveitis Diseases 0.000 claims description 2
- 208000034943 Primary Sjögren syndrome Diseases 0.000 claims description 2
- 206010053395 Progressive multiple sclerosis Diseases 0.000 claims description 2
- 206010067063 Progressive relapsing multiple sclerosis Diseases 0.000 claims description 2
- 206010037394 Pulmonary haemorrhage Diseases 0.000 claims description 2
- 208000003670 Pure Red-Cell Aplasia Diseases 0.000 claims description 2
- 206010037660 Pyrexia Diseases 0.000 claims description 2
- 208000033464 Reiter syndrome Diseases 0.000 claims description 2
- 208000007400 Relapsing-Remitting Multiple Sclerosis Diseases 0.000 claims description 2
- 208000017442 Retinal disease Diseases 0.000 claims description 2
- 206010038923 Retinopathy Diseases 0.000 claims description 2
- 208000025747 Rheumatic disease Diseases 0.000 claims description 2
- 206010039710 Scleroderma Diseases 0.000 claims description 2
- 206010067739 Shrinking lung syndrome Diseases 0.000 claims description 2
- 208000006045 Spondylarthropathies Diseases 0.000 claims description 2
- 206010072148 Stiff-Person syndrome Diseases 0.000 claims description 2
- 206010042742 Sympathetic ophthalmia Diseases 0.000 claims description 2
- 208000001106 Takayasu Arteritis Diseases 0.000 claims description 2
- 206010047642 Vitiligo Diseases 0.000 claims description 2
- 206010064930 age-related macular degeneration Diseases 0.000 claims description 2
- 201000009961 allergic asthma Diseases 0.000 claims description 2
- 230000000735 allogeneic effect Effects 0.000 claims description 2
- 208000004631 alopecia areata Diseases 0.000 claims description 2
- 208000032775 alopecia universalis congenita Diseases 0.000 claims description 2
- 201000005000 autoimmune gastritis Diseases 0.000 claims description 2
- 208000027625 autoimmune inner ear disease Diseases 0.000 claims description 2
- 206010071578 autoimmune retinopathy Diseases 0.000 claims description 2
- 208000029407 autoimmune urticaria Diseases 0.000 claims description 2
- 201000004982 autoimmune uveitis Diseases 0.000 claims description 2
- 208000000594 bullous pemphigoid Diseases 0.000 claims description 2
- 201000010415 childhood type dermatomyositis Diseases 0.000 claims description 2
- 201000004709 chorioretinitis Diseases 0.000 claims description 2
- 208000016644 chronic atrophic gastritis Diseases 0.000 claims description 2
- 201000005795 chronic inflammatory demyelinating polyneuritis Diseases 0.000 claims description 2
- 208000025302 chronic primary adrenal insufficiency Diseases 0.000 claims description 2
- 201000010002 cicatricial pemphigoid Diseases 0.000 claims description 2
- 208000008609 collagenous colitis Diseases 0.000 claims description 2
- 208000018631 connective tissue disease Diseases 0.000 claims description 2
- 208000004921 cutaneous lupus erythematosus Diseases 0.000 claims description 2
- 208000024389 cytopenia Diseases 0.000 claims description 2
- 201000008243 diversion colitis Diseases 0.000 claims description 2
- 229960000301 factor viii Drugs 0.000 claims description 2
- 206010064570 familial cold autoinflammatory syndrome Diseases 0.000 claims description 2
- ZZUFCTLCJUWOSV-UHFFFAOYSA-N furosemide Chemical compound C1=C(Cl)C(S(=O)(=O)N)=CC(C(O)=O)=C1NCC1=CC=CO1 ZZUFCTLCJUWOSV-UHFFFAOYSA-N 0.000 claims description 2
- 208000023368 generalized pustular psoriasis Diseases 0.000 claims description 2
- 208000004104 gestational diabetes Diseases 0.000 claims description 2
- 208000024908 graft versus host disease Diseases 0.000 claims description 2
- 206010018797 guttate psoriasis Diseases 0.000 claims description 2
- 231100000869 headache Toxicity 0.000 claims description 2
- 201000006317 impetigo herpetiformis Diseases 0.000 claims description 2
- 208000027138 indeterminate colitis Diseases 0.000 claims description 2
- 208000036971 interstitial lung disease 2 Diseases 0.000 claims description 2
- 208000001921 latent autoimmune diabetes in adults Diseases 0.000 claims description 2
- 208000004341 lymphocytic colitis Diseases 0.000 claims description 2
- 230000000527 lymphocytic effect Effects 0.000 claims description 2
- 208000002780 macular degeneration Diseases 0.000 claims description 2
- 230000003211 malignant effect Effects 0.000 claims description 2
- 201000006950 maturity-onset diabetes of the young Diseases 0.000 claims description 2
- 201000008350 membranous glomerulonephritis Diseases 0.000 claims description 2
- 206010063344 microscopic polyangiitis Diseases 0.000 claims description 2
- 201000002003 mononeuritis multiplex Diseases 0.000 claims description 2
- 208000003786 myxedema Diseases 0.000 claims description 2
- 201000001119 neuropathy Diseases 0.000 claims description 2
- 230000007823 neuropathy Effects 0.000 claims description 2
- 201000001976 pemphigus vulgaris Diseases 0.000 claims description 2
- 206010063401 primary progressive multiple sclerosis Diseases 0.000 claims description 2
- 230000001185 psoriatic effect Effects 0.000 claims description 2
- 230000002685 pulmonary effect Effects 0.000 claims description 2
- 208000002815 pulmonary hypertension Diseases 0.000 claims description 2
- 201000010914 pustulosis of palm and sole Diseases 0.000 claims description 2
- 230000000306 recurrent effect Effects 0.000 claims description 2
- 208000009169 relapsing polychondritis Diseases 0.000 claims description 2
- 206010048628 rheumatoid vasculitis Diseases 0.000 claims description 2
- 201000008628 secondary progressive multiple sclerosis Diseases 0.000 claims description 2
- 201000003196 skeletal tuberculosis Diseases 0.000 claims description 2
- 201000005671 spondyloarthropathy Diseases 0.000 claims description 2
- 208000009174 transverse myelitis Diseases 0.000 claims description 2
- 208000001072 type 2 diabetes mellitus Diseases 0.000 claims description 2
- 238000010322 bone marrow transplantation Methods 0.000 claims 1
- 230000031261 interleukin-10 production Effects 0.000 claims 1
- 201000007407 panuveitis Diseases 0.000 claims 1
- 108090000623 proteins and genes Proteins 0.000 abstract description 125
- 102000004169 proteins and genes Human genes 0.000 abstract description 110
- 239000012634 fragment Substances 0.000 abstract description 102
- 235000018102 proteins Nutrition 0.000 description 106
- 235000001014 amino acid Nutrition 0.000 description 72
- 210000001744 T-lymphocyte Anatomy 0.000 description 65
- 229940024606 amino acid Drugs 0.000 description 64
- -1 phosphinates Chemical class 0.000 description 42
- 150000007523 nucleic acids Chemical group 0.000 description 40
- 230000014509 gene expression Effects 0.000 description 38
- 125000003275 alpha amino acid group Chemical group 0.000 description 37
- 241000282414 Homo sapiens Species 0.000 description 36
- 239000013598 vector Substances 0.000 description 34
- 239000013604 expression vector Substances 0.000 description 33
- 239000000427 antigen Substances 0.000 description 32
- 108060003951 Immunoglobulin Proteins 0.000 description 31
- 108091007433 antigens Proteins 0.000 description 31
- 102000036639 antigens Human genes 0.000 description 31
- 102000018358 immunoglobulin Human genes 0.000 description 31
- 238000006467 substitution reaction Methods 0.000 description 31
- 125000005647 linker group Chemical group 0.000 description 30
- 102100030703 Interleukin-22 Human genes 0.000 description 28
- 102000039446 nucleic acids Human genes 0.000 description 28
- 108020004707 nucleic acids Proteins 0.000 description 28
- 150000001875 compounds Chemical class 0.000 description 25
- 230000004048 modification Effects 0.000 description 25
- 238000012986 modification Methods 0.000 description 25
- 239000003795 chemical substances by application Substances 0.000 description 24
- 230000001225 therapeutic effect Effects 0.000 description 24
- 238000006471 dimerization reaction Methods 0.000 description 23
- MZOFCQQQCNRIBI-VMXHOPILSA-N (3s)-4-[[(2s)-1-[[(2s)-1-[[(1s)-1-carboxy-2-hydroxyethyl]amino]-4-methyl-1-oxopentan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-3-[[2-[[(2s)-2,6-diaminohexanoyl]amino]acetyl]amino]-4-oxobutanoic acid Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@@H](N)CCCCN MZOFCQQQCNRIBI-VMXHOPILSA-N 0.000 description 22
- CMSMOCZEIVJLDB-UHFFFAOYSA-N Cyclophosphamide Chemical compound ClCCN(CCCl)P1(=O)NCCCO1 CMSMOCZEIVJLDB-UHFFFAOYSA-N 0.000 description 22
- 108091034117 Oligonucleotide Proteins 0.000 description 22
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 22
- 230000001105 regulatory effect Effects 0.000 description 22
- 230000006870 function Effects 0.000 description 21
- 102100037850 Interferon gamma Human genes 0.000 description 20
- 108010074328 Interferon-gamma Proteins 0.000 description 20
- 210000000447 Th1 cell Anatomy 0.000 description 19
- 102000004127 Cytokines Human genes 0.000 description 18
- 108090000695 Cytokines Proteins 0.000 description 18
- 239000000203 mixture Substances 0.000 description 18
- 230000004044 response Effects 0.000 description 18
- 241000700605 Viruses Species 0.000 description 17
- 239000000539 dimer Substances 0.000 description 17
- 108050003558 Interleukin-17 Proteins 0.000 description 16
- 102000013691 Interleukin-17 Human genes 0.000 description 16
- 108091033319 polynucleotide Proteins 0.000 description 16
- 102000040430 polynucleotide Human genes 0.000 description 16
- 239000002157 polynucleotide Substances 0.000 description 16
- 102000013264 Interleukin-23 Human genes 0.000 description 15
- 108010065637 Interleukin-23 Proteins 0.000 description 15
- 108010076504 Protein Sorting Signals Proteins 0.000 description 15
- 210000003719 b-lymphocyte Anatomy 0.000 description 15
- 230000028993 immune response Effects 0.000 description 15
- 230000002401 inhibitory effect Effects 0.000 description 15
- 230000000670 limiting effect Effects 0.000 description 15
- 230000001404 mediated effect Effects 0.000 description 15
- 102000005962 receptors Human genes 0.000 description 15
- 108020003175 receptors Proteins 0.000 description 15
- 108020004414 DNA Proteins 0.000 description 14
- 108090001005 Interleukin-6 Proteins 0.000 description 14
- 102000004889 Interleukin-6 Human genes 0.000 description 14
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 14
- 102000002274 Matrix Metalloproteinases Human genes 0.000 description 14
- 108010000684 Matrix Metalloproteinases Proteins 0.000 description 14
- 125000000539 amino acid group Chemical group 0.000 description 14
- 230000000139 costimulatory effect Effects 0.000 description 14
- 210000000987 immune system Anatomy 0.000 description 14
- 108010074108 interleukin-21 Proteins 0.000 description 14
- 108010074109 interleukin-22 Proteins 0.000 description 14
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 14
- 230000008685 targeting Effects 0.000 description 14
- 210000001519 tissue Anatomy 0.000 description 14
- 229960005486 vaccine Drugs 0.000 description 13
- 230000003612 virological effect Effects 0.000 description 13
- 101000716102 Homo sapiens T-cell surface glycoprotein CD4 Proteins 0.000 description 12
- 102100036011 T-cell surface glycoprotein CD4 Human genes 0.000 description 12
- 108090001012 Transforming Growth Factor beta Proteins 0.000 description 12
- 102000004887 Transforming Growth Factor beta Human genes 0.000 description 12
- 230000013595 glycosylation Effects 0.000 description 12
- 238000006206 glycosylation reaction Methods 0.000 description 12
- 230000001965 increasing effect Effects 0.000 description 12
- 230000035772 mutation Effects 0.000 description 12
- 239000000816 peptidomimetic Substances 0.000 description 12
- ZRKFYGHZFMAOKI-QMGMOQQFSA-N tgfbeta Chemical compound C([C@H](NC(=O)[C@H](C(C)C)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CCSC)C(C)C)[C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O)C1=CC=C(O)C=C1 ZRKFYGHZFMAOKI-QMGMOQQFSA-N 0.000 description 12
- 208000035473 Communicable disease Diseases 0.000 description 11
- PMATZTZNYRCHOR-CGLBZJNRSA-N Cyclosporin A Chemical compound CC[C@@H]1NC(=O)[C@H]([C@H](O)[C@H](C)C\C=C\C)N(C)C(=O)[C@H](C(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)N(C)C(=O)[C@H](C(C)C)NC(=O)[C@H](CC(C)C)N(C)C(=O)CN(C)C1=O PMATZTZNYRCHOR-CGLBZJNRSA-N 0.000 description 11
- 108091008874 T cell receptors Proteins 0.000 description 11
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 11
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 11
- 150000001720 carbohydrates Chemical group 0.000 description 11
- 230000005764 inhibitory process Effects 0.000 description 11
- 229960000485 methotrexate Drugs 0.000 description 11
- 125000000325 methylidene group Chemical group [H]C([H])=* 0.000 description 11
- 108010036949 Cyclosporine Proteins 0.000 description 10
- 108091028043 Nucleic acid sequence Proteins 0.000 description 10
- 102100040678 Programmed cell death protein 1 Human genes 0.000 description 10
- 101710089372 Programmed cell death protein 1 Proteins 0.000 description 10
- LMEKQMALGUDUQG-UHFFFAOYSA-N azathioprine Chemical compound CN1C=NC([N+]([O-])=O)=C1SC1=NC=NC2=C1NC=N2 LMEKQMALGUDUQG-UHFFFAOYSA-N 0.000 description 10
- 230000000903 blocking effect Effects 0.000 description 10
- OPTASPLRGRRNAP-UHFFFAOYSA-N cytosine Chemical compound NC=1C=CNC(=O)N=1 OPTASPLRGRRNAP-UHFFFAOYSA-N 0.000 description 10
- 229960004641 rituximab Drugs 0.000 description 10
- 238000003786 synthesis reaction Methods 0.000 description 10
- 238000002560 therapeutic procedure Methods 0.000 description 10
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 9
- 108010008165 Etanercept Proteins 0.000 description 9
- 239000002202 Polyethylene glycol Substances 0.000 description 9
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 9
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 9
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 9
- 229960003697 abatacept Drugs 0.000 description 9
- 125000001797 benzyl group Chemical group [H]C1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])* 0.000 description 9
- 230000015572 biosynthetic process Effects 0.000 description 9
- 229960004397 cyclophosphamide Drugs 0.000 description 9
- UYTPUPDQBNUYGX-UHFFFAOYSA-N guanine Chemical compound O=C1NC(N)=NC2=C1N=CN2 UYTPUPDQBNUYGX-UHFFFAOYSA-N 0.000 description 9
- XXSMGPRMXLTPCZ-UHFFFAOYSA-N hydroxychloroquine Chemical compound ClC1=CC=C2C(NC(C)CCCN(CCO)CC)=CC=NC2=C1 XXSMGPRMXLTPCZ-UHFFFAOYSA-N 0.000 description 9
- 239000003018 immunosuppressive agent Substances 0.000 description 9
- 238000001727 in vivo Methods 0.000 description 9
- 229920001223 polyethylene glycol Polymers 0.000 description 9
- 238000003259 recombinant expression Methods 0.000 description 9
- QFJCIRLUMZQUOT-HPLJOQBZSA-N sirolimus Chemical compound C1C[C@@H](O)[C@H](OC)C[C@@H]1C[C@@H](C)[C@H]1OC(=O)[C@@H]2CCCCN2C(=O)C(=O)[C@](O)(O2)[C@H](C)CC[C@H]2C[C@H](OC)/C(C)=C/C=C/C=C/[C@@H](C)C[C@@H](C)C(=O)[C@H](OC)[C@H](O)/C(C)=C/[C@@H](C)C(=O)C1 QFJCIRLUMZQUOT-HPLJOQBZSA-N 0.000 description 9
- 229960002930 sirolimus Drugs 0.000 description 9
- 150000003384 small molecules Chemical class 0.000 description 9
- 235000000346 sugar Nutrition 0.000 description 9
- 102100039498 Cytotoxic T-lymphocyte protein 4 Human genes 0.000 description 8
- 241000588724 Escherichia coli Species 0.000 description 8
- 241000124008 Mammalia Species 0.000 description 8
- 230000005867 T cell response Effects 0.000 description 8
- 230000000692 anti-sense effect Effects 0.000 description 8
- 230000001580 bacterial effect Effects 0.000 description 8
- 230000004071 biological effect Effects 0.000 description 8
- 229960001265 ciclosporin Drugs 0.000 description 8
- 235000018417 cysteine Nutrition 0.000 description 8
- 238000012217 deletion Methods 0.000 description 8
- 230000037430 deletion Effects 0.000 description 8
- 229940035567 orencia Drugs 0.000 description 8
- 244000052769 pathogen Species 0.000 description 8
- 230000001717 pathogenic effect Effects 0.000 description 8
- ZAHRKKWIAAJSAO-UHFFFAOYSA-N rapamycin Natural products COCC(O)C(=C/C(C)C(=O)CC(OC(=O)C1CCCCN1C(=O)C(=O)C2(O)OC(CC(OC)C(=CC=CC=CC(C)CC(C)C(=O)C)C)CCC2C)C(C)CC3CCC(O)C(C3)OC)C ZAHRKKWIAAJSAO-UHFFFAOYSA-N 0.000 description 8
- 230000002829 reductive effect Effects 0.000 description 8
- 108010072051 Glatiramer Acetate Proteins 0.000 description 7
- 101000914514 Homo sapiens T-cell-specific surface glycoprotein CD28 Proteins 0.000 description 7
- 108010005714 Interferon beta-1b Proteins 0.000 description 7
- 230000006044 T cell activation Effects 0.000 description 7
- 102100027213 T-cell-specific surface glycoprotein CD28 Human genes 0.000 description 7
- 239000002253 acid Substances 0.000 description 7
- 239000002671 adjuvant Substances 0.000 description 7
- 239000002160 alpha blocker Substances 0.000 description 7
- 239000003435 antirheumatic agent Substances 0.000 description 7
- 229960002170 azathioprine Drugs 0.000 description 7
- 238000003776 cleavage reaction Methods 0.000 description 7
- 239000003246 corticosteroid Substances 0.000 description 7
- 229960001334 corticosteroids Drugs 0.000 description 7
- 230000018109 developmental process Effects 0.000 description 7
- 239000002988 disease modifying antirheumatic drug Substances 0.000 description 7
- 125000000524 functional group Chemical group 0.000 description 7
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 7
- 238000003780 insertion Methods 0.000 description 7
- 230000037431 insertion Effects 0.000 description 7
- 239000003446 ligand Substances 0.000 description 7
- 239000002773 nucleotide Substances 0.000 description 7
- 125000003729 nucleotide group Chemical group 0.000 description 7
- 239000013612 plasmid Substances 0.000 description 7
- 230000007017 scission Effects 0.000 description 7
- 102100032937 CD40 ligand Human genes 0.000 description 6
- 108010021064 CTLA-4 Antigen Proteins 0.000 description 6
- 229940045513 CTLA4 antagonist Drugs 0.000 description 6
- 102000051628 Interleukin-1 receptor antagonist Human genes 0.000 description 6
- 108700021006 Interleukin-1 receptor antagonist Proteins 0.000 description 6
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 6
- 241001465754 Metazoa Species 0.000 description 6
- 241001529936 Murinae Species 0.000 description 6
- 241000699666 Mus <mouse, genus> Species 0.000 description 6
- QJJXYPPXXYFBGM-LFZNUXCKSA-N Tacrolimus Chemical compound C1C[C@@H](O)[C@H](OC)C[C@@H]1\C=C(/C)[C@@H]1[C@H](C)[C@@H](O)CC(=O)[C@H](CC=C)/C=C(C)/C[C@H](C)C[C@H](OC)[C@H]([C@H](C[C@H]2C)OC)O[C@@]2(O)C(=O)C(=O)N2CCCC[C@H]2C(=O)O1 QJJXYPPXXYFBGM-LFZNUXCKSA-N 0.000 description 6
- 210000000068 Th17 cell Anatomy 0.000 description 6
- 125000001931 aliphatic group Chemical group 0.000 description 6
- 229940124308 alpha-adrenoreceptor antagonist Drugs 0.000 description 6
- 239000005557 antagonist Substances 0.000 description 6
- 229940121375 antifungal agent Drugs 0.000 description 6
- 210000000612 antigen-presenting cell Anatomy 0.000 description 6
- 210000004899 c-terminal region Anatomy 0.000 description 6
- 230000001413 cellular effect Effects 0.000 description 6
- 210000003169 central nervous system Anatomy 0.000 description 6
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 6
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 description 6
- LDCRTTXIJACKKU-ONEGZZNKSA-N dimethyl fumarate Chemical compound COC(=O)\C=C\C(=O)OC LDCRTTXIJACKKU-ONEGZZNKSA-N 0.000 description 6
- 229960004171 hydroxychloroquine Drugs 0.000 description 6
- 230000005934 immune activation Effects 0.000 description 6
- 229960000598 infliximab Drugs 0.000 description 6
- 206010022000 influenza Diseases 0.000 description 6
- 239000003112 inhibitor Substances 0.000 description 6
- 150000002632 lipids Chemical group 0.000 description 6
- 239000003550 marker Substances 0.000 description 6
- 229940021182 non-steroidal anti-inflammatory drug Drugs 0.000 description 6
- 229920000642 polymer Polymers 0.000 description 6
- 229960004618 prednisone Drugs 0.000 description 6
- XOFYZVNMUHMLCC-ZPOLXVRWSA-N prednisone Chemical compound O=C1C=C[C@]2(C)[C@H]3C(=O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 XOFYZVNMUHMLCC-ZPOLXVRWSA-N 0.000 description 6
- 230000008569 process Effects 0.000 description 6
- 125000006239 protecting group Chemical group 0.000 description 6
- 230000010076 replication Effects 0.000 description 6
- RWQNBRDOKXIBIV-UHFFFAOYSA-N thymine Chemical compound CC1=CNC(=O)NC1=O RWQNBRDOKXIBIV-UHFFFAOYSA-N 0.000 description 6
- 238000002255 vaccination Methods 0.000 description 6
- 208000030507 AIDS Diseases 0.000 description 5
- 241000894006 Bacteria Species 0.000 description 5
- 102000017420 CD3 protein, epsilon/gamma/delta subunit Human genes 0.000 description 5
- 108050005493 CD3 protein, epsilon/gamma/delta subunit Proteins 0.000 description 5
- 101150013553 CD40 gene Proteins 0.000 description 5
- 241000701022 Cytomegalovirus Species 0.000 description 5
- 108010087819 Fc receptors Proteins 0.000 description 5
- 102000009109 Fc receptors Human genes 0.000 description 5
- 208000005176 Hepatitis C Diseases 0.000 description 5
- 108010005716 Interferon beta-1a Proteins 0.000 description 5
- 108090000978 Interleukin-4 Proteins 0.000 description 5
- 102000004388 Interleukin-4 Human genes 0.000 description 5
- 102100029193 Low affinity immunoglobulin gamma Fc region receptor III-A Human genes 0.000 description 5
- 208000037581 Persistent Infection Diseases 0.000 description 5
- 239000004473 Threonine Substances 0.000 description 5
- 102100040245 Tumor necrosis factor receptor superfamily member 5 Human genes 0.000 description 5
- 230000004913 activation Effects 0.000 description 5
- 125000000217 alkyl group Chemical group 0.000 description 5
- 125000003118 aryl group Chemical group 0.000 description 5
- 229960003115 certolizumab pegol Drugs 0.000 description 5
- 238000007385 chemical modification Methods 0.000 description 5
- 230000000295 complement effect Effects 0.000 description 5
- 230000004940 costimulation Effects 0.000 description 5
- 229930182912 cyclosporin Natural products 0.000 description 5
- 229960002433 cysteine Drugs 0.000 description 5
- 125000000151 cysteine group Chemical class N[C@@H](CS)C(=O)* 0.000 description 5
- 229940104302 cytosine Drugs 0.000 description 5
- 230000003247 decreasing effect Effects 0.000 description 5
- 239000012636 effector Substances 0.000 description 5
- 230000002255 enzymatic effect Effects 0.000 description 5
- 229960000403 etanercept Drugs 0.000 description 5
- 125000001495 ethyl group Chemical group [H]C([H])([H])C([H])([H])* 0.000 description 5
- 210000003527 eukaryotic cell Anatomy 0.000 description 5
- 229960000556 fingolimod Drugs 0.000 description 5
- KKGQTZUTZRNORY-UHFFFAOYSA-N fingolimod Chemical compound CCCCCCCCC1=CC=C(CCC(N)(CO)CO)C=C1 KKGQTZUTZRNORY-UHFFFAOYSA-N 0.000 description 5
- 229960001743 golimumab Drugs 0.000 description 5
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 5
- 210000004698 lymphocyte Anatomy 0.000 description 5
- 210000004962 mammalian cell Anatomy 0.000 description 5
- 230000007246 mechanism Effects 0.000 description 5
- 239000000047 product Substances 0.000 description 5
- 210000001236 prokaryotic cell Anatomy 0.000 description 5
- 230000001681 protective effect Effects 0.000 description 5
- 239000013636 protein dimer Substances 0.000 description 5
- 238000013518 transcription Methods 0.000 description 5
- 230000035897 transcription Effects 0.000 description 5
- 238000001890 transfection Methods 0.000 description 5
- 229940079023 tysabri Drugs 0.000 description 5
- HMLGSIZOMSVISS-ONJSNURVSA-N (7r)-7-[[(2z)-2-(2-amino-1,3-thiazol-4-yl)-2-(2,2-dimethylpropanoyloxymethoxyimino)acetyl]amino]-3-ethenyl-8-oxo-5-thia-1-azabicyclo[4.2.0]oct-2-ene-2-carboxylic acid Chemical compound N([C@@H]1C(N2C(=C(C=C)CSC21)C(O)=O)=O)C(=O)\C(=N/OCOC(=O)C(C)(C)C)C1=CSC(N)=N1 HMLGSIZOMSVISS-ONJSNURVSA-N 0.000 description 4
- 229930024421 Adenine Natural products 0.000 description 4
- 108091026890 Coding region Proteins 0.000 description 4
- 229930105110 Cyclosporin A Natural products 0.000 description 4
- 102000053602 DNA Human genes 0.000 description 4
- 241000238631 Hexapoda Species 0.000 description 4
- 101000868215 Homo sapiens CD40 ligand Proteins 0.000 description 4
- 101100334515 Homo sapiens FCGR3A gene Proteins 0.000 description 4
- 101001055144 Homo sapiens Interleukin-2 receptor subunit alpha Proteins 0.000 description 4
- 241000725303 Human immunodeficiency virus Species 0.000 description 4
- 102000006496 Immunoglobulin Heavy Chains Human genes 0.000 description 4
- 108010019476 Immunoglobulin Heavy Chains Proteins 0.000 description 4
- 108010008212 Integrin alpha4beta1 Proteins 0.000 description 4
- 102000013462 Interleukin-12 Human genes 0.000 description 4
- 108010065805 Interleukin-12 Proteins 0.000 description 4
- 102100026878 Interleukin-2 receptor subunit alpha Human genes 0.000 description 4
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 4
- 108010083674 Myelin Proteins Proteins 0.000 description 4
- 102000006386 Myelin Proteins Human genes 0.000 description 4
- 206010028980 Neoplasm Diseases 0.000 description 4
- 108091093037 Peptide nucleic acid Proteins 0.000 description 4
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 4
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 4
- FHEAIOHRHQGZPC-KIWGSFCNSA-N acetic acid;(2s)-2-amino-3-(4-hydroxyphenyl)propanoic acid;(2s)-2-aminopentanedioic acid;(2s)-2-aminopropanoic acid;(2s)-2,6-diaminohexanoic acid Chemical compound CC(O)=O.C[C@H](N)C(O)=O.NCCCC[C@H](N)C(O)=O.OC(=O)[C@@H](N)CCC(O)=O.OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 FHEAIOHRHQGZPC-KIWGSFCNSA-N 0.000 description 4
- 230000010933 acylation Effects 0.000 description 4
- 238000005917 acylation reaction Methods 0.000 description 4
- 229960002964 adalimumab Drugs 0.000 description 4
- 229960000643 adenine Drugs 0.000 description 4
- 150000001408 amides Chemical group 0.000 description 4
- 229960004238 anakinra Drugs 0.000 description 4
- 230000000843 anti-fungal effect Effects 0.000 description 4
- 239000002260 anti-inflammatory agent Substances 0.000 description 4
- 229940121363 anti-inflammatory agent Drugs 0.000 description 4
- 230000003110 anti-inflammatory effect Effects 0.000 description 4
- 229960005347 belatacept Drugs 0.000 description 4
- 201000011510 cancer Diseases 0.000 description 4
- 108091008034 costimulatory receptors Proteins 0.000 description 4
- 210000004443 dendritic cell Anatomy 0.000 description 4
- 229960003957 dexamethasone Drugs 0.000 description 4
- 229960004419 dimethyl fumarate Drugs 0.000 description 4
- 229940073621 enbrel Drugs 0.000 description 4
- 238000005516 engineering process Methods 0.000 description 4
- 239000003623 enhancer Substances 0.000 description 4
- 229960003776 glatiramer acetate Drugs 0.000 description 4
- 125000000623 heterocyclic group Chemical group 0.000 description 4
- 230000036039 immunity Effects 0.000 description 4
- 230000002163 immunogen Effects 0.000 description 4
- 229960003444 immunosuppressant agent Drugs 0.000 description 4
- 229940125721 immunosuppressive agent Drugs 0.000 description 4
- 238000000338 in vitro Methods 0.000 description 4
- CGIGDMFJXJATDK-UHFFFAOYSA-N indomethacin Chemical compound CC1=C(CC(O)=O)C2=CC(OC)=CC=C2N1C(=O)C1=CC=C(Cl)C=C1 CGIGDMFJXJATDK-UHFFFAOYSA-N 0.000 description 4
- 230000001939 inductive effect Effects 0.000 description 4
- 208000027866 inflammatory disease Diseases 0.000 description 4
- 230000003993 interaction Effects 0.000 description 4
- KBOPZPXVLCULAV-UHFFFAOYSA-N mesalamine Chemical compound NC1=CC=C(O)C(C(O)=O)=C1 KBOPZPXVLCULAV-UHFFFAOYSA-N 0.000 description 4
- HPNSFSBZBAHARI-UHFFFAOYSA-N micophenolic acid Natural products OC1=C(CC=C(C)CCC(O)=O)C(OC)=C(C)C2=C1C(=O)OC2 HPNSFSBZBAHARI-UHFFFAOYSA-N 0.000 description 4
- KKZJGLLVHKMTCM-UHFFFAOYSA-N mitoxantrone Chemical compound O=C1C2=C(O)C=CC(O)=C2C(=O)C2=C1C(NCCNCCO)=CC=C2NCCNCCO KKZJGLLVHKMTCM-UHFFFAOYSA-N 0.000 description 4
- 210000005012 myelin Anatomy 0.000 description 4
- 229960005027 natalizumab Drugs 0.000 description 4
- 239000000041 non-steroidal anti-inflammatory agent Substances 0.000 description 4
- 238000002360 preparation method Methods 0.000 description 4
- 150000003212 purines Chemical class 0.000 description 4
- 229940116176 remicade Drugs 0.000 description 4
- RYMZZMVNJRMUDD-HGQWONQESA-N simvastatin Chemical compound C([C@H]1[C@@H](C)C=CC2=C[C@H](C)C[C@@H]([C@H]12)OC(=O)C(C)(C)CC)C[C@@H]1C[C@@H](O)CC(=O)O1 RYMZZMVNJRMUDD-HGQWONQESA-N 0.000 description 4
- 238000010532 solid phase synthesis reaction Methods 0.000 description 4
- 150000003431 steroids Chemical class 0.000 description 4
- 230000000638 stimulation Effects 0.000 description 4
- 229910052717 sulfur Inorganic materials 0.000 description 4
- QJJXYPPXXYFBGM-SHYZHZOCSA-N tacrolimus Natural products CO[C@H]1C[C@H](CC[C@@H]1O)C=C(C)[C@H]2OC(=O)[C@H]3CCCCN3C(=O)C(=O)[C@@]4(O)O[C@@H]([C@H](C[C@H]4C)OC)[C@@H](C[C@H](C)CC(=C[C@@H](CC=C)C(=O)C[C@H](O)[C@H]2C)C)OC QJJXYPPXXYFBGM-SHYZHZOCSA-N 0.000 description 4
- 229940021747 therapeutic vaccine Drugs 0.000 description 4
- 241000701161 unidentified adenovirus Species 0.000 description 4
- FPIPGXGPPPQFEQ-UHFFFAOYSA-N 13-cis retinol Natural products OCC=C(C)C=CC=C(C)C=CC1=C(C)CCCC1(C)C FPIPGXGPPPQFEQ-UHFFFAOYSA-N 0.000 description 3
- JRWROCIMSDXGOZ-UHFFFAOYSA-N 4-tert-butyl-n-[4-chloro-2-(1-oxidopyridin-1-ium-4-carbonyl)phenyl]benzenesulfonamide Chemical compound C1=CC(C(C)(C)C)=CC=C1S(=O)(=O)NC1=CC=C(Cl)C=C1C(=O)C1=CC=[N+]([O-])C=C1 JRWROCIMSDXGOZ-UHFFFAOYSA-N 0.000 description 3
- MJZJYWCQPMNPRM-UHFFFAOYSA-N 6,6-dimethyl-1-[3-(2,4,5-trichlorophenoxy)propoxy]-1,6-dihydro-1,3,5-triazine-2,4-diamine Chemical compound CC1(C)N=C(N)N=C(N)N1OCCCOC1=CC(Cl)=C(Cl)C=C1Cl MJZJYWCQPMNPRM-UHFFFAOYSA-N 0.000 description 3
- 108020005544 Antisense RNA Proteins 0.000 description 3
- 241000283690 Bos taurus Species 0.000 description 3
- PTOAARAWEBMLNO-KVQBGUIXSA-N Cladribine Chemical compound C1=NC=2C(N)=NC(Cl)=NC=2N1[C@H]1C[C@H](O)[C@@H](CO)O1 PTOAARAWEBMLNO-KVQBGUIXSA-N 0.000 description 3
- 241000196324 Embryophyta Species 0.000 description 3
- 101000759376 Escherichia phage Mu Tail sheath protein Proteins 0.000 description 3
- WJOHZNCJWYWUJD-IUGZLZTKSA-N Fluocinonide Chemical compound C1([C@@H](F)C2)=CC(=O)C=C[C@]1(C)[C@]1(F)[C@@H]2[C@@H]2C[C@H]3OC(C)(C)O[C@@]3(C(=O)COC(=O)C)[C@@]2(C)C[C@@H]1O WJOHZNCJWYWUJD-IUGZLZTKSA-N 0.000 description 3
- 241000233866 Fungi Species 0.000 description 3
- 102000003886 Glycoproteins Human genes 0.000 description 3
- 108090000288 Glycoproteins Proteins 0.000 description 3
- 206010061192 Haemorrhagic fever Diseases 0.000 description 3
- 241000700721 Hepatitis B virus Species 0.000 description 3
- 101001057504 Homo sapiens Interferon-stimulated gene 20 kDa protein Proteins 0.000 description 3
- 101000917824 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor II-b Proteins 0.000 description 3
- 101000914484 Homo sapiens T-lymphocyte activation antigen CD80 Proteins 0.000 description 3
- 108010091135 Immunoglobulin Fc Fragments Proteins 0.000 description 3
- 102000018071 Immunoglobulin Fc Fragments Human genes 0.000 description 3
- 102100025390 Integrin beta-2 Human genes 0.000 description 3
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 3
- 208000007764 Legionnaires' Disease Diseases 0.000 description 3
- 102100029205 Low affinity immunoglobulin gamma Fc region receptor II-b Human genes 0.000 description 3
- 102000018697 Membrane Proteins Human genes 0.000 description 3
- 108010052285 Membrane Proteins Proteins 0.000 description 3
- 201000009906 Meningitis Diseases 0.000 description 3
- 230000004988 N-glycosylation Effects 0.000 description 3
- 230000004989 O-glycosylation Effects 0.000 description 3
- 241001631646 Papillomaviridae Species 0.000 description 3
- 206010035148 Plague Diseases 0.000 description 3
- 102100024216 Programmed cell death 1 ligand 1 Human genes 0.000 description 3
- 241000725643 Respiratory syncytial virus Species 0.000 description 3
- 235000014680 Saccharomyces cerevisiae Nutrition 0.000 description 3
- 230000006052 T cell proliferation Effects 0.000 description 3
- 102100025237 T-cell surface antigen CD2 Human genes 0.000 description 3
- 102100027222 T-lymphocyte activation antigen CD80 Human genes 0.000 description 3
- FPIPGXGPPPQFEQ-BOOMUCAASA-N Vitamin A Natural products OC/C=C(/C)\C=C\C=C(\C)/C=C/C1=C(C)CCCC1(C)C FPIPGXGPPPQFEQ-BOOMUCAASA-N 0.000 description 3
- QYSXJUFSXHHAJI-XFEUOLMDSA-N Vitamin D3 Natural products C1(/[C@@H]2CC[C@@H]([C@]2(CCC1)C)[C@H](C)CCCC(C)C)=C/C=C1\C[C@@H](O)CCC1=C QYSXJUFSXHHAJI-XFEUOLMDSA-N 0.000 description 3
- 239000004480 active ingredient Substances 0.000 description 3
- FPIPGXGPPPQFEQ-OVSJKPMPSA-N all-trans-retinol Chemical compound OC\C=C(/C)\C=C\C=C(/C)\C=C\C1=C(C)CCCC1(C)C FPIPGXGPPPQFEQ-OVSJKPMPSA-N 0.000 description 3
- 230000004075 alteration Effects 0.000 description 3
- 125000003277 amino group Chemical group 0.000 description 3
- 238000010171 animal model Methods 0.000 description 3
- 230000000840 anti-viral effect Effects 0.000 description 3
- 230000010056 antibody-dependent cellular cytotoxicity Effects 0.000 description 3
- 230000000890 antigenic effect Effects 0.000 description 3
- 125000005161 aryl oxy carbonyl group Chemical group 0.000 description 3
- 229960003270 belimumab Drugs 0.000 description 3
- 239000003124 biologic agent Substances 0.000 description 3
- 235000014633 carbohydrates Nutrition 0.000 description 3
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 3
- 238000010382 chemical cross-linking Methods 0.000 description 3
- 238000006243 chemical reaction Methods 0.000 description 3
- 229940090100 cimzia Drugs 0.000 description 3
- 238000002648 combination therapy Methods 0.000 description 3
- 239000003184 complementary RNA Substances 0.000 description 3
- 229940038717 copaxone Drugs 0.000 description 3
- 229940127089 cytotoxic agent Drugs 0.000 description 3
- 239000002254 cytotoxic agent Substances 0.000 description 3
- 231100000599 cytotoxic agent Toxicity 0.000 description 3
- 229960002806 daclizumab Drugs 0.000 description 3
- 230000006378 damage Effects 0.000 description 3
- 230000001419 dependent effect Effects 0.000 description 3
- VWVSBHGCDBMOOT-IIEHVVJPSA-N desoximetasone Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@@H](C)[C@H](C(=O)CO)[C@@]1(C)C[C@@H]2O VWVSBHGCDBMOOT-IIEHVVJPSA-N 0.000 description 3
- UREBDLICKHMUKA-CXSFZGCWSA-N dexamethasone Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@@H](C)[C@@](C(=O)CO)(O)[C@@]1(C)C[C@@H]2O UREBDLICKHMUKA-CXSFZGCWSA-N 0.000 description 3
- 235000014113 dietary fatty acids Nutrition 0.000 description 3
- 206010014599 encephalitis Diseases 0.000 description 3
- 150000002148 esters Chemical class 0.000 description 3
- 229930195729 fatty acid Natural products 0.000 description 3
- 239000000194 fatty acid Substances 0.000 description 3
- AAXVEMMRQDVLJB-BULBTXNYSA-N fludrocortisone Chemical compound O=C1CC[C@]2(C)[C@@]3(F)[C@@H](O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 AAXVEMMRQDVLJB-BULBTXNYSA-N 0.000 description 3
- 229960002011 fludrocortisone Drugs 0.000 description 3
- 229960000785 fluocinonide Drugs 0.000 description 3
- 229940048921 humira Drugs 0.000 description 3
- 230000002209 hydrophobic effect Effects 0.000 description 3
- RAXXELZNTBOGNW-UHFFFAOYSA-N imidazole Natural products C1=CNC=N1 RAXXELZNTBOGNW-UHFFFAOYSA-N 0.000 description 3
- 230000001900 immune effect Effects 0.000 description 3
- 230000006058 immune tolerance Effects 0.000 description 3
- 229940072221 immunoglobulins Drugs 0.000 description 3
- 230000001771 impaired effect Effects 0.000 description 3
- 230000001976 improved effect Effects 0.000 description 3
- 229940073062 imuran Drugs 0.000 description 3
- 239000012678 infectious agent Substances 0.000 description 3
- 230000028709 inflammatory response Effects 0.000 description 3
- 238000001990 intravenous administration Methods 0.000 description 3
- GKWPCEFFIHSJOE-UHFFFAOYSA-N laquinimod Chemical compound OC=1C2=C(Cl)C=CC=C2N(C)C(=O)C=1C(=O)N(CC)C1=CC=CC=C1 GKWPCEFFIHSJOE-UHFFFAOYSA-N 0.000 description 3
- 229960004577 laquinimod Drugs 0.000 description 3
- VHOGYURTWQBHIL-UHFFFAOYSA-N leflunomide Chemical compound O1N=CC(C(=O)NC=2C=CC(=CC=2)C(F)(F)F)=C1C VHOGYURTWQBHIL-UHFFFAOYSA-N 0.000 description 3
- 230000003902 lesion Effects 0.000 description 3
- 210000004185 liver Anatomy 0.000 description 3
- 239000003120 macrolide antibiotic agent Substances 0.000 description 3
- 210000004379 membrane Anatomy 0.000 description 3
- 239000012528 membrane Substances 0.000 description 3
- 210000003071 memory t lymphocyte Anatomy 0.000 description 3
- 210000001616 monocyte Anatomy 0.000 description 3
- RTGDFNSFWBGLEC-SYZQJQIISA-N mycophenolate mofetil Chemical compound COC1=C(C)C=2COC(=O)C=2C(O)=C1C\C=C(/C)CCC(=O)OCCN1CCOCC1 RTGDFNSFWBGLEC-SYZQJQIISA-N 0.000 description 3
- 229960004866 mycophenolate mofetil Drugs 0.000 description 3
- 239000002777 nucleoside Substances 0.000 description 3
- 229950005751 ocrelizumab Drugs 0.000 description 3
- 229910052760 oxygen Inorganic materials 0.000 description 3
- 238000004806 packaging method and process Methods 0.000 description 3
- 210000000496 pancreas Anatomy 0.000 description 3
- 244000045947 parasite Species 0.000 description 3
- 230000001575 pathological effect Effects 0.000 description 3
- 230000026731 phosphorylation Effects 0.000 description 3
- 238000006366 phosphorylation reaction Methods 0.000 description 3
- 238000001126 phototherapy Methods 0.000 description 3
- 229940072689 plaquenil Drugs 0.000 description 3
- 230000001737 promoting effect Effects 0.000 description 3
- 150000003230 pyrimidines Chemical class 0.000 description 3
- 238000010188 recombinant method Methods 0.000 description 3
- 230000002441 reversible effect Effects 0.000 description 3
- 201000004409 schistosomiasis Diseases 0.000 description 3
- 206010040872 skin infection Diseases 0.000 description 3
- 201000010153 skin papilloma Diseases 0.000 description 3
- 239000007790 solid phase Substances 0.000 description 3
- 241000894007 species Species 0.000 description 3
- 229940071598 stelara Drugs 0.000 description 3
- 230000003637 steroidlike Effects 0.000 description 3
- 150000008163 sugars Chemical class 0.000 description 3
- 230000004083 survival effect Effects 0.000 description 3
- 208000024891 symptom Diseases 0.000 description 3
- 229960000331 teriflunomide Drugs 0.000 description 3
- UTNUDOFZCWSZMS-YFHOEESVSA-N teriflunomide Chemical compound C\C(O)=C(/C#N)C(=O)NC1=CC=C(C(F)(F)F)C=C1 UTNUDOFZCWSZMS-YFHOEESVSA-N 0.000 description 3
- 229940113082 thymine Drugs 0.000 description 3
- 238000013519 translation Methods 0.000 description 3
- 201000008827 tuberculosis Diseases 0.000 description 3
- 241000701447 unidentified baculovirus Species 0.000 description 3
- 229960003824 ustekinumab Drugs 0.000 description 3
- 235000019155 vitamin A Nutrition 0.000 description 3
- 239000011719 vitamin A Substances 0.000 description 3
- 229940045997 vitamin a Drugs 0.000 description 3
- ARAIBEBZBOPLMB-UFGQHTETSA-N zanamivir Chemical compound CC(=O)N[C@@H]1[C@@H](N=C(N)N)C=C(C(O)=O)O[C@H]1[C@H](O)[C@H](O)CO ARAIBEBZBOPLMB-UFGQHTETSA-N 0.000 description 3
- QCHFTSOMWOSFHM-WPRPVWTQSA-N (+)-Pilocarpine Chemical compound C1OC(=O)[C@@H](CC)[C@H]1CC1=CN=CN1C QCHFTSOMWOSFHM-WPRPVWTQSA-N 0.000 description 2
- FFTVPQUHLQBXQZ-KVUCHLLUSA-N (4s,4as,5ar,12ar)-4,7-bis(dimethylamino)-1,10,11,12a-tetrahydroxy-3,12-dioxo-4a,5,5a,6-tetrahydro-4h-tetracene-2-carboxamide Chemical compound C1C2=C(N(C)C)C=CC(O)=C2C(O)=C2[C@@H]1C[C@H]1[C@H](N(C)C)C(=O)C(C(N)=O)=C(O)[C@@]1(O)C2=O FFTVPQUHLQBXQZ-KVUCHLLUSA-N 0.000 description 2
- 125000004178 (C1-C4) alkyl group Chemical group 0.000 description 2
- GVJHHUAWPYXKBD-UHFFFAOYSA-N (±)-α-Tocopherol Chemical compound OC1=C(C)C(C)=C2OC(CCCC(C)CCCC(C)CCCC(C)C)(C)CCC2=C1C GVJHHUAWPYXKBD-UHFFFAOYSA-N 0.000 description 2
- FUFLCEKSBBHCMO-UHFFFAOYSA-N 11-dehydrocorticosterone Natural products O=C1CCC2(C)C3C(=O)CC(C)(C(CC4)C(=O)CO)C4C3CCC2=C1 FUFLCEKSBBHCMO-UHFFFAOYSA-N 0.000 description 2
- GOJUJUVQIVIZAV-UHFFFAOYSA-N 2-amino-4,6-dichloropyrimidine-5-carbaldehyde Chemical group NC1=NC(Cl)=C(C=O)C(Cl)=N1 GOJUJUVQIVIZAV-UHFFFAOYSA-N 0.000 description 2
- FZWGECJQACGGTI-UHFFFAOYSA-N 2-amino-7-methyl-1,7-dihydro-6H-purin-6-one Chemical compound NC1=NC(O)=C2N(C)C=NC2=N1 FZWGECJQACGGTI-UHFFFAOYSA-N 0.000 description 2
- OYIFNHCXNCRBQI-UHFFFAOYSA-N 2-aminoadipic acid Chemical compound OC(=O)C(N)CCCC(O)=O OYIFNHCXNCRBQI-UHFFFAOYSA-N 0.000 description 2
- NUKYPUAOHBNCPY-UHFFFAOYSA-N 4-aminopyridine Chemical compound NC1=CC=NC=C1 NUKYPUAOHBNCPY-UHFFFAOYSA-N 0.000 description 2
- RYVNIFSIEDRLSJ-UHFFFAOYSA-N 5-(hydroxymethyl)cytosine Chemical compound NC=1NC(=O)N=CC=1CO RYVNIFSIEDRLSJ-UHFFFAOYSA-N 0.000 description 2
- LRSASMSXMSNRBT-UHFFFAOYSA-N 5-methylcytosine Chemical compound CC1=CNC(=O)N=C1N LRSASMSXMSNRBT-UHFFFAOYSA-N 0.000 description 2
- UJBCLAXPPIDQEE-UHFFFAOYSA-N 5-prop-1-ynyl-1h-pyrimidine-2,4-dione Chemical compound CC#CC1=CNC(=O)NC1=O UJBCLAXPPIDQEE-UHFFFAOYSA-N 0.000 description 2
- PEHVGBZKEYRQSX-UHFFFAOYSA-N 7-deaza-adenine Chemical compound NC1=NC=NC2=C1C=CN2 PEHVGBZKEYRQSX-UHFFFAOYSA-N 0.000 description 2
- HCGHYQLFMPXSDU-UHFFFAOYSA-N 7-methyladenine Chemical compound C1=NC(N)=C2N(C)C=NC2=N1 HCGHYQLFMPXSDU-UHFFFAOYSA-N 0.000 description 2
- KDCGOANMDULRCW-UHFFFAOYSA-N 7H-purine Chemical compound N1=CNC2=NC=NC2=C1 KDCGOANMDULRCW-UHFFFAOYSA-N 0.000 description 2
- LRFVTYWOQMYALW-UHFFFAOYSA-N 9H-xanthine Chemical compound O=C1NC(=O)NC2=C1NC=N2 LRFVTYWOQMYALW-UHFFFAOYSA-N 0.000 description 2
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 2
- GFFGJBXGBJISGV-UHFFFAOYSA-N Adenine Chemical compound NC1=NC=NC2=C1N=CN2 GFFGJBXGBJISGV-UHFFFAOYSA-N 0.000 description 2
- 206010001257 Adenoviral conjunctivitis Diseases 0.000 description 2
- 102100027211 Albumin Human genes 0.000 description 2
- 108010088751 Albumins Proteins 0.000 description 2
- BSYNRYMUTXBXSQ-UHFFFAOYSA-N Aspirin Chemical compound CC(=O)OC1=CC=CC=C1C(O)=O BSYNRYMUTXBXSQ-UHFFFAOYSA-N 0.000 description 2
- XHVAWZZCDCWGBK-WYRLRVFGSA-M Aurothioglucose Chemical compound OC[C@H]1O[C@H](S[Au])[C@H](O)[C@@H](O)[C@@H]1O XHVAWZZCDCWGBK-WYRLRVFGSA-M 0.000 description 2
- 102100022005 B-lymphocyte antigen CD20 Human genes 0.000 description 2
- 108010074708 B7-H1 Antigen Proteins 0.000 description 2
- 208000004429 Bacillary Dysentery Diseases 0.000 description 2
- KUVIULQEHSCUHY-XYWKZLDCSA-N Beclometasone Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(Cl)[C@@H]1[C@@H]1C[C@H](C)[C@@](C(=O)COC(=O)CC)(OC(=O)CC)[C@@]1(C)C[C@@H]2O KUVIULQEHSCUHY-XYWKZLDCSA-N 0.000 description 2
- 206010005098 Blastomycosis Diseases 0.000 description 2
- 102000004219 Brain-derived neurotrophic factor Human genes 0.000 description 2
- 108090000715 Brain-derived neurotrophic factor Proteins 0.000 description 2
- 206010006448 Bronchiolitis Diseases 0.000 description 2
- QWOJMRHUQHTCJG-UHFFFAOYSA-N CC([CH2-])=O Chemical compound CC([CH2-])=O QWOJMRHUQHTCJG-UHFFFAOYSA-N 0.000 description 2
- 108010029697 CD40 Ligand Proteins 0.000 description 2
- 102100032912 CD44 antigen Human genes 0.000 description 2
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 2
- 241000222122 Candida albicans Species 0.000 description 2
- 241000282472 Canis lupus familiaris Species 0.000 description 2
- 102100033668 Cartilage matrix protein Human genes 0.000 description 2
- 241000224483 Coccidia Species 0.000 description 2
- 241000223205 Coccidioides immitis Species 0.000 description 2
- 108700010070 Codon Usage Proteins 0.000 description 2
- 241000711573 Coronaviridae Species 0.000 description 2
- MFYSYFVPBJMHGN-ZPOLXVRWSA-N Cortisone Chemical compound O=C1CC[C@]2(C)[C@H]3C(=O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 MFYSYFVPBJMHGN-ZPOLXVRWSA-N 0.000 description 2
- MFYSYFVPBJMHGN-UHFFFAOYSA-N Cortisone Natural products O=C1CCC2(C)C3C(=O)CC(C)(C(CC4)(O)C(=O)CO)C4C3CCC2=C1 MFYSYFVPBJMHGN-UHFFFAOYSA-N 0.000 description 2
- 201000007336 Cryptococcosis Diseases 0.000 description 2
- 241000221204 Cryptococcus neoformans Species 0.000 description 2
- 206010011831 Cytomegalovirus infection Diseases 0.000 description 2
- DYDCUQKUCUHJBH-UWTATZPHSA-N D-Cycloserine Chemical compound N[C@@H]1CONC1=O DYDCUQKUCUHJBH-UWTATZPHSA-N 0.000 description 2
- DYDCUQKUCUHJBH-UHFFFAOYSA-N D-Cycloserine Natural products NC1CONC1=O DYDCUQKUCUHJBH-UHFFFAOYSA-N 0.000 description 2
- SRBFZHDQGSBBOR-IOVATXLUSA-N D-xylopyranose Chemical compound O[C@@H]1COC(O)[C@H](O)[C@H]1O SRBFZHDQGSBBOR-IOVATXLUSA-N 0.000 description 2
- 230000006820 DNA synthesis Effects 0.000 description 2
- FMGSKLZLMKYGDP-UHFFFAOYSA-N Dehydroepiandrosterone Natural products C1C(O)CCC2(C)C3CCC(C)(C(CC4)=O)C4C3CC=C21 FMGSKLZLMKYGDP-UHFFFAOYSA-N 0.000 description 2
- 208000016192 Demyelinating disease Diseases 0.000 description 2
- 208000001490 Dengue Diseases 0.000 description 2
- 206010012310 Dengue fever Diseases 0.000 description 2
- 241000702421 Dependoparvovirus Species 0.000 description 2
- 206010012735 Diarrhoea Diseases 0.000 description 2
- 108010024212 E-Selectin Proteins 0.000 description 2
- 102100023471 E-selectin Human genes 0.000 description 2
- 101150013359 E7 gene Proteins 0.000 description 2
- 102100025137 Early activation antigen CD69 Human genes 0.000 description 2
- 241000709661 Enterovirus Species 0.000 description 2
- 241000283086 Equidae Species 0.000 description 2
- 201000000297 Erysipelas Diseases 0.000 description 2
- 208000007985 Erythema Infectiosum Diseases 0.000 description 2
- 241000282326 Felis catus Species 0.000 description 2
- 201000006353 Filariasis Diseases 0.000 description 2
- 241000711950 Filoviridae Species 0.000 description 2
- POPFMWWJOGLOIF-XWCQMRHXSA-N Flurandrenolide Chemical compound C1([C@@H](F)C2)=CC(=O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2C[C@H]3OC(C)(C)O[C@@]3(C(=O)CO)[C@@]2(C)C[C@@H]1O POPFMWWJOGLOIF-XWCQMRHXSA-N 0.000 description 2
- 208000005577 Gastroenteritis Diseases 0.000 description 2
- 206010018364 Glomerulonephritis Diseases 0.000 description 2
- 102000005720 Glutathione transferase Human genes 0.000 description 2
- 108010070675 Glutathione transferase Proteins 0.000 description 2
- 102000005744 Glycoside Hydrolases Human genes 0.000 description 2
- 108010031186 Glycoside Hydrolases Proteins 0.000 description 2
- 208000031886 HIV Infections Diseases 0.000 description 2
- 208000004898 Herpes Labialis Diseases 0.000 description 2
- 208000007514 Herpes zoster Diseases 0.000 description 2
- 101000897405 Homo sapiens B-lymphocyte antigen CD20 Proteins 0.000 description 2
- 101000868273 Homo sapiens CD44 antigen Proteins 0.000 description 2
- 101000889276 Homo sapiens Cytotoxic T-lymphocyte protein 4 Proteins 0.000 description 2
- 101000934374 Homo sapiens Early activation antigen CD69 Proteins 0.000 description 2
- 101000935043 Homo sapiens Integrin beta-1 Proteins 0.000 description 2
- 101000798109 Homo sapiens Melanotransferrin Proteins 0.000 description 2
- 101000581981 Homo sapiens Neural cell adhesion molecule 1 Proteins 0.000 description 2
- 241000713772 Human immunodeficiency virus 1 Species 0.000 description 2
- 241000713340 Human immunodeficiency virus 2 Species 0.000 description 2
- PMMYEEVYMWASQN-DMTCNVIQSA-N Hydroxyproline Chemical compound O[C@H]1CN[C@H](C(O)=O)C1 PMMYEEVYMWASQN-DMTCNVIQSA-N 0.000 description 2
- HEFNNWSXXWATRW-UHFFFAOYSA-N Ibuprofen Chemical compound CC(C)CC1=CC=C(C(C)C(O)=O)C=C1 HEFNNWSXXWATRW-UHFFFAOYSA-N 0.000 description 2
- 108010073807 IgG Receptors Proteins 0.000 description 2
- 102000009490 IgG Receptors Human genes 0.000 description 2
- 206010021531 Impetigo Diseases 0.000 description 2
- 102000004877 Insulin Human genes 0.000 description 2
- 108090001061 Insulin Proteins 0.000 description 2
- 102100034353 Integrase Human genes 0.000 description 2
- 102100025304 Integrin beta-1 Human genes 0.000 description 2
- 108010050904 Interferons Proteins 0.000 description 2
- 102000014150 Interferons Human genes 0.000 description 2
- 108010002350 Interleukin-2 Proteins 0.000 description 2
- 102000000588 Interleukin-2 Human genes 0.000 description 2
- 108010002616 Interleukin-5 Proteins 0.000 description 2
- 102000004890 Interleukin-8 Human genes 0.000 description 2
- 108090001007 Interleukin-8 Proteins 0.000 description 2
- KJHKTHWMRKYKJE-SUGCFTRWSA-N Kaletra Chemical compound N1([C@@H](C(C)C)C(=O)N[C@H](C[C@H](O)[C@H](CC=2C=CC=CC=2)NC(=O)COC=2C(=CC=CC=2C)C)CC=2C=CC=CC=2)CCCNC1=O KJHKTHWMRKYKJE-SUGCFTRWSA-N 0.000 description 2
- 108010092694 L-Selectin Proteins 0.000 description 2
- 150000008575 L-amino acids Chemical class 0.000 description 2
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 2
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 2
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 2
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 2
- 125000000174 L-prolyl group Chemical group [H]N1C([H])([H])C([H])([H])C([H])([H])[C@@]1([H])C(*)=O 0.000 description 2
- 102000016551 L-selectin Human genes 0.000 description 2
- 125000000510 L-tryptophano group Chemical group [H]C1=C([H])C([H])=C2N([H])C([H])=C(C([H])([H])[C@@]([H])(C(O[H])=O)N([H])[*])C2=C1[H] 0.000 description 2
- 241000713666 Lentivirus Species 0.000 description 2
- 206010024229 Leprosy Diseases 0.000 description 2
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 2
- 208000032514 Leukocytoclastic vasculitis Diseases 0.000 description 2
- 108010064548 Lymphocyte Function-Associated Antigen-1 Proteins 0.000 description 2
- 241000712899 Lymphocytic choriomeningitis mammarenavirus Species 0.000 description 2
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 2
- 239000004472 Lysine Substances 0.000 description 2
- 102100032239 Melanotransferrin Human genes 0.000 description 2
- 102000005741 Metalloproteases Human genes 0.000 description 2
- 108010006035 Metalloproteases Proteins 0.000 description 2
- 108010000123 Myelin-Oligodendrocyte Glycoprotein Proteins 0.000 description 2
- 102100023302 Myelin-oligodendrocyte glycoprotein Human genes 0.000 description 2
- OVRNDRQMDRJTHS-CBQIKETKSA-N N-Acetyl-D-Galactosamine Chemical compound CC(=O)N[C@H]1[C@@H](O)O[C@H](CO)[C@H](O)[C@@H]1O OVRNDRQMDRJTHS-CBQIKETKSA-N 0.000 description 2
- 108010081735 N-Ethylmaleimide-Sensitive Proteins Proteins 0.000 description 2
- MBLBDJOUHNCFQT-UHFFFAOYSA-N N-acetyl-D-galactosamine Natural products CC(=O)NC(C=O)C(O)C(O)C(O)CO MBLBDJOUHNCFQT-UHFFFAOYSA-N 0.000 description 2
- CMWTZPSULFXXJA-UHFFFAOYSA-N Naproxen Natural products C1=C(C(C)C(O)=O)C=CC2=CC(OC)=CC=C21 CMWTZPSULFXXJA-UHFFFAOYSA-N 0.000 description 2
- 241000244206 Nematoda Species 0.000 description 2
- 108010025020 Nerve Growth Factor Proteins 0.000 description 2
- 102000015336 Nerve Growth Factor Human genes 0.000 description 2
- 102100027347 Neural cell adhesion molecule 1 Human genes 0.000 description 2
- 102000008763 Neurofilament Proteins Human genes 0.000 description 2
- 108010088373 Neurofilament Proteins Proteins 0.000 description 2
- 108090000742 Neurotrophin 3 Proteins 0.000 description 2
- 102100029268 Neurotrophin-3 Human genes 0.000 description 2
- 241000243985 Onchocerca volvulus Species 0.000 description 2
- MITFXPHMIHQXPI-UHFFFAOYSA-N Oraflex Chemical compound N=1C2=CC(C(C(O)=O)C)=CC=C2OC=1C1=CC=C(Cl)C=C1 MITFXPHMIHQXPI-UHFFFAOYSA-N 0.000 description 2
- 206010067152 Oral herpes Diseases 0.000 description 2
- 208000002606 Paramyxoviridae Infections Diseases 0.000 description 2
- 241000709664 Picornaviridae Species 0.000 description 2
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 2
- 208000006265 Renal cell carcinoma Diseases 0.000 description 2
- 241000702670 Rotavirus Species 0.000 description 2
- 206010039438 Salmonella Infections Diseases 0.000 description 2
- 206010040047 Sepsis Diseases 0.000 description 2
- 206010040070 Septic Shock Diseases 0.000 description 2
- 201000003176 Severe Acute Respiratory Syndrome Diseases 0.000 description 2
- 241000713311 Simian immunodeficiency virus Species 0.000 description 2
- 208000001203 Smallpox Diseases 0.000 description 2
- 241000194017 Streptococcus Species 0.000 description 2
- 238000000692 Student's t-test Methods 0.000 description 2
- 210000000662 T-lymphocyte subset Anatomy 0.000 description 2
- 108700002718 TACI receptor-IgG Fc fragment fusion Proteins 0.000 description 2
- 101150052863 THY1 gene Proteins 0.000 description 2
- RYYWUUFWQRZTIU-UHFFFAOYSA-N Thiophosphoric acid Chemical class OP(O)(S)=O RYYWUUFWQRZTIU-UHFFFAOYSA-N 0.000 description 2
- 208000002474 Tinea Diseases 0.000 description 2
- 108020004566 Transfer RNA Proteins 0.000 description 2
- 108700019146 Transgenes Proteins 0.000 description 2
- 208000004938 Trematode Infections Diseases 0.000 description 2
- ISAKRJDGNUQOIC-UHFFFAOYSA-N Uracil Chemical compound O=C1C=CNC(=O)N1 ISAKRJDGNUQOIC-UHFFFAOYSA-N 0.000 description 2
- DRTQHJPVMGBUCF-XVFCMESISA-N Uridine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C=C1 DRTQHJPVMGBUCF-XVFCMESISA-N 0.000 description 2
- 241000870995 Variola Species 0.000 description 2
- 108010000134 Vascular Cell Adhesion Molecule-1 Proteins 0.000 description 2
- 108010073929 Vascular Endothelial Growth Factor A Proteins 0.000 description 2
- 102000005789 Vascular Endothelial Growth Factors Human genes 0.000 description 2
- 108010019530 Vascular Endothelial Growth Factors Proteins 0.000 description 2
- 102100023543 Vascular cell adhesion protein 1 Human genes 0.000 description 2
- 102100035054 Vesicle-fusing ATPase Human genes 0.000 description 2
- 229930003316 Vitamin D Natural products 0.000 description 2
- 239000005862 Whey Substances 0.000 description 2
- 102000007544 Whey Proteins Human genes 0.000 description 2
- 108010046377 Whey Proteins Proteins 0.000 description 2
- HCHKCACWOHOZIP-UHFFFAOYSA-N Zinc Chemical compound [Zn] HCHKCACWOHOZIP-UHFFFAOYSA-N 0.000 description 2
- AAYJNPGTWYJOET-VURLEEIPSA-N acetic acid (4S)-4-[[(2S,3S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[2-[[(2S)-2-[[(2S)-1-[(2S)-6-amino-2-[[2-[[(2S)-2-[[(2S)-2-[[(2S)-6-amino-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S,3S)-2-[[(2S)-2-amino-5-(diaminomethylideneamino)pentanoyl]amino]-3-methylpentanoyl]amino]-3-(1H-imidazol-4-yl)propanoyl]amino]-4-methylsulfanylbutanoyl]amino]-3-methylbutanoyl]amino]-3-(4-hydroxyphenyl)propanoyl]amino]-3-hydroxypropanoyl]amino]hexanoyl]amino]-5-(diaminomethylideneamino)pentanoyl]amino]-3-phosphonooxypropanoyl]amino]acetyl]amino]hexanoyl]pyrrolidine-2-carbonyl]amino]-5-(diaminomethylideneamino)pentanoyl]amino]acetyl]amino]-3-(4-hydroxyphenyl)propanoyl]amino]propanoyl]amino]-3-phenylpropanoyl]amino]-3-methylpentanoyl]amino]-5-[[(1S)-1-carboxy-2-(4-hydroxyphenyl)ethyl]amino]-5-oxopentanoic acid Chemical compound CC(O)=O.CC[C@H](C)[C@H](NC(=O)[C@@H](N)CCCN=C(N)N)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](COP(O)(O)=O)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCN=C(N)N)C(=O)NCC(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](C)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](Cc1ccc(O)cc1)C(O)=O AAYJNPGTWYJOET-VURLEEIPSA-N 0.000 description 2
- 150000007513 acids Chemical class 0.000 description 2
- 125000002252 acyl group Chemical group 0.000 description 2
- ORILYTVJVMAKLC-UHFFFAOYSA-N adamantane Chemical compound C1C(C2)CC3CC1CC2C3 ORILYTVJVMAKLC-UHFFFAOYSA-N 0.000 description 2
- 230000033289 adaptive immune response Effects 0.000 description 2
- 230000002411 adverse Effects 0.000 description 2
- 229960002459 alefacept Drugs 0.000 description 2
- 229960000548 alemtuzumab Drugs 0.000 description 2
- 125000004453 alkoxycarbonyl group Chemical group 0.000 description 2
- JAZBEHYOTPTENJ-JLNKQSITSA-N all-cis-5,8,11,14,17-icosapentaenoic acid Chemical compound CC\C=C/C\C=C/C\C=C/C\C=C/C\C=C/CCCC(O)=O JAZBEHYOTPTENJ-JLNKQSITSA-N 0.000 description 2
- NUZWLKWWNNJHPT-UHFFFAOYSA-N anthralin Chemical compound C1C2=CC=CC(O)=C2C(=O)C2=C1C=CC=C2O NUZWLKWWNNJHPT-UHFFFAOYSA-N 0.000 description 2
- 239000003242 anti bacterial agent Substances 0.000 description 2
- 229940088710 antibiotic agent Drugs 0.000 description 2
- 238000013459 approach Methods 0.000 description 2
- 238000003556 assay Methods 0.000 description 2
- 229950009925 atacicept Drugs 0.000 description 2
- 230000006472 autoimmune response Effects 0.000 description 2
- 229940003504 avonex Drugs 0.000 description 2
- 229940022836 benlysta Drugs 0.000 description 2
- 229960002537 betamethasone Drugs 0.000 description 2
- UREBDLICKHMUKA-DVTGEIKXSA-N betamethasone Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@H](C)[C@@](C(=O)CO)(O)[C@@]1(C)C[C@@H]2O UREBDLICKHMUKA-DVTGEIKXSA-N 0.000 description 2
- 229940021459 betaseron Drugs 0.000 description 2
- 230000007321 biological mechanism Effects 0.000 description 2
- 229960000074 biopharmaceutical Drugs 0.000 description 2
- 229940077737 brain-derived neurotrophic factor Drugs 0.000 description 2
- 229960002874 briakinumab Drugs 0.000 description 2
- 239000011575 calcium Substances 0.000 description 2
- 229910052791 calcium Inorganic materials 0.000 description 2
- 239000001506 calcium phosphate Substances 0.000 description 2
- 229910000389 calcium phosphate Inorganic materials 0.000 description 2
- 235000011010 calcium phosphates Nutrition 0.000 description 2
- 229910052799 carbon Inorganic materials 0.000 description 2
- 230000015556 catabolic process Effects 0.000 description 2
- 229940107810 cellcept Drugs 0.000 description 2
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 2
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical group C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 2
- 208000037976 chronic inflammation Diseases 0.000 description 2
- 230000006020 chronic inflammation Effects 0.000 description 2
- 238000010367 cloning Methods 0.000 description 2
- 230000007699 co-inhibitory pathway Effects 0.000 description 2
- 230000001276 controlling effect Effects 0.000 description 2
- 229960004544 cortisone Drugs 0.000 description 2
- 230000008878 coupling Effects 0.000 description 2
- 238000010168 coupling process Methods 0.000 description 2
- 238000005859 coupling reaction Methods 0.000 description 2
- 125000000753 cycloalkyl group Chemical group 0.000 description 2
- 239000003255 cyclooxygenase 2 inhibitor Substances 0.000 description 2
- 229960003077 cycloserine Drugs 0.000 description 2
- 231100000433 cytotoxic Toxicity 0.000 description 2
- 230000001472 cytotoxic effect Effects 0.000 description 2
- 230000007423 decrease Effects 0.000 description 2
- 230000002950 deficient Effects 0.000 description 2
- 230000022811 deglycosylation Effects 0.000 description 2
- 238000006731 degradation reaction Methods 0.000 description 2
- FMGSKLZLMKYGDP-USOAJAOKSA-N dehydroepiandrosterone Chemical compound C1[C@@H](O)CC[C@]2(C)[C@H]3CC[C@](C)(C(CC4)=O)[C@@H]4[C@@H]3CC=C21 FMGSKLZLMKYGDP-USOAJAOKSA-N 0.000 description 2
- 230000002939 deleterious effect Effects 0.000 description 2
- YSMODUONRAFBET-UHFFFAOYSA-N delta-DL-hydroxylysine Natural products NCC(O)CCC(N)C(O)=O YSMODUONRAFBET-UHFFFAOYSA-N 0.000 description 2
- 208000025729 dengue disease Diseases 0.000 description 2
- 238000013461 design Methods 0.000 description 2
- 229960002593 desoximetasone Drugs 0.000 description 2
- 229950009888 dichlorisone Drugs 0.000 description 2
- YNNURTVKPVJVEI-GSLJADNHSA-N dichlorisone Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(Cl)[C@@H]1[C@@H]1CC[C@@](C(=O)COC(=O)C)(O)[C@@]1(C)C[C@@H]2Cl YNNURTVKPVJVEI-GSLJADNHSA-N 0.000 description 2
- 229960001259 diclofenac Drugs 0.000 description 2
- DCOPUUMXTXDBNB-UHFFFAOYSA-N diclofenac Chemical compound OC(=O)CC1=CC=CC=C1NC1=C(Cl)C=CC=C1Cl DCOPUUMXTXDBNB-UHFFFAOYSA-N 0.000 description 2
- 235000005911 diet Nutrition 0.000 description 2
- 230000037213 diet Effects 0.000 description 2
- ZUOUZKKEUPVFJK-UHFFFAOYSA-N diphenyl Chemical compound C1=CC=CC=C1C1=CC=CC=C1 ZUOUZKKEUPVFJK-UHFFFAOYSA-N 0.000 description 2
- 238000009826 distribution Methods 0.000 description 2
- 229960002311 dithranol Drugs 0.000 description 2
- PMMYEEVYMWASQN-UHFFFAOYSA-N dl-hydroxyproline Natural products OC1C[NH2+]C(C([O-])=O)C1 PMMYEEVYMWASQN-UHFFFAOYSA-N 0.000 description 2
- NOPFSRXAKWQILS-UHFFFAOYSA-N docosan-1-ol Chemical compound CCCCCCCCCCCCCCCCCCCCCCO NOPFSRXAKWQILS-UHFFFAOYSA-N 0.000 description 2
- 230000003828 downregulation Effects 0.000 description 2
- 229960000284 efalizumab Drugs 0.000 description 2
- 235000020673 eicosapentaenoic acid Nutrition 0.000 description 2
- 229960005135 eicosapentaenoic acid Drugs 0.000 description 2
- JAZBEHYOTPTENJ-UHFFFAOYSA-N eicosapentaenoic acid Natural products CCC=CCC=CCC=CCC=CCC=CCCCC(O)=O JAZBEHYOTPTENJ-UHFFFAOYSA-N 0.000 description 2
- 201000002491 encephalomyelitis Diseases 0.000 description 2
- 108010078428 env Gene Products Proteins 0.000 description 2
- 230000007515 enzymatic degradation Effects 0.000 description 2
- YSMODUONRAFBET-UHNVWZDZSA-N erythro-5-hydroxy-L-lysine Chemical compound NC[C@H](O)CC[C@H](N)C(O)=O YSMODUONRAFBET-UHNVWZDZSA-N 0.000 description 2
- 230000007717 exclusion Effects 0.000 description 2
- 229940077362 extavia Drugs 0.000 description 2
- 208000006275 fascioliasis Diseases 0.000 description 2
- 150000004665 fatty acids Chemical class 0.000 description 2
- NJNWEGFJCGYWQT-VSXGLTOVSA-N fluclorolone acetonide Chemical compound C1([C@@H](F)C2)=CC(=O)C=C[C@]1(C)[C@]1(Cl)[C@@H]2[C@@H]2C[C@H]3OC(C)(C)O[C@@]3(C(=O)CO)[C@@]2(C)C[C@@H]1Cl NJNWEGFJCGYWQT-VSXGLTOVSA-N 0.000 description 2
- RFHAOTPXVQNOHP-UHFFFAOYSA-N fluconazole Chemical compound C1=NC=NN1CC(C=1C(=CC(F)=CC=1)F)(O)CN1C=NC=N1 RFHAOTPXVQNOHP-UHFFFAOYSA-N 0.000 description 2
- 229960004511 fludroxycortide Drugs 0.000 description 2
- 229960003238 fluprednidene Drugs 0.000 description 2
- YVHXHNGGPURVOS-SBTDHBFYSA-N fluprednidene Chemical compound O=C1C=C[C@]2(C)[C@@]3(F)[C@@H](O)C[C@](C)([C@@](C(=C)C4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 YVHXHNGGPURVOS-SBTDHBFYSA-N 0.000 description 2
- 230000002538 fungal effect Effects 0.000 description 2
- 230000002068 genetic effect Effects 0.000 description 2
- 239000003862 glucocorticoid Substances 0.000 description 2
- 125000001475 halogen functional group Chemical group 0.000 description 2
- 244000000013 helminth Species 0.000 description 2
- 238000009235 helminthic therapy Methods 0.000 description 2
- 206010073071 hepatocellular carcinoma Diseases 0.000 description 2
- 231100000844 hepatocellular carcinoma Toxicity 0.000 description 2
- 125000005842 heteroatom Chemical group 0.000 description 2
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 2
- JYGXADMDTFJGBT-VWUMJDOOSA-N hydrocortisone Chemical compound O=C1CC[C@]2(C)[C@H]3[C@@H](O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 JYGXADMDTFJGBT-VWUMJDOOSA-N 0.000 description 2
- 125000001165 hydrophobic group Chemical group 0.000 description 2
- 229960002591 hydroxyproline Drugs 0.000 description 2
- FDGQSTZJBFJUBT-UHFFFAOYSA-N hypoxanthine Chemical compound O=C1NC=NC2=C1NC=N2 FDGQSTZJBFJUBT-UHFFFAOYSA-N 0.000 description 2
- 229960001680 ibuprofen Drugs 0.000 description 2
- 230000008102 immune modulation Effects 0.000 description 2
- 239000002955 immunomodulating agent Substances 0.000 description 2
- 238000009169 immunotherapy Methods 0.000 description 2
- 238000011065 in-situ storage Methods 0.000 description 2
- 229960000905 indomethacin Drugs 0.000 description 2
- 230000006698 induction Effects 0.000 description 2
- 201000006747 infectious mononucleosis Diseases 0.000 description 2
- 229940125396 insulin Drugs 0.000 description 2
- 230000002452 interceptive effect Effects 0.000 description 2
- 229940096397 interleukin-8 Drugs 0.000 description 2
- XKTZWUACRZHVAN-VADRZIEHSA-N interleukin-8 Chemical compound C([C@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@@H](NC(C)=O)CCSC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N[C@@H](CCSC)C(=O)N1[C@H](CCC1)C(=O)N1[C@H](CCC1)C(=O)N[C@@H](C)C(=O)N[C@H](CC(O)=O)C(=O)N[C@H](CCC(O)=O)C(=O)N[C@H](CC(O)=O)C(=O)N[C@H](CC=1C=CC(O)=CC=1)C(=O)N[C@H](CO)C(=O)N1[C@H](CCC1)C(N)=O)C1=CC=CC=C1 XKTZWUACRZHVAN-VADRZIEHSA-N 0.000 description 2
- 102000010681 interleukin-8 receptors Human genes 0.000 description 2
- 108010038415 interleukin-8 receptors Proteins 0.000 description 2
- 230000003834 intracellular effect Effects 0.000 description 2
- 229940008228 intravenous immunoglobulins Drugs 0.000 description 2
- 238000002955 isolation Methods 0.000 description 2
- 229960000310 isoleucine Drugs 0.000 description 2
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 2
- 229940054136 kineret Drugs 0.000 description 2
- 229960001627 lamivudine Drugs 0.000 description 2
- JTEGQNOMFQHVDC-NKWVEPMBSA-N lamivudine Chemical class O=C1N=C(N)C=CN1[C@H]1O[C@@H](CO)SC1 JTEGQNOMFQHVDC-NKWVEPMBSA-N 0.000 description 2
- 229960000681 leflunomide Drugs 0.000 description 2
- 230000004807 localization Effects 0.000 description 2
- 229960004525 lopinavir Drugs 0.000 description 2
- 229920001427 mPEG Polymers 0.000 description 2
- 210000002540 macrophage Anatomy 0.000 description 2
- 201000004792 malaria Diseases 0.000 description 2
- 210000005075 mammary gland Anatomy 0.000 description 2
- 240000004308 marijuana Species 0.000 description 2
- 239000002609 medium Substances 0.000 description 2
- GLVAUDGFNGKCSF-UHFFFAOYSA-N mercaptopurine Chemical compound S=C1NC=NC2=C1NC=N2 GLVAUDGFNGKCSF-UHFFFAOYSA-N 0.000 description 2
- 235000013336 milk Nutrition 0.000 description 2
- 239000008267 milk Substances 0.000 description 2
- 210000004080 milk Anatomy 0.000 description 2
- 229960001156 mitoxantrone Drugs 0.000 description 2
- 230000000897 modulatory effect Effects 0.000 description 2
- 238000010369 molecular cloning Methods 0.000 description 2
- HPNSFSBZBAHARI-RUDMXATFSA-N mycophenolic acid Chemical compound OC1=C(C\C=C(/C)CCC(O)=O)C(OC)=C(C)C2=C1C(=O)OC2 HPNSFSBZBAHARI-RUDMXATFSA-N 0.000 description 2
- DIKSYHCCYVYKRO-UHFFFAOYSA-N n,5-diethyl-4-hydroxy-1-methyl-2-oxo-n-phenylquinoline-3-carboxamide Chemical compound OC=1C2=C(CC)C=CC=C2N(C)C(=O)C=1C(=O)N(CC)C1=CC=CC=C1 DIKSYHCCYVYKRO-UHFFFAOYSA-N 0.000 description 2
- 229960002009 naproxen Drugs 0.000 description 2
- CMWTZPSULFXXJA-VIFPVBQESA-N naproxen Chemical compound C1=C([C@H](C)C(O)=O)C=CC2=CC(OC)=CC=C21 CMWTZPSULFXXJA-VIFPVBQESA-N 0.000 description 2
- 210000000581 natural killer T-cell Anatomy 0.000 description 2
- 229940053128 nerve growth factor Drugs 0.000 description 2
- 210000005044 neurofilament Anatomy 0.000 description 2
- 210000002569 neuron Anatomy 0.000 description 2
- 229940032018 neurotrophin 3 Drugs 0.000 description 2
- 229910052757 nitrogen Inorganic materials 0.000 description 2
- 229960003301 nivolumab Drugs 0.000 description 2
- 150000003833 nucleoside derivatives Chemical class 0.000 description 2
- 229960003752 oseltamivir Drugs 0.000 description 2
- NENPYTRHICXVCS-YNEHKIRRSA-N oseltamivir acid Chemical compound CCC(CC)O[C@@H]1C=C(C(O)=O)C[C@H](N)[C@H]1NC(C)=O NENPYTRHICXVCS-YNEHKIRRSA-N 0.000 description 2
- 230000006320 pegylation Effects 0.000 description 2
- 230000035515 penetration Effects 0.000 description 2
- 125000001997 phenyl group Chemical group [H]C1=C([H])C([H])=C(*)C([H])=C1[H] 0.000 description 2
- ZJAOAACCNHFJAH-UHFFFAOYSA-N phosphonoformic acid Chemical compound OC(=O)P(O)(O)=O ZJAOAACCNHFJAH-UHFFFAOYSA-N 0.000 description 2
- 125000004437 phosphorous atom Chemical group 0.000 description 2
- 229910052698 phosphorus Inorganic materials 0.000 description 2
- DCWXELXMIBXGTH-UHFFFAOYSA-N phosphotyrosine Chemical compound OC(=O)C(N)CC1=CC=C(OP(O)(O)=O)C=C1 DCWXELXMIBXGTH-UHFFFAOYSA-N 0.000 description 2
- 230000008488 polyadenylation Effects 0.000 description 2
- 230000004481 post-translational protein modification Effects 0.000 description 2
- 229960002847 prasterone Drugs 0.000 description 2
- 230000037457 pro-inflammatory mechanism Effects 0.000 description 2
- 230000000069 prophylactic effect Effects 0.000 description 2
- ZCCUUQDIBDJBTK-UHFFFAOYSA-N psoralen Chemical compound C1=C2OC(=O)C=CC2=CC2=C1OC=C2 ZCCUUQDIBDJBTK-UHFFFAOYSA-N 0.000 description 2
- 238000000746 purification Methods 0.000 description 2
- RXWNCPJZOCPEPQ-NVWDDTSBSA-N puromycin Chemical compound C1=CC(OC)=CC=C1C[C@H](N)C(=O)N[C@H]1[C@@H](O)[C@H](N2C3=NC=NC(=C3N=C2)N(C)C)O[C@@H]1CO RXWNCPJZOCPEPQ-NVWDDTSBSA-N 0.000 description 2
- 229940038850 rebif Drugs 0.000 description 2
- 238000011160 research Methods 0.000 description 2
- 229930002330 retinoic acid Natural products 0.000 description 2
- SHGAZHPCJJPHSC-YCNIQYBTSA-N retinoic acid group Chemical group C\C(=C/C(=O)O)\C=C\C=C(\C=C\C1=C(CCCC1(C)C)C)/C SHGAZHPCJJPHSC-YCNIQYBTSA-N 0.000 description 2
- 230000001177 retroviral effect Effects 0.000 description 2
- 229940061969 rheumatrex Drugs 0.000 description 2
- 201000005404 rubella Diseases 0.000 description 2
- 150000003902 salicylic acid esters Chemical class 0.000 description 2
- 206010039447 salmonellosis Diseases 0.000 description 2
- WVYADZUPLLSGPU-UHFFFAOYSA-N salsalate Chemical compound OC(=O)C1=CC=CC=C1OC(=O)C1=CC=CC=C1O WVYADZUPLLSGPU-UHFFFAOYSA-N 0.000 description 2
- 150000003839 salts Chemical class 0.000 description 2
- 201000005113 shigellosis Diseases 0.000 description 2
- 230000011664 signaling Effects 0.000 description 2
- 229940068638 simponi Drugs 0.000 description 2
- 239000000243 solution Substances 0.000 description 2
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 2
- 150000003456 sulfonamides Chemical group 0.000 description 2
- 239000006228 supernatant Substances 0.000 description 2
- 208000004441 taeniasis Diseases 0.000 description 2
- 238000012360 testing method Methods 0.000 description 2
- 239000003860 topical agent Substances 0.000 description 2
- 239000003053 toxin Substances 0.000 description 2
- 231100000765 toxin Toxicity 0.000 description 2
- 108700012359 toxins Proteins 0.000 description 2
- FGMPLJWBKKVCDB-UHFFFAOYSA-N trans-L-hydroxy-proline Natural products ON1CCCC1C(O)=O FGMPLJWBKKVCDB-UHFFFAOYSA-N 0.000 description 2
- 230000002103 transcriptional effect Effects 0.000 description 2
- 238000012546 transfer Methods 0.000 description 2
- 230000009466 transformation Effects 0.000 description 2
- 230000032258 transport Effects 0.000 description 2
- 229960001727 tretinoin Drugs 0.000 description 2
- 229960005294 triamcinolone Drugs 0.000 description 2
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 2
- 241001430294 unidentified retrovirus Species 0.000 description 2
- 229940035893 uracil Drugs 0.000 description 2
- 208000019206 urinary tract infection Diseases 0.000 description 2
- 239000013603 viral vector Substances 0.000 description 2
- 235000019166 vitamin D Nutrition 0.000 description 2
- 239000011710 vitamin D Substances 0.000 description 2
- 150000003710 vitamin D derivatives Chemical class 0.000 description 2
- QYSXJUFSXHHAJI-YRZJJWOYSA-N vitamin D3 Chemical class C1(/[C@@H]2CC[C@@H]([C@]2(CCC1)C)[C@H](C)CCCC(C)C)=C\C=C1\C[C@@H](O)CCC1=C QYSXJUFSXHHAJI-YRZJJWOYSA-N 0.000 description 2
- 229940046008 vitamin d Drugs 0.000 description 2
- 238000001086 yeast two-hybrid system Methods 0.000 description 2
- 229910052725 zinc Inorganic materials 0.000 description 2
- 239000011701 zinc Substances 0.000 description 2
- ZSTLCHCDLIUXJE-ZGBAEQJLSA-N (2S,5S)-2-methylspiro[1,3-oxathiolane-5,3'-1-azabicyclo[2.2.2]octane] hydrate dihydrochloride Chemical compound O.Cl.Cl.C1S[C@@H](C)O[C@@]21C(CC1)CCN1C2.C1S[C@@H](C)O[C@@]21C(CC1)CCN1C2 ZSTLCHCDLIUXJE-ZGBAEQJLSA-N 0.000 description 1
- DVSZKTAMJJTWFG-SKCDLICFSA-N (2e,4e,6e,8e,10e,12e)-docosa-2,4,6,8,10,12-hexaenoic acid Chemical compound CCCCCCCCC\C=C\C=C\C=C\C=C\C=C\C=C\C(O)=O DVSZKTAMJJTWFG-SKCDLICFSA-N 0.000 description 1
- RDJGLLICXDHJDY-NSHDSACASA-N (2s)-2-(3-phenoxyphenyl)propanoic acid Chemical compound OC(=O)[C@@H](C)C1=CC=CC(OC=2C=CC=CC=2)=C1 RDJGLLICXDHJDY-NSHDSACASA-N 0.000 description 1
- YLFZHHDVRSYTKT-NRFANRHFSA-N (2s)-2-[(2,6-difluorobenzoyl)amino]-3-[4-[4-(ethoxymethyl)-2,6-dimethoxyphenyl]phenyl]propanoic acid Chemical compound COC1=CC(COCC)=CC(OC)=C1C(C=C1)=CC=C1C[C@@H](C(O)=O)NC(=O)C1=C(F)C=CC=C1F YLFZHHDVRSYTKT-NRFANRHFSA-N 0.000 description 1
- MDKGKXOCJGEUJW-VIFPVBQESA-N (2s)-2-[4-(thiophene-2-carbonyl)phenyl]propanoic acid Chemical compound C1=CC([C@@H](C(O)=O)C)=CC=C1C(=O)C1=CC=CS1 MDKGKXOCJGEUJW-VIFPVBQESA-N 0.000 description 1
- PHOZOHFUXHPOCK-QMMMGPOBSA-N (2s)-2-ethyl-8-methyl-1-thia-4,8-diazaspiro[4.5]decan-3-one Chemical compound N1C(=O)[C@H](CC)SC11CCN(C)CC1 PHOZOHFUXHPOCK-QMMMGPOBSA-N 0.000 description 1
- KYBXNPIASYUWLN-WUCPZUCCSA-N (2s)-5-hydroxypyrrolidine-2-carboxylic acid Chemical compound OC1CC[C@@H](C(O)=O)N1 KYBXNPIASYUWLN-WUCPZUCCSA-N 0.000 description 1
- BHQCQFFYRZLCQQ-UHFFFAOYSA-N (3alpha,5alpha,7alpha,12alpha)-3,7,12-trihydroxy-cholan-24-oic acid Natural products OC1CC2CC(O)CCC2(C)C2C1C1CCC(C(CCC(O)=O)C)C1(C)C(O)C2 BHQCQFFYRZLCQQ-UHFFFAOYSA-N 0.000 description 1
- FELGMEQIXOGIFQ-CYBMUJFWSA-N (3r)-9-methyl-3-[(2-methylimidazol-1-yl)methyl]-2,3-dihydro-1h-carbazol-4-one Chemical compound CC1=NC=CN1C[C@@H]1C(=O)C(C=2C(=CC=CC=2)N2C)=C2CC1 FELGMEQIXOGIFQ-CYBMUJFWSA-N 0.000 description 1
- QGVQZRDQPDLHHV-DPAQBDIFSA-N (3s,8s,9s,10r,13r,14s,17r)-10,13-dimethyl-17-[(2r)-6-methylheptan-2-yl]-2,3,4,7,8,9,11,12,14,15,16,17-dodecahydro-1h-cyclopenta[a]phenanthrene-3-thiol Chemical compound C1C=C2C[C@@H](S)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 QGVQZRDQPDLHHV-DPAQBDIFSA-N 0.000 description 1
- MINDHVHHQZYEEK-UHFFFAOYSA-N (E)-(2S,3R,4R,5S)-5-[(2S,3S,4S,5S)-2,3-epoxy-5-hydroxy-4-methylhexyl]tetrahydro-3,4-dihydroxy-(beta)-methyl-2H-pyran-2-crotonic acid ester with 9-hydroxynonanoic acid Natural products CC(O)C(C)C1OC1CC1C(O)C(O)C(CC(C)=CC(=O)OCCCCCCCCC(O)=O)OC1 MINDHVHHQZYEEK-UHFFFAOYSA-N 0.000 description 1
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 1
- BWKMGYQJPOAASG-UHFFFAOYSA-M 1,2,3,4-tetrahydroisoquinoline-3-carboxylate Chemical compound C1=CC=C2CNC(C(=O)[O-])CC2=C1 BWKMGYQJPOAASG-UHFFFAOYSA-M 0.000 description 1
- FYADHXFMURLYQI-UHFFFAOYSA-N 1,2,4-triazine Chemical class C1=CN=NC=N1 FYADHXFMURLYQI-UHFFFAOYSA-N 0.000 description 1
- UBCHPRBFMUDMNC-UHFFFAOYSA-N 1-(1-adamantyl)ethanamine Chemical compound C1C(C2)CC3CC2CC1(C(N)C)C3 UBCHPRBFMUDMNC-UHFFFAOYSA-N 0.000 description 1
- MPBMJFQAGBVIDC-UHFFFAOYSA-N 1-hydroxy-1,2,3,4-tetrahydroisoquinoline-3-carboxylic acid Chemical compound C1=CC=C2C(O)NC(C(O)=O)CC2=C1 MPBMJFQAGBVIDC-UHFFFAOYSA-N 0.000 description 1
- NFGXHKASABOEEW-UHFFFAOYSA-N 1-methylethyl 11-methoxy-3,7,11-trimethyl-2,4-dodecadienoate Chemical compound COC(C)(C)CCCC(C)CC=CC(C)=CC(=O)OC(C)C NFGXHKASABOEEW-UHFFFAOYSA-N 0.000 description 1
- KYWCUACNBIYDNL-UHFFFAOYSA-N 1-oxo-2h-isoquinoline-3-carboxylic acid Chemical compound C1=CC=C2C(=O)NC(C(=O)O)=CC2=C1 KYWCUACNBIYDNL-UHFFFAOYSA-N 0.000 description 1
- OWEGMIWEEQEYGQ-UHFFFAOYSA-N 100676-05-9 Natural products OC1C(O)C(O)C(CO)OC1OCC1C(O)C(O)C(O)C(OC2C(OC(O)C(O)C2O)CO)O1 OWEGMIWEEQEYGQ-UHFFFAOYSA-N 0.000 description 1
- WHBHBVVOGNECLV-OBQKJFGGSA-N 11-deoxycortisol Chemical compound O=C1CC[C@]2(C)[C@H]3CC[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 WHBHBVVOGNECLV-OBQKJFGGSA-N 0.000 description 1
- UHUHBFMZVCOEOV-UHFFFAOYSA-N 1h-imidazo[4,5-c]pyridin-4-amine Chemical compound NC1=NC=CC2=C1N=CN2 UHUHBFMZVCOEOV-UHFFFAOYSA-N 0.000 description 1
- LDGWQMRUWMSZIU-LQDDAWAPSA-M 2,3-bis[(z)-octadec-9-enoxy]propyl-trimethylazanium;chloride Chemical compound [Cl-].CCCCCCCC\C=C/CCCCCCCCOCC(C[N+](C)(C)C)OCCCCCCCC\C=C/CCCCCCCC LDGWQMRUWMSZIU-LQDDAWAPSA-M 0.000 description 1
- KLIVRBFRQSOGQI-UHFFFAOYSA-N 2-(11-oxo-6h-benzo[c][1]benzothiepin-3-yl)acetic acid Chemical compound S1CC2=CC=CC=C2C(=O)C2=CC=C(CC(=O)O)C=C12 KLIVRBFRQSOGQI-UHFFFAOYSA-N 0.000 description 1
- PYIHCGFQQSKYBO-UHFFFAOYSA-N 2-(11-oxo-6h-benzo[c][1]benzoxepin-3-yl)acetic acid Chemical compound O1CC2=CC=CC=C2C(=O)C2=CC=C(CC(=O)O)C=C12 PYIHCGFQQSKYBO-UHFFFAOYSA-N 0.000 description 1
- UEJJHQNACJXSKW-UHFFFAOYSA-N 2-(2,6-dioxopiperidin-3-yl)-1H-isoindole-1,3(2H)-dione Chemical compound O=C1C2=CC=CC=C2C(=O)N1C1CCC(=O)NC1=O UEJJHQNACJXSKW-UHFFFAOYSA-N 0.000 description 1
- QSHACTSJHMKXTE-UHFFFAOYSA-N 2-(2-aminopropyl)-7h-purin-6-amine Chemical compound CC(N)CC1=NC(N)=C2NC=NC2=N1 QSHACTSJHMKXTE-UHFFFAOYSA-N 0.000 description 1
- PIINGYXNCHTJTF-UHFFFAOYSA-N 2-(2-azaniumylethylamino)acetate Chemical group NCCNCC(O)=O PIINGYXNCHTJTF-UHFFFAOYSA-N 0.000 description 1
- MYQXHLQMZLTSDB-UHFFFAOYSA-N 2-(2-ethyl-2,3-dihydro-1-benzofuran-5-yl)acetic acid Chemical compound OC(=O)CC1=CC=C2OC(CC)CC2=C1 MYQXHLQMZLTSDB-UHFFFAOYSA-N 0.000 description 1
- DCXHLPGLBYHNMU-UHFFFAOYSA-N 2-[1-(4-azidobenzoyl)-5-methoxy-2-methylindol-3-yl]acetic acid Chemical compound CC1=C(CC(O)=O)C2=CC(OC)=CC=C2N1C(=O)C1=CC=C(N=[N+]=[N-])C=C1 DCXHLPGLBYHNMU-UHFFFAOYSA-N 0.000 description 1
- JIEKMACRVQTPRC-UHFFFAOYSA-N 2-[4-(4-chlorophenyl)-2-phenyl-5-thiazolyl]acetic acid Chemical compound OC(=O)CC=1SC(C=2C=CC=CC=2)=NC=1C1=CC=C(Cl)C=C1 JIEKMACRVQTPRC-UHFFFAOYSA-N 0.000 description 1
- KISWVXRQTGLFGD-UHFFFAOYSA-N 2-[[2-[[6-amino-2-[[2-[[2-[[5-amino-2-[[2-[[1-[2-[[6-amino-2-[(2,5-diamino-5-oxopentanoyl)amino]hexanoyl]amino]-5-(diaminomethylideneamino)pentanoyl]pyrrolidine-2-carbonyl]amino]-3-hydroxypropanoyl]amino]-5-oxopentanoyl]amino]-5-(diaminomethylideneamino)p Chemical compound C1CCN(C(=O)C(CCCN=C(N)N)NC(=O)C(CCCCN)NC(=O)C(N)CCC(N)=O)C1C(=O)NC(CO)C(=O)NC(CCC(N)=O)C(=O)NC(CCCN=C(N)N)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(C(=O)NC(CC(C)C)C(O)=O)CC1=CC=C(O)C=C1 KISWVXRQTGLFGD-UHFFFAOYSA-N 0.000 description 1
- WGDADRBTCPGSDG-UHFFFAOYSA-N 2-[[4,5-bis(4-chlorophenyl)-1,3-oxazol-2-yl]sulfanyl]propanoic acid Chemical compound O1C(SC(C)C(O)=O)=NC(C=2C=CC(Cl)=CC=2)=C1C1=CC=C(Cl)C=C1 WGDADRBTCPGSDG-UHFFFAOYSA-N 0.000 description 1
- ZDPCIXZONVNODH-UHFFFAOYSA-N 2-acetyloxybenzoic acid;n-(4-hydroxyphenyl)acetamide Chemical compound CC(=O)NC1=CC=C(O)C=C1.CC(=O)OC1=CC=CC=C1C(O)=O ZDPCIXZONVNODH-UHFFFAOYSA-N 0.000 description 1
- 125000000979 2-amino-2-oxoethyl group Chemical group [H]C([*])([H])C(=O)N([H])[H] 0.000 description 1
- FUBFWTUFPGFHOJ-UHFFFAOYSA-N 2-nitrofuran Chemical class [O-][N+](=O)C1=CC=CO1 FUBFWTUFPGFHOJ-UHFFFAOYSA-N 0.000 description 1
- VXGRJERITKFWPL-UHFFFAOYSA-N 4',5'-Dihydropsoralen Natural products C1=C2OC(=O)C=CC2=CC2=C1OCC2 VXGRJERITKFWPL-UHFFFAOYSA-N 0.000 description 1
- VERWQPYQDXWOGT-LVJNJWHOSA-N 4-amino-5-fluoro-1-[(2r,5s)-2-(hydroxymethyl)-1,3-oxathiolan-5-yl]pyrimidin-2-one;[[(2r)-1-(6-aminopurin-9-yl)propan-2-yl]oxymethyl-(propan-2-yloxycarbonyloxymethoxy)phosphoryl]oxymethyl propan-2-yl carbonate;(e)-but-2-enedioic acid Chemical compound OC(=O)\C=C\C(O)=O.C1=C(F)C(N)=NC(=O)N1[C@H]1O[C@@H](CO)SC1.N1=CN=C2N(C[C@@H](C)OCP(=O)(OCOC(=O)OC(C)C)OCOC(=O)OC(C)C)C=NC2=C1N VERWQPYQDXWOGT-LVJNJWHOSA-N 0.000 description 1
- SYCHUQUJURZQMO-UHFFFAOYSA-N 4-hydroxy-2-methyl-1,1-dioxo-n-(1,3-thiazol-2-yl)-1$l^{6},2-benzothiazine-3-carboxamide Chemical compound OC=1C2=CC=CC=C2S(=O)(=O)N(C)C=1C(=O)NC1=NC=CS1 SYCHUQUJURZQMO-UHFFFAOYSA-N 0.000 description 1
- OVONXEQGWXGFJD-UHFFFAOYSA-N 4-sulfanylidene-1h-pyrimidin-2-one Chemical compound SC=1C=CNC(=O)N=1 OVONXEQGWXGFJD-UHFFFAOYSA-N 0.000 description 1
- 229940117976 5-hydroxylysine Drugs 0.000 description 1
- ZLAQATDNGLKIEV-UHFFFAOYSA-N 5-methyl-2-sulfanylidene-1h-pyrimidin-4-one Chemical compound CC1=CNC(=S)NC1=O ZLAQATDNGLKIEV-UHFFFAOYSA-N 0.000 description 1
- GZJLLYHBALOKEX-UHFFFAOYSA-N 6-Ketone, O18-Me-Ussuriedine Natural products CC=CCC=CCC=CCC=CCC=CCC=CCCCC(O)=O GZJLLYHBALOKEX-UHFFFAOYSA-N 0.000 description 1
- KXBCLNRMQPRVTP-UHFFFAOYSA-N 6-amino-1,5-dihydroimidazo[4,5-c]pyridin-4-one Chemical compound O=C1NC(N)=CC2=C1N=CN2 KXBCLNRMQPRVTP-UHFFFAOYSA-N 0.000 description 1
- DCPSTSVLRXOYGS-UHFFFAOYSA-N 6-amino-1h-pyrimidine-2-thione Chemical compound NC1=CC=NC(S)=N1 DCPSTSVLRXOYGS-UHFFFAOYSA-N 0.000 description 1
- QNNARSZPGNJZIX-UHFFFAOYSA-N 6-amino-5-prop-1-ynyl-1h-pyrimidin-2-one Chemical compound CC#CC1=CNC(=O)N=C1N QNNARSZPGNJZIX-UHFFFAOYSA-N 0.000 description 1
- 102100038222 60 kDa heat shock protein, mitochondrial Human genes 0.000 description 1
- 101710154868 60 kDa heat shock protein, mitochondrial Proteins 0.000 description 1
- MYYIMZRZXIQBGI-HVIRSNARSA-N 6alpha-Fluoroprednisolone Chemical compound O=C1C=C[C@]2(C)[C@H]3[C@@H](O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3C[C@H](F)C2=C1 MYYIMZRZXIQBGI-HVIRSNARSA-N 0.000 description 1
- LOSIULRWFAEMFL-UHFFFAOYSA-N 7-deazaguanine Chemical compound O=C1NC(N)=NC2=C1CC=N2 LOSIULRWFAEMFL-UHFFFAOYSA-N 0.000 description 1
- HCKFPALGXKOOBK-NRYMJLQJSA-N 7332-27-6 Chemical compound C1([C@]2(O[C@]3([C@@]4(C)C[C@H](O)[C@]5(F)[C@@]6(C)C=CC(=O)C=C6CC[C@H]5[C@@H]4C[C@H]3O2)C(=O)CO)C)=CC=CC=C1 HCKFPALGXKOOBK-NRYMJLQJSA-N 0.000 description 1
- HRYKDUPGBWLLHO-UHFFFAOYSA-N 8-azaadenine Chemical compound NC1=NC=NC2=NNN=C12 HRYKDUPGBWLLHO-UHFFFAOYSA-N 0.000 description 1
- LPXQRXLUHJKZIE-UHFFFAOYSA-N 8-azaguanine Chemical compound NC1=NC(O)=C2NN=NC2=N1 LPXQRXLUHJKZIE-UHFFFAOYSA-N 0.000 description 1
- 229960005508 8-azaguanine Drugs 0.000 description 1
- MSSXOMSJDRHRMC-UHFFFAOYSA-N 9H-purine-2,6-diamine Chemical compound NC1=NC(N)=C2NC=NC2=N1 MSSXOMSJDRHRMC-UHFFFAOYSA-N 0.000 description 1
- 230000005730 ADP ribosylation Effects 0.000 description 1
- 241000224422 Acanthamoeba Species 0.000 description 1
- 206010063409 Acarodermatitis Diseases 0.000 description 1
- 208000002874 Acne Vulgaris Diseases 0.000 description 1
- 241000701242 Adenoviridae Species 0.000 description 1
- 208000000230 African Trypanosomiasis Diseases 0.000 description 1
- 241000701386 African swine fever virus Species 0.000 description 1
- IPWKGIFRRBGCJO-IMJSIDKUSA-N Ala-Ser Chemical compound C[C@H]([NH3+])C(=O)N[C@@H](CO)C([O-])=O IPWKGIFRRBGCJO-IMJSIDKUSA-N 0.000 description 1
- 208000004881 Amebiasis Diseases 0.000 description 1
- 206010001935 American trypanosomiasis Diseases 0.000 description 1
- 102000052866 Amino Acyl-tRNA Synthetases Human genes 0.000 description 1
- 108700028939 Amino Acyl-tRNA Synthetases Proteins 0.000 description 1
- 206010001980 Amoebiasis Diseases 0.000 description 1
- 201000002045 Ancylostomiasis Diseases 0.000 description 1
- 208000033211 Ankylostomiasis Diseases 0.000 description 1
- 206010059313 Anogenital warts Diseases 0.000 description 1
- 101100107610 Arabidopsis thaliana ABCF4 gene Proteins 0.000 description 1
- 241000712892 Arenaviridae Species 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- 241001480043 Arthrodermataceae Species 0.000 description 1
- 241000238421 Arthropoda Species 0.000 description 1
- TZFQICWZWFNIKU-KKUMJFAQSA-N Asn-Leu-Tyr Chemical compound NC(=O)C[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 TZFQICWZWFNIKU-KKUMJFAQSA-N 0.000 description 1
- 206010003487 Aspergilloma Diseases 0.000 description 1
- 201000002909 Aspergillosis Diseases 0.000 description 1
- 208000036641 Aspergillus infections Diseases 0.000 description 1
- AXRYRYVKAWYZBR-UHFFFAOYSA-N Atazanavir Natural products C=1C=C(C=2N=CC=CC=2)C=CC=1CN(NC(=O)C(NC(=O)OC)C(C)(C)C)CC(O)C(NC(=O)C(NC(=O)OC)C(C)(C)C)CC1=CC=CC=C1 AXRYRYVKAWYZBR-UHFFFAOYSA-N 0.000 description 1
- 108010019625 Atazanavir Sulfate Proteins 0.000 description 1
- 201000001320 Atherosclerosis Diseases 0.000 description 1
- 229930003347 Atropine Natural products 0.000 description 1
- 208000032116 Autoimmune Experimental Encephalomyelitis Diseases 0.000 description 1
- 102100029822 B- and T-lymphocyte attenuator Human genes 0.000 description 1
- 241000193830 Bacillus <bacterium> Species 0.000 description 1
- 241000193738 Bacillus anthracis Species 0.000 description 1
- 208000004926 Bacterial Vaginosis Diseases 0.000 description 1
- 241001148536 Bacteroides sp. Species 0.000 description 1
- 208000027496 Behcet disease Diseases 0.000 description 1
- 241000702628 Birnaviridae Species 0.000 description 1
- 241000228405 Blastomyces dermatitidis Species 0.000 description 1
- 101100208237 Bos taurus THBS2 gene Proteins 0.000 description 1
- 206010006473 Bronchopulmonary aspergillosis Diseases 0.000 description 1
- 206010006474 Bronchopulmonary aspergillosis allergic Diseases 0.000 description 1
- 206010006500 Brucellosis Diseases 0.000 description 1
- 208000011691 Burkitt lymphomas Diseases 0.000 description 1
- UWLXXVABSMPTET-UHFFFAOYSA-L C(C(S)CC(=O)[O-])(=O)[O-].[Na+].[Au+3].[Au+3] Chemical compound C(C(S)CC(=O)[O-])(=O)[O-].[Na+].[Au+3].[Au+3] UWLXXVABSMPTET-UHFFFAOYSA-L 0.000 description 1
- 102100025277 C-X-C motif chemokine 13 Human genes 0.000 description 1
- 102100024217 CAMPATH-1 antigen Human genes 0.000 description 1
- 102100038078 CD276 antigen Human genes 0.000 description 1
- 102100036008 CD48 antigen Human genes 0.000 description 1
- 108010065524 CD52 Antigen Proteins 0.000 description 1
- 101100297347 Caenorhabditis elegans pgl-3 gene Proteins 0.000 description 1
- 229940122739 Calcineurin inhibitor Drugs 0.000 description 1
- 101710192106 Calcineurin-binding protein cabin-1 Proteins 0.000 description 1
- 102100024123 Calcineurin-binding protein cabin-1 Human genes 0.000 description 1
- UXVMQQNJUSDDNG-UHFFFAOYSA-L Calcium chloride Chemical compound [Cl-].[Cl-].[Ca+2] UXVMQQNJUSDDNG-UHFFFAOYSA-L 0.000 description 1
- 240000001432 Calendula officinalis Species 0.000 description 1
- 235000005881 Calendula officinalis Nutrition 0.000 description 1
- 241000589994 Campylobacter sp. Species 0.000 description 1
- 206010007134 Candida infections Diseases 0.000 description 1
- 244000025254 Cannabis sativa Species 0.000 description 1
- 235000012766 Cannabis sativa ssp. sativa var. sativa Nutrition 0.000 description 1
- 235000012765 Cannabis sativa ssp. sativa var. spontanea Nutrition 0.000 description 1
- KXDHJXZQYSOELW-UHFFFAOYSA-N Carbamic acid Chemical group NC(O)=O KXDHJXZQYSOELW-UHFFFAOYSA-N 0.000 description 1
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical group [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 1
- 102000014914 Carrier Proteins Human genes 0.000 description 1
- 208000005024 Castleman disease Diseases 0.000 description 1
- 206010007882 Cellulitis Diseases 0.000 description 1
- 229930186147 Cephalosporin Natural products 0.000 description 1
- 241000242722 Cestoda Species 0.000 description 1
- 208000026368 Cestode infections Diseases 0.000 description 1
- 208000024699 Chagas disease Diseases 0.000 description 1
- 102000009410 Chemokine receptor Human genes 0.000 description 1
- 108050000299 Chemokine receptor Proteins 0.000 description 1
- 102000019034 Chemokines Human genes 0.000 description 1
- 108010012236 Chemokines Proteins 0.000 description 1
- 201000006082 Chickenpox Diseases 0.000 description 1
- 241000606153 Chlamydia trachomatis Species 0.000 description 1
- 206010008631 Cholera Diseases 0.000 description 1
- 239000004380 Cholic acid Substances 0.000 description 1
- 206010008761 Choriomeningitis lymphocytic Diseases 0.000 description 1
- 206010008909 Chronic Hepatitis Diseases 0.000 description 1
- 208000006154 Chronic hepatitis C Diseases 0.000 description 1
- 206010064568 Chronic infantile neurological cutaneous and articular syndrome Diseases 0.000 description 1
- VWFCHDSQECPREK-LURJTMIESA-N Cidofovir Chemical compound NC=1C=CN(C[C@@H](CO)OCP(O)(O)=O)C(=O)N=1 VWFCHDSQECPREK-LURJTMIESA-N 0.000 description 1
- 241000223782 Ciliophora Species 0.000 description 1
- 208000030808 Clear cell renal carcinoma Diseases 0.000 description 1
- 206010009344 Clonorchiasis Diseases 0.000 description 1
- 241000193403 Clostridium Species 0.000 description 1
- 206010009657 Clostridium difficile colitis Diseases 0.000 description 1
- 241000193449 Clostridium tetani Species 0.000 description 1
- 241000933851 Cochliomyia Species 0.000 description 1
- 108020004705 Codon Proteins 0.000 description 1
- 208000003606 Congenital Rubella Syndrome Diseases 0.000 description 1
- 206010010619 Congenital rubella infection Diseases 0.000 description 1
- 208000001528 Coronaviridae Infections Diseases 0.000 description 1
- 241000186227 Corynebacterium diphtheriae Species 0.000 description 1
- 241000186249 Corynebacterium sp. Species 0.000 description 1
- 241000709687 Coxsackievirus Species 0.000 description 1
- 241000938605 Crocodylia Species 0.000 description 1
- 206010011409 Cross infection Diseases 0.000 description 1
- 206010011416 Croup infectious Diseases 0.000 description 1
- 208000008953 Cryptosporidiosis Diseases 0.000 description 1
- 206010011502 Cryptosporidiosis infection Diseases 0.000 description 1
- XDTMQSROBMDMFD-UHFFFAOYSA-N Cyclohexane Chemical compound C1CCCCC1 XDTMQSROBMDMFD-UHFFFAOYSA-N 0.000 description 1
- 201000000077 Cysticercosis Diseases 0.000 description 1
- UHDGCWIWMRVCDJ-CCXZUQQUSA-N Cytarabine Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@@H](O)[C@H](O)[C@@H](CO)O1 UHDGCWIWMRVCDJ-CCXZUQQUSA-N 0.000 description 1
- 150000008574 D-amino acids Chemical class 0.000 description 1
- VVNCNSJFMMFHPL-VKHMYHEASA-N D-penicillamine Chemical compound CC(C)(S)[C@@H](N)C(O)=O VVNCNSJFMMFHPL-VKHMYHEASA-N 0.000 description 1
- 206010012305 Demyelination Diseases 0.000 description 1
- 241000710829 Dengue virus group Species 0.000 description 1
- VPGRYOFKCNULNK-ACXQXYJUSA-N Deoxycorticosterone acetate Chemical compound C1CC2=CC(=O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H](C(=O)COC(=O)C)[C@@]1(C)CC2 VPGRYOFKCNULNK-ACXQXYJUSA-N 0.000 description 1
- 206010012504 Dermatophytosis Diseases 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- 206010012742 Diarrhoea infectious Diseases 0.000 description 1
- HHJIUUAMYGBVSD-YTFFSALGSA-N Diflucortolone valerate Chemical compound C1([C@@H](F)C2)=CC(=O)C=C[C@]1(C)[C@]1(F)[C@@H]2[C@@H]2C[C@@H](C)[C@H](C(=O)COC(=O)CCCC)[C@@]2(C)C[C@@H]1O HHJIUUAMYGBVSD-YTFFSALGSA-N 0.000 description 1
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 description 1
- 241000690784 Dioctophyme Species 0.000 description 1
- 102000003779 Dipeptidyl-peptidases and tripeptidyl-peptidases Human genes 0.000 description 1
- 108090000194 Dipeptidyl-peptidases and tripeptidyl-peptidases Proteins 0.000 description 1
- 206010013029 Diphyllobothriasis Diseases 0.000 description 1
- 101100347633 Drosophila melanogaster Mhc gene Proteins 0.000 description 1
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 1
- 238000008157 ELISA kit Methods 0.000 description 1
- 201000011001 Ebola Hemorrhagic Fever Diseases 0.000 description 1
- 241001115402 Ebolavirus Species 0.000 description 1
- 108010049047 Echinocandins Proteins 0.000 description 1
- 206010014096 Echinococciasis Diseases 0.000 description 1
- 208000009366 Echinococcosis Diseases 0.000 description 1
- 241001466953 Echovirus Species 0.000 description 1
- 208000005235 Echovirus Infections Diseases 0.000 description 1
- XPOQHMRABVBWPR-UHFFFAOYSA-N Efavirenz Natural products O1C(=O)NC2=CC=C(Cl)C=C2C1(C(F)(F)F)C#CC1CC1 XPOQHMRABVBWPR-UHFFFAOYSA-N 0.000 description 1
- 208000004145 Endometritis Diseases 0.000 description 1
- 108010032976 Enfuvirtide Proteins 0.000 description 1
- 208000004232 Enteritis Diseases 0.000 description 1
- 241000588914 Enterobacter Species 0.000 description 1
- 241000194033 Enterococcus Species 0.000 description 1
- 241000194032 Enterococcus faecalis Species 0.000 description 1
- 206010014896 Enterocolitis haemorrhagic Diseases 0.000 description 1
- 108010013369 Enteropeptidase Proteins 0.000 description 1
- 102100029727 Enteropeptidase Human genes 0.000 description 1
- 241000991587 Enterovirus C Species 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- YQYJSBFKSSDGFO-UHFFFAOYSA-N Epihygromycin Natural products OC1C(O)C(C(=O)C)OC1OC(C(=C1)O)=CC=C1C=C(C)C(=O)NC1C(O)C(O)C2OCOC2C1O YQYJSBFKSSDGFO-UHFFFAOYSA-N 0.000 description 1
- 206010015108 Epstein-Barr virus infection Diseases 0.000 description 1
- 208000000832 Equine Encephalomyelitis Diseases 0.000 description 1
- 241000283073 Equus caballus Species 0.000 description 1
- 241000186810 Erysipelothrix rhusiopathiae Species 0.000 description 1
- LYCAIKOWRPUZTN-UHFFFAOYSA-N Ethylene glycol Chemical group OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 description 1
- 241000206602 Eukaryota Species 0.000 description 1
- 108010074860 Factor Xa Proteins 0.000 description 1
- 241000242711 Fasciola hepatica Species 0.000 description 1
- 108010021472 Fc gamma receptor IIB Proteins 0.000 description 1
- RBBWCVQDXDFISW-UHFFFAOYSA-N Feprazone Chemical compound O=C1C(CC=C(C)C)C(=O)N(C=2C=CC=CC=2)N1C1=CC=CC=C1 RBBWCVQDXDFISW-UHFFFAOYSA-N 0.000 description 1
- 206010016675 Filariasis lymphatic Diseases 0.000 description 1
- 241000710831 Flavivirus Species 0.000 description 1
- 206010016952 Food poisoning Diseases 0.000 description 1
- 208000019331 Foodborne disease Diseases 0.000 description 1
- 206010017523 Fungaemia Diseases 0.000 description 1
- 241000605986 Fusobacterium nucleatum Species 0.000 description 1
- 241000287828 Gallus gallus Species 0.000 description 1
- 229940124897 Gardasil Drugs 0.000 description 1
- 201000000628 Gas Gangrene Diseases 0.000 description 1
- 102400000921 Gastrin Human genes 0.000 description 1
- 108010052343 Gastrins Chemical class 0.000 description 1
- 206010061166 Gastroenteritis bacterial Diseases 0.000 description 1
- 206010017915 Gastroenteritis shigella Diseases 0.000 description 1
- 206010017916 Gastroenteritis staphylococcal Diseases 0.000 description 1
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 1
- BCCRXDTUTZHDEU-VKHMYHEASA-N Gly-Ser Chemical compound NCC(=O)N[C@@H](CO)C(O)=O BCCRXDTUTZHDEU-VKHMYHEASA-N 0.000 description 1
- FGPLUIQCSKGLTI-WDSKDSINSA-N Gly-Ser-Glu Chemical compound NCC(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CCC(O)=O FGPLUIQCSKGLTI-WDSKDSINSA-N 0.000 description 1
- 208000000807 Gnathostomiasis Diseases 0.000 description 1
- 206010018612 Gonorrhoea Diseases 0.000 description 1
- 102000001398 Granzyme Human genes 0.000 description 1
- 108060005986 Granzyme Proteins 0.000 description 1
- 241000288105 Grus Species 0.000 description 1
- 102100035943 HERV-H LTR-associating protein 2 Human genes 0.000 description 1
- 229940121710 HMGCoA reductase inhibitor Drugs 0.000 description 1
- 241000606768 Haemophilus influenzae Species 0.000 description 1
- MUQNGPZZQDCDFT-JNQJZLCISA-N Halcinonide Chemical compound C1CC2=CC(=O)CC[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@H]3OC(C)(C)O[C@@]3(C(=O)CCl)[C@@]1(C)C[C@@H]2O MUQNGPZZQDCDFT-JNQJZLCISA-N 0.000 description 1
- 241000150562 Hantaan orthohantavirus Species 0.000 description 1
- 101150046249 Havcr2 gene Proteins 0.000 description 1
- 241000590002 Helicobacter pylori Species 0.000 description 1
- 108010034145 Helminth Proteins Proteins 0.000 description 1
- 208000032759 Hemolytic-Uremic Syndrome Diseases 0.000 description 1
- 241000711549 Hepacivirus C Species 0.000 description 1
- 241000700739 Hepadnaviridae Species 0.000 description 1
- HTTJABKRGRZYRN-UHFFFAOYSA-N Heparin Chemical compound OC1C(NC(=O)C)C(O)OC(COS(O)(=O)=O)C1OC1C(OS(O)(=O)=O)C(O)C(OC2C(C(OS(O)(=O)=O)C(OC3C(C(O)C(O)C(O3)C(O)=O)OS(O)(=O)=O)C(CO)O2)NS(O)(=O)=O)C(C(O)=O)O1 HTTJABKRGRZYRN-UHFFFAOYSA-N 0.000 description 1
- 102100034458 Hepatitis A virus cellular receptor 2 Human genes 0.000 description 1
- 208000005331 Hepatitis D Diseases 0.000 description 1
- 241000709721 Hepatovirus A Species 0.000 description 1
- 208000009889 Herpes Simplex Diseases 0.000 description 1
- 241000228404 Histoplasma capsulatum Species 0.000 description 1
- 201000002563 Histoplasmosis Diseases 0.000 description 1
- ZTVIKZXZYLEVOL-MCOXGKPRSA-N Homatropine Chemical compound O([C@H]1C[C@H]2CC[C@@H](C1)N2C)C(=O)C(O)C1=CC=CC=C1 ZTVIKZXZYLEVOL-MCOXGKPRSA-N 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 101000864344 Homo sapiens B- and T-lymphocyte attenuator Proteins 0.000 description 1
- 101000858064 Homo sapiens C-X-C motif chemokine 13 Proteins 0.000 description 1
- 101000716130 Homo sapiens CD48 antigen Proteins 0.000 description 1
- 101000935040 Homo sapiens Integrin beta-2 Proteins 0.000 description 1
- 101000998146 Homo sapiens Interleukin-17A Proteins 0.000 description 1
- 101001137987 Homo sapiens Lymphocyte activation gene 3 protein Proteins 0.000 description 1
- 101001063392 Homo sapiens Lymphocyte function-associated antigen 3 Proteins 0.000 description 1
- 101000738771 Homo sapiens Receptor-type tyrosine-protein phosphatase C Proteins 0.000 description 1
- 101000914496 Homo sapiens T-cell antigen CD7 Proteins 0.000 description 1
- 101000934346 Homo sapiens T-cell surface antigen CD2 Proteins 0.000 description 1
- 206010020376 Hookworm infection Diseases 0.000 description 1
- 240000005979 Hordeum vulgare Species 0.000 description 1
- 235000007340 Hordeum vulgare Nutrition 0.000 description 1
- 241000701109 Human adenovirus 2 Species 0.000 description 1
- 241000701085 Human alphaherpesvirus 3 Species 0.000 description 1
- 241000701806 Human papillomavirus Species 0.000 description 1
- DLVOSEUFIRPIRM-KAQKJVHQSA-N Hydrocortisone cypionate Chemical compound O=C([C@@]1(O)CC[C@H]2[C@H]3[C@@H]([C@]4(CCC(=O)C=C4CC3)C)[C@@H](O)C[C@@]21C)COC(=O)CCC1CCCC1 DLVOSEUFIRPIRM-KAQKJVHQSA-N 0.000 description 1
- LCWXJXMHJVIJFK-UHFFFAOYSA-N Hydroxylysine Natural products NCC(O)CC(N)CC(O)=O LCWXJXMHJVIJFK-UHFFFAOYSA-N 0.000 description 1
- RKUNBYITZUJHSG-UHFFFAOYSA-N Hyosciamin-hydrochlorid Natural products CN1C(C2)CCC1CC2OC(=O)C(CO)C1=CC=CC=C1 RKUNBYITZUJHSG-UHFFFAOYSA-N 0.000 description 1
- 208000017731 Hypocomplementemic urticarial vasculitis Diseases 0.000 description 1
- UGQMRVRMYYASKQ-UHFFFAOYSA-N Hypoxanthine nucleoside Natural products OC1C(O)C(CO)OC1N1C(NC=NC2=O)=C2N=C1 UGQMRVRMYYASKQ-UHFFFAOYSA-N 0.000 description 1
- 102100034980 ICOS ligand Human genes 0.000 description 1
- 101710093458 ICOS ligand Proteins 0.000 description 1
- XQFRJNBWHJMXHO-RRKCRQDMSA-N IDUR Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(I)=C1 XQFRJNBWHJMXHO-RRKCRQDMSA-N 0.000 description 1
- 102100026120 IgG receptor FcRn large subunit p51 Human genes 0.000 description 1
- 101710177940 IgG receptor FcRn large subunit p51 Proteins 0.000 description 1
- 108010009817 Immunoglobulin Constant Regions Proteins 0.000 description 1
- 102000009786 Immunoglobulin Constant Regions Human genes 0.000 description 1
- 229930010555 Inosine Natural products 0.000 description 1
- UGQMRVRMYYASKQ-KQYNXXCUSA-N Inosine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C2=NC=NC(O)=C2N=C1 UGQMRVRMYYASKQ-KQYNXXCUSA-N 0.000 description 1
- 108010041012 Integrin alpha4 Proteins 0.000 description 1
- 108010064593 Intercellular Adhesion Molecule-1 Proteins 0.000 description 1
- 108010064600 Intercellular Adhesion Molecule-3 Proteins 0.000 description 1
- 102100037877 Intercellular adhesion molecule 1 Human genes 0.000 description 1
- 102100037872 Intercellular adhesion molecule 2 Human genes 0.000 description 1
- 101710148794 Intercellular adhesion molecule 2 Proteins 0.000 description 1
- 102100037871 Intercellular adhesion molecule 3 Human genes 0.000 description 1
- 108090000176 Interleukin-13 Proteins 0.000 description 1
- 102100033461 Interleukin-17A Human genes 0.000 description 1
- 102000015696 Interleukins Human genes 0.000 description 1
- 108010063738 Interleukins Proteins 0.000 description 1
- 208000005615 Interstitial Cystitis Diseases 0.000 description 1
- 241000701377 Iridoviridae Species 0.000 description 1
- 206010023076 Isosporiasis Diseases 0.000 description 1
- 208000007766 Kaposi sarcoma Diseases 0.000 description 1
- 241000588748 Klebsiella Species 0.000 description 1
- SNDPXSYFESPGGJ-BYPYZUCNSA-N L-2-aminopentanoic acid Chemical compound CCC[C@H](N)C(O)=O SNDPXSYFESPGGJ-BYPYZUCNSA-N 0.000 description 1
- AHLPHDHHMVZTML-BYPYZUCNSA-N L-Ornithine Chemical compound NCCC[C@H](N)C(O)=O AHLPHDHHMVZTML-BYPYZUCNSA-N 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- ZGUNAGUHMKGQNY-ZETCQYMHSA-N L-alpha-phenylglycine zwitterion Chemical compound OC(=O)[C@@H](N)C1=CC=CC=C1 ZGUNAGUHMKGQNY-ZETCQYMHSA-N 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- 125000000393 L-methionino group Chemical group [H]OC(=O)[C@@]([H])(N([H])[*])C([H])([H])C(SC([H])([H])[H])([H])[H] 0.000 description 1
- SNDPXSYFESPGGJ-UHFFFAOYSA-N L-norVal-OH Natural products CCCC(N)C(O)=O SNDPXSYFESPGGJ-UHFFFAOYSA-N 0.000 description 1
- LRQKBLKVPFOOQJ-YFKPBYRVSA-N L-norleucine Chemical compound CCCC[C@H]([NH3+])C([O-])=O LRQKBLKVPFOOQJ-YFKPBYRVSA-N 0.000 description 1
- XUIIKFGFIJCVMT-LBPRGKRZSA-N L-thyroxine Chemical compound IC1=CC(C[C@H]([NH3+])C([O-])=O)=CC(I)=C1OC1=CC(I)=C(O)C(I)=C1 XUIIKFGFIJCVMT-LBPRGKRZSA-N 0.000 description 1
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 1
- 102000017578 LAG3 Human genes 0.000 description 1
- QNRRHYPPQFELSF-CNYIRLTGSA-N Laninamivir Chemical class OC[C@@H](O)[C@@H](OC)[C@@H]1OC(C(O)=O)=C[C@H](N=C(N)N)[C@H]1NC(C)=O QNRRHYPPQFELSF-CNYIRLTGSA-N 0.000 description 1
- 206010023849 Laryngeal papilloma Diseases 0.000 description 1
- 206010023927 Lassa fever Diseases 0.000 description 1
- 241000589248 Legionella Species 0.000 description 1
- 208000004554 Leishmaniasis Diseases 0.000 description 1
- 241000589902 Leptospira Species 0.000 description 1
- 206010024238 Leptospirosis Diseases 0.000 description 1
- 241000186779 Listeria monocytogenes Species 0.000 description 1
- 206010024641 Listeriosis Diseases 0.000 description 1
- 206010024774 Localised infection Diseases 0.000 description 1
- 101710099301 Low affinity immunoglobulin gamma Fc region receptor III-A Proteins 0.000 description 1
- 208000037263 Lymphatic filariasis Diseases 0.000 description 1
- 102100030984 Lymphocyte function-associated antigen 3 Human genes 0.000 description 1
- 206010025323 Lymphomas Diseases 0.000 description 1
- 241000282560 Macaca mulatta Species 0.000 description 1
- 241000829100 Macaca mulatta polyomavirus 1 Species 0.000 description 1
- GUBGYTABKSRVRQ-PICCSMPSSA-N Maltose Natural products O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@@H](CO)OC(O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-PICCSMPSSA-N 0.000 description 1
- 241000767482 Massospora cicadina Species 0.000 description 1
- 108010072582 Matrilin Proteins Proteins 0.000 description 1
- 201000005505 Measles Diseases 0.000 description 1
- 241000712079 Measles morbillivirus Species 0.000 description 1
- GZENKSODFLBBHQ-ILSZZQPISA-N Medrysone Chemical compound C([C@@]12C)CC(=O)C=C1[C@@H](C)C[C@@H]1[C@@H]2[C@@H](O)C[C@]2(C)[C@@H](C(C)=O)CC[C@H]21 GZENKSODFLBBHQ-ILSZZQPISA-N 0.000 description 1
- FQISKWAFAHGMGT-SGJOWKDISA-M Methylprednisolone sodium succinate Chemical compound [Na+].C([C@@]12C)=CC(=O)C=C1[C@@H](C)C[C@@H]1[C@@H]2[C@@H](O)C[C@]2(C)[C@@](O)(C(=O)COC(=O)CCC([O-])=O)CC[C@H]21 FQISKWAFAHGMGT-SGJOWKDISA-M 0.000 description 1
- 241000243190 Microsporidia Species 0.000 description 1
- 241001460074 Microsporum distortum Species 0.000 description 1
- HZQDCMWJEBCWBR-UUOKFMHZSA-N Mizoribine Chemical compound OC1=C(C(=O)N)N=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 HZQDCMWJEBCWBR-UUOKFMHZSA-N 0.000 description 1
- 239000004909 Moisturizer Substances 0.000 description 1
- 241000700601 Moniliformis Species 0.000 description 1
- 208000005647 Mumps Diseases 0.000 description 1
- 241000711386 Mumps virus Species 0.000 description 1
- 101100407308 Mus musculus Pdcd1lg2 gene Proteins 0.000 description 1
- 241000699670 Mus sp. Species 0.000 description 1
- 241000186367 Mycobacterium avium Species 0.000 description 1
- 241000186364 Mycobacterium intracellulare Species 0.000 description 1
- 241000186363 Mycobacterium kansasii Species 0.000 description 1
- RTGDFNSFWBGLEC-UHFFFAOYSA-N Mycophenolate mofetil Chemical compound COC1=C(C)C=2COC(=O)C=2C(O)=C1CC=C(C)CCC(=O)OCCN1CCOCC1 RTGDFNSFWBGLEC-UHFFFAOYSA-N 0.000 description 1
- 208000006123 Myiasis Diseases 0.000 description 1
- OVRNDRQMDRJTHS-UHFFFAOYSA-N N-acelyl-D-glucosamine Natural products CC(=O)NC1C(O)OC(CO)C(O)C1O OVRNDRQMDRJTHS-UHFFFAOYSA-N 0.000 description 1
- OVRNDRQMDRJTHS-FMDGEEDCSA-N N-acetyl-beta-D-glucosamine Chemical compound CC(=O)N[C@H]1[C@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O OVRNDRQMDRJTHS-FMDGEEDCSA-N 0.000 description 1
- MBLBDJOUHNCFQT-LXGUWJNJSA-N N-acetylglucosamine Natural products CC(=O)N[C@@H](C=O)[C@@H](O)[C@H](O)[C@H](O)CO MBLBDJOUHNCFQT-LXGUWJNJSA-N 0.000 description 1
- 230000006181 N-acylation Effects 0.000 description 1
- 102100029527 Natural cytotoxicity triggering receptor 3 ligand 1 Human genes 0.000 description 1
- 206010028885 Necrotising fasciitis Diseases 0.000 description 1
- 208000005119 Necrotizing Pneumonia Diseases 0.000 description 1
- 241000588652 Neisseria gonorrhoeae Species 0.000 description 1
- 241000588650 Neisseria meningitidis Species 0.000 description 1
- 208000012902 Nervous system disease Diseases 0.000 description 1
- 208000025966 Neurological disease Diseases 0.000 description 1
- 101100202932 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) tsp-4 gene Proteins 0.000 description 1
- 101100202938 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) tsp-5 gene Proteins 0.000 description 1
- 108020003217 Nuclear RNA Proteins 0.000 description 1
- 102000043141 Nuclear RNA Human genes 0.000 description 1
- BZQFBWGGLXLEPQ-UHFFFAOYSA-N O-phosphoryl-L-serine Natural products OC(=O)C(N)COP(O)(O)=O BZQFBWGGLXLEPQ-UHFFFAOYSA-N 0.000 description 1
- REYJJPSVUYRZGE-UHFFFAOYSA-N Octadecylamine Chemical compound CCCCCCCCCCCCCCCCCCN REYJJPSVUYRZGE-UHFFFAOYSA-N 0.000 description 1
- 206010030154 Oesophageal candidiasis Diseases 0.000 description 1
- 241000702259 Orbivirus Species 0.000 description 1
- AHLPHDHHMVZTML-UHFFFAOYSA-N Orn-delta-NH2 Natural products NCCCC(N)C(O)=O AHLPHDHHMVZTML-UHFFFAOYSA-N 0.000 description 1
- UTJLXEIPEHZYQJ-UHFFFAOYSA-N Ornithine Natural products OC(=O)C(C)CCCN UTJLXEIPEHZYQJ-UHFFFAOYSA-N 0.000 description 1
- 241000712464 Orthomyxoviridae Species 0.000 description 1
- 241000150218 Orthonairovirus Species 0.000 description 1
- 241000702244 Orthoreovirus Species 0.000 description 1
- 206010033078 Otitis media Diseases 0.000 description 1
- 102000000470 PDZ domains Human genes 0.000 description 1
- 108050008994 PDZ domains Proteins 0.000 description 1
- 206010033767 Paracoccidioides infections Diseases 0.000 description 1
- 201000000301 Paracoccidioidomycosis Diseases 0.000 description 1
- HYRKAAMZBDSJFJ-LFDBJOOHSA-N Paramethasone acetate Chemical compound C1([C@@H](F)C2)=CC(=O)C=C[C@]1(C)[C@@H]1[C@@H]2[C@@H]2C[C@@H](C)[C@@](C(=O)COC(C)=O)(O)[C@@]2(C)C[C@@H]1O HYRKAAMZBDSJFJ-LFDBJOOHSA-N 0.000 description 1
- 241000711504 Paramyxoviridae Species 0.000 description 1
- 241000701945 Parvoviridae Species 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 208000029082 Pelvic Inflammatory Disease Diseases 0.000 description 1
- JNTOCHDNEULJHD-UHFFFAOYSA-N Penciclovir Chemical compound N1C(N)=NC(=O)C2=C1N(CCC(CO)CO)C=N2 JNTOCHDNEULJHD-UHFFFAOYSA-N 0.000 description 1
- 229930182555 Penicillin Natural products 0.000 description 1
- 206010064458 Penicilliosis Diseases 0.000 description 1
- CWRVKFFCRWGWCS-UHFFFAOYSA-N Pentrazole Chemical compound C1CCCCC2=NN=NN21 CWRVKFFCRWGWCS-UHFFFAOYSA-N 0.000 description 1
- 208000008469 Peptic Ulcer Diseases 0.000 description 1
- 108010079855 Peptide Aptamers Proteins 0.000 description 1
- 108010033276 Peptide Fragments Proteins 0.000 description 1
- 102000007079 Peptide Fragments Human genes 0.000 description 1
- 108010043958 Peptoids Proteins 0.000 description 1
- 201000005702 Pertussis Diseases 0.000 description 1
- 201000007100 Pharyngitis Diseases 0.000 description 1
- 206010034839 Pharyngitis streptococcal Diseases 0.000 description 1
- LLGTYVHITPVGKR-RYUDHWBXSA-N Phe-Gln-Gly Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCC(N)=O)C(=O)NCC(O)=O LLGTYVHITPVGKR-RYUDHWBXSA-N 0.000 description 1
- 241000713137 Phlebovirus Species 0.000 description 1
- 108010089430 Phosphoproteins Proteins 0.000 description 1
- 102000007982 Phosphoproteins Human genes 0.000 description 1
- ABLZXFCXXLZCGV-UHFFFAOYSA-N Phosphorous acid Chemical class OP(O)=O ABLZXFCXXLZCGV-UHFFFAOYSA-N 0.000 description 1
- 241000223960 Plasmodium falciparum Species 0.000 description 1
- 206010035718 Pneumonia legionella Diseases 0.000 description 1
- 208000000474 Poliomyelitis Diseases 0.000 description 1
- 108010039918 Polylysine Proteins 0.000 description 1
- 241001505332 Polyomavirus sp. Species 0.000 description 1
- 206010054161 Pontiac fever Diseases 0.000 description 1
- 241000700625 Poxviridae Species 0.000 description 1
- TVQZAMVBTVNYLA-UHFFFAOYSA-N Pranoprofen Chemical compound C1=CC=C2CC3=CC(C(C(O)=O)C)=CC=C3OC2=N1 TVQZAMVBTVNYLA-UHFFFAOYSA-N 0.000 description 1
- 206010065857 Primary Effusion Lymphoma Diseases 0.000 description 1
- 241000288906 Primates Species 0.000 description 1
- 108091000054 Prion Proteins 0.000 description 1
- 102000029797 Prion Human genes 0.000 description 1
- 208000024777 Prion disease Diseases 0.000 description 1
- 108700030875 Programmed Cell Death 1 Ligand 2 Proteins 0.000 description 1
- 102100024213 Programmed cell death 1 ligand 2 Human genes 0.000 description 1
- 108010010974 Proteolipids Proteins 0.000 description 1
- 102000016202 Proteolipids Human genes 0.000 description 1
- 241000125945 Protoparvovirus Species 0.000 description 1
- 208000003100 Pseudomembranous Enterocolitis Diseases 0.000 description 1
- 206010037128 Pseudomembranous colitis Diseases 0.000 description 1
- 208000032536 Pseudomonas Infections Diseases 0.000 description 1
- 206010037294 Puerperal pyrexia Diseases 0.000 description 1
- 208000004430 Pulmonary Aspergillosis Diseases 0.000 description 1
- CZPWVGJYEJSRLH-UHFFFAOYSA-N Pyrimidine Chemical compound C1=CN=CN=C1 CZPWVGJYEJSRLH-UHFFFAOYSA-N 0.000 description 1
- 206010037742 Rabies Diseases 0.000 description 1
- 241000711798 Rabies lyssavirus Species 0.000 description 1
- 241001421802 Ramularia grevilleana Species 0.000 description 1
- 101100208249 Rattus norvegicus Thbs4 gene Proteins 0.000 description 1
- ALLWOAVDORUJLA-UHFFFAOYSA-N Rebamipida Chemical compound C=1C(=O)NC2=CC=CC=C2C=1CC(C(=O)O)NC(=O)C1=CC=C(Cl)C=C1 ALLWOAVDORUJLA-UHFFFAOYSA-N 0.000 description 1
- 102100037422 Receptor-type tyrosine-protein phosphatase C Human genes 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- 241000702247 Reoviridae Species 0.000 description 1
- 206010063837 Reperfusion injury Diseases 0.000 description 1
- 241000712907 Retroviridae Species 0.000 description 1
- 241000711931 Rhabdoviridae Species 0.000 description 1
- 208000004364 Rhinosporidiosis Diseases 0.000 description 1
- 206010061494 Rhinovirus infection Diseases 0.000 description 1
- IWUCXVSUMQZMFG-AFCXAGJDSA-N Ribavirin Chemical compound N1=C(C(=O)N)N=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 IWUCXVSUMQZMFG-AFCXAGJDSA-N 0.000 description 1
- NCDNCNXCDXHOMX-UHFFFAOYSA-N Ritonavir Natural products C=1C=CC=CC=1CC(NC(=O)OCC=1SC=NC=1)C(O)CC(CC=1C=CC=CC=1)NC(=O)C(C(C)C)NC(=O)N(C)CC1=CSC(C(C)C)=N1 NCDNCNXCDXHOMX-UHFFFAOYSA-N 0.000 description 1
- 206010039207 Rocky Mountain Spotted Fever Diseases 0.000 description 1
- 241001303601 Rosacea Species 0.000 description 1
- 241000714474 Rous sarcoma virus Species 0.000 description 1
- 241000710799 Rubella virus Species 0.000 description 1
- 241000315672 SARS coronavirus Species 0.000 description 1
- QCHFTSOMWOSFHM-UHFFFAOYSA-N SJ000285536 Natural products C1OC(=O)C(CC)C1CC1=CN=CN1C QCHFTSOMWOSFHM-UHFFFAOYSA-N 0.000 description 1
- 101100068078 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GCN4 gene Proteins 0.000 description 1
- 241000447727 Scabies Species 0.000 description 1
- 206010039587 Scarlet Fever Diseases 0.000 description 1
- 229920002684 Sepharose Polymers 0.000 description 1
- 206010040550 Shigella infections Diseases 0.000 description 1
- 241000700584 Simplexvirus Species 0.000 description 1
- 208000008582 Staphylococcal Food Poisoning Diseases 0.000 description 1
- 108010088160 Staphylococcal Protein A Proteins 0.000 description 1
- 206010041925 Staphylococcal infections Diseases 0.000 description 1
- 241000191967 Staphylococcus aureus Species 0.000 description 1
- 208000007107 Stomach Ulcer Diseases 0.000 description 1
- 241000193985 Streptococcus agalactiae Species 0.000 description 1
- 241000194049 Streptococcus equinus Species 0.000 description 1
- 241000193998 Streptococcus pneumoniae Species 0.000 description 1
- 241000193996 Streptococcus pyogenes Species 0.000 description 1
- 241001505901 Streptococcus sp. 'group A' Species 0.000 description 1
- 241000193990 Streptococcus sp. 'group B' Species 0.000 description 1
- 206010042254 Strongyloidiasis Diseases 0.000 description 1
- NINIDFKCEFEMDL-UHFFFAOYSA-N Sulfur Chemical group [S] NINIDFKCEFEMDL-UHFFFAOYSA-N 0.000 description 1
- UCKMPCXJQFINFW-UHFFFAOYSA-N Sulphide Chemical compound [S-2] UCKMPCXJQFINFW-UHFFFAOYSA-N 0.000 description 1
- 230000024932 T cell mediated immunity Effects 0.000 description 1
- 102100027208 T-cell antigen CD7 Human genes 0.000 description 1
- 101710165202 T-cell surface antigen CD2 Proteins 0.000 description 1
- 210000000173 T-lymphoid precursor cell Anatomy 0.000 description 1
- 206010043376 Tetanus Diseases 0.000 description 1
- 239000004098 Tetracycline Substances 0.000 description 1
- FZWLAAWBMGSTSO-UHFFFAOYSA-N Thiazole Chemical compound C1=CSC=N1 FZWLAAWBMGSTSO-UHFFFAOYSA-N 0.000 description 1
- 108090000190 Thrombin Proteins 0.000 description 1
- 108060008245 Thrombospondin Proteins 0.000 description 1
- 102000002938 Thrombospondin Human genes 0.000 description 1
- 241000130764 Tinea Species 0.000 description 1
- HJLSLZFTEKNLFI-UHFFFAOYSA-N Tinidazole Chemical compound CCS(=O)(=O)CCN1C(C)=NC=C1[N+]([O-])=O HJLSLZFTEKNLFI-UHFFFAOYSA-N 0.000 description 1
- 241000710924 Togaviridae Species 0.000 description 1
- YXFVVABEGXRONW-UHFFFAOYSA-N Toluene Chemical compound CC1=CC=CC=C1 YXFVVABEGXRONW-UHFFFAOYSA-N 0.000 description 1
- 206010044248 Toxic shock syndrome Diseases 0.000 description 1
- 231100000650 Toxic shock syndrome Toxicity 0.000 description 1
- 101710120037 Toxin CcdB Proteins 0.000 description 1
- 231100000579 Toxinosis Toxicity 0.000 description 1
- 206010044269 Toxocariasis Diseases 0.000 description 1
- 241000223997 Toxoplasma gondii Species 0.000 description 1
- 201000005485 Toxoplasmosis Diseases 0.000 description 1
- 101800001690 Transmembrane protein gp41 Proteins 0.000 description 1
- 206010052779 Transplant rejections Diseases 0.000 description 1
- 241000242541 Trematoda Species 0.000 description 1
- 241000869417 Trematodes Species 0.000 description 1
- 241000589886 Treponema Species 0.000 description 1
- 241000589904 Treponema pallidum subsp. pertenue Species 0.000 description 1
- 206010044608 Trichiniasis Diseases 0.000 description 1
- 208000005448 Trichomonas Infections Diseases 0.000 description 1
- 206010044620 Trichomoniasis Diseases 0.000 description 1
- 241000960389 Trichuris suis Species 0.000 description 1
- 241000223109 Trypanosoma cruzi Species 0.000 description 1
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 1
- 208000034784 Tularaemia Diseases 0.000 description 1
- 208000035896 Twin-reversed arterial perfusion sequence Diseases 0.000 description 1
- 208000037386 Typhoid Diseases 0.000 description 1
- 208000025865 Ulcer Diseases 0.000 description 1
- 102100038929 V-set domain-containing T-cell activation inhibitor 1 Human genes 0.000 description 1
- 241000700618 Vaccinia virus Species 0.000 description 1
- 208000037009 Vaginitis bacterial Diseases 0.000 description 1
- HDOVUKNUBWVHOX-QMMMGPOBSA-N Valacyclovir Chemical compound N1C(N)=NC(=O)C2=C1N(COCCOC(=O)[C@@H](N)C(C)C)C=N2 HDOVUKNUBWVHOX-QMMMGPOBSA-N 0.000 description 1
- WPVFJKSGQUFQAP-GKAPJAKFSA-N Valcyte Chemical compound N1C(N)=NC(=O)C2=C1N(COC(CO)COC(=O)[C@@H](N)C(C)C)C=N2 WPVFJKSGQUFQAP-GKAPJAKFSA-N 0.000 description 1
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Chemical compound CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 1
- 241001573052 Vandellia cirrhosa Species 0.000 description 1
- 206010046980 Varicella Diseases 0.000 description 1
- 102000009520 Vascular Endothelial Growth Factor C Human genes 0.000 description 1
- 108010073923 Vascular Endothelial Growth Factor C Proteins 0.000 description 1
- 102000009519 Vascular Endothelial Growth Factor D Human genes 0.000 description 1
- 108010073919 Vascular Endothelial Growth Factor D Proteins 0.000 description 1
- 241000251539 Vertebrata <Metazoa> Species 0.000 description 1
- 241000711975 Vesicular stomatitis virus Species 0.000 description 1
- OIRDTQYFTABQOQ-UHTZMRCNSA-N Vidarabine Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@@H]1O OIRDTQYFTABQOQ-UHTZMRCNSA-N 0.000 description 1
- 229930003427 Vitamin E Natural products 0.000 description 1
- 208000004143 Waterhouse-Friderichsen Syndrome Diseases 0.000 description 1
- 201000006449 West Nile encephalitis Diseases 0.000 description 1
- 241000244005 Wuchereria bancrofti Species 0.000 description 1
- 241000120645 Yellow fever virus group Species 0.000 description 1
- 241000607479 Yersinia pestis Species 0.000 description 1
- 206010061418 Zygomycosis Diseases 0.000 description 1
- RLXCFCYWFYXTON-JTTSDREOSA-N [(3S,8S,9S,10R,13S,14S,17R)-3-hydroxy-10,13-dimethyl-17-[(2R)-6-methylheptan-2-yl]-2,3,4,7,8,9,11,12,14,15,16,17-dodecahydro-1H-cyclopenta[a]phenanthren-16-yl] N-hexylcarbamate Chemical group C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC(OC(=O)NCCCCCC)[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 RLXCFCYWFYXTON-JTTSDREOSA-N 0.000 description 1
- HIHOWBSBBDRPDW-PTHRTHQKSA-N [(3s,8s,9s,10r,13r,14s,17r)-10,13-dimethyl-17-[(2r)-6-methylheptan-2-yl]-2,3,4,7,8,9,11,12,14,15,16,17-dodecahydro-1h-cyclopenta[a]phenanthren-3-yl] n-[2-(dimethylamino)ethyl]carbamate Chemical compound C1C=C2C[C@@H](OC(=O)NCCN(C)C)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HIHOWBSBBDRPDW-PTHRTHQKSA-N 0.000 description 1
- ZWBTYMGEBZUQTK-PVLSIAFMSA-N [(7S,9E,11S,12R,13S,14R,15R,16R,17S,18S,19E,21Z)-2,15,17,32-tetrahydroxy-11-methoxy-3,7,12,14,16,18,22-heptamethyl-1'-(2-methylpropyl)-6,23-dioxospiro[8,33-dioxa-24,27,29-triazapentacyclo[23.6.1.14,7.05,31.026,30]tritriaconta-1(32),2,4,9,19,21,24,26,30-nonaene-28,4'-piperidine]-13-yl] acetate Chemical compound CO[C@H]1\C=C\O[C@@]2(C)Oc3c(C2=O)c2c4NC5(CCN(CC(C)C)CC5)N=c4c(=NC(=O)\C(C)=C/C=C/[C@H](C)[C@H](O)[C@@H](C)[C@@H](O)[C@@H](C)[C@H](OC(C)=O)[C@@H]1C)c(O)c2c(O)c3C ZWBTYMGEBZUQTK-PVLSIAFMSA-N 0.000 description 1
- DLGSOJOOYHWROO-WQLSENKSSA-N [(z)-(1-methyl-2-oxoindol-3-ylidene)amino]thiourea Chemical compound C1=CC=C2N(C)C(=O)\C(=N/NC(N)=S)C2=C1 DLGSOJOOYHWROO-WQLSENKSSA-N 0.000 description 1
- RACDDTQBAFEERP-PLTZVPCUSA-N [2-[(6s,8s,9s,10r,13s,14s,17r)-6-chloro-17-hydroxy-10,13-dimethyl-3,11-dioxo-6,7,8,9,12,14,15,16-octahydrocyclopenta[a]phenanthren-17-yl]-2-oxoethyl] acetate Chemical compound C1([C@@H](Cl)C2)=CC(=O)C=C[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@@](C(=O)COC(=O)C)(O)[C@@]2(C)CC1=O RACDDTQBAFEERP-PLTZVPCUSA-N 0.000 description 1
- 229960004748 abacavir Drugs 0.000 description 1
- MCGSCOLBFJQGHM-SCZZXKLOSA-N abacavir Chemical compound C=12N=CN([C@H]3C=C[C@@H](CO)C3)C2=NC(N)=NC=1NC1CC1 MCGSCOLBFJQGHM-SCZZXKLOSA-N 0.000 description 1
- 230000001594 aberrant effect Effects 0.000 description 1
- 229960003146 abetimus sodium Drugs 0.000 description 1
- 230000005856 abnormality Effects 0.000 description 1
- VOVIALXJUBGFJZ-AMTWPJRWSA-N ac1l1y6y Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@@H]2[C@@H]1[C@@H]1C[C@H]3O[C@H](CCC)O[C@@]3(C(=O)CO)[C@@]1(C)C[C@@H]2O VOVIALXJUBGFJZ-AMTWPJRWSA-N 0.000 description 1
- DHKHKXVYLBGOIT-UHFFFAOYSA-N acetaldehyde Diethyl Acetal Natural products CCOC(C)OCC DHKHKXVYLBGOIT-UHFFFAOYSA-N 0.000 description 1
- 150000001241 acetals Chemical class 0.000 description 1
- 229940022663 acetate Drugs 0.000 description 1
- 150000001242 acetic acid derivatives Chemical class 0.000 description 1
- XVIYCJDWYLJQBG-UHFFFAOYSA-N acetic acid;adamantane Chemical compound CC(O)=O.C1C(C2)CC3CC1CC2C3 XVIYCJDWYLJQBG-UHFFFAOYSA-N 0.000 description 1
- 125000002777 acetyl group Chemical group [H]C([H])([H])C(*)=O 0.000 description 1
- 230000021736 acetylation Effects 0.000 description 1
- 238000006640 acetylation reaction Methods 0.000 description 1
- 229960001138 acetylsalicylic acid Drugs 0.000 description 1
- 229960004150 aciclovir Drugs 0.000 description 1
- MKUXAQIIEYXACX-UHFFFAOYSA-N aciclovir Chemical compound N1C(N)=NC(=O)C2=C1N(COCCO)C=N2 MKUXAQIIEYXACX-UHFFFAOYSA-N 0.000 description 1
- 206010000496 acne Diseases 0.000 description 1
- 229940119059 actemra Drugs 0.000 description 1
- 230000003213 activating effect Effects 0.000 description 1
- 208000012876 acute enteritis Diseases 0.000 description 1
- 208000037950 acute febrile pharyngitis Diseases 0.000 description 1
- 231100000354 acute hepatitis Toxicity 0.000 description 1
- 230000006022 acute inflammation Effects 0.000 description 1
- 208000038016 acute inflammation Diseases 0.000 description 1
- 229960001997 adefovir Drugs 0.000 description 1
- WOZSCQDILHKSGG-UHFFFAOYSA-N adefovir depivoxil Chemical compound N1=CN=C2N(CCOCP(=O)(OCOC(=O)C(C)(C)C)OCOC(=O)C(C)(C)C)C=NC2=C1N WOZSCQDILHKSGG-UHFFFAOYSA-N 0.000 description 1
- 108700010877 adenoviridae proteins Proteins 0.000 description 1
- 238000001261 affinity purification Methods 0.000 description 1
- 239000000556 agonist Substances 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 150000001294 alanine derivatives Chemical class 0.000 description 1
- 150000001336 alkenes Chemical class 0.000 description 1
- 125000003545 alkoxy group Chemical group 0.000 description 1
- 125000005600 alkyl phosphonate group Chemical group 0.000 description 1
- 229940100198 alkylating agent Drugs 0.000 description 1
- 239000002168 alkylating agent Substances 0.000 description 1
- 208000006778 allergic bronchopulmonary aspergillosis Diseases 0.000 description 1
- 229960004663 alminoprofen Drugs 0.000 description 1
- FPHLBGOJWPEVME-UHFFFAOYSA-N alminoprofen Chemical compound OC(=O)C(C)C1=CC=C(NCC(C)=C)C=C1 FPHLBGOJWPEVME-UHFFFAOYSA-N 0.000 description 1
- 108010050122 alpha 1-Antitrypsin Proteins 0.000 description 1
- 102000015395 alpha 1-Antitrypsin Human genes 0.000 description 1
- 229940024142 alpha 1-antitrypsin Drugs 0.000 description 1
- WQZGKKKJIJFFOK-PHYPRBDBSA-N alpha-D-galactose Chemical compound OC[C@H]1O[C@H](O)[C@H](O)[C@@H](O)[C@H]1O WQZGKKKJIJFFOK-PHYPRBDBSA-N 0.000 description 1
- 102000013529 alpha-Fetoproteins Human genes 0.000 description 1
- 108010026331 alpha-Fetoproteins Proteins 0.000 description 1
- DKNWSYNQZKUICI-UHFFFAOYSA-N amantadine Chemical compound C1C(C2)CC3CC2CC1(N)C3 DKNWSYNQZKUICI-UHFFFAOYSA-N 0.000 description 1
- 229960003805 amantadine Drugs 0.000 description 1
- 229950003408 amcinafide Drugs 0.000 description 1
- 230000009435 amidation Effects 0.000 description 1
- 238000007112 amidation reaction Methods 0.000 description 1
- 125000003368 amide group Chemical group 0.000 description 1
- 125000006242 amine protecting group Chemical group 0.000 description 1
- 150000001412 amines Chemical class 0.000 description 1
- 125000006295 amino methylene group Chemical group [H]N(*)C([H])([H])* 0.000 description 1
- 125000004103 aminoalkyl group Chemical group 0.000 description 1
- 229940126575 aminoglycoside Drugs 0.000 description 1
- 229940006984 ampyra Drugs 0.000 description 1
- 208000020936 anaerobic cellulitis Diseases 0.000 description 1
- 238000002399 angioplasty Methods 0.000 description 1
- 208000005067 anisakiasis Diseases 0.000 description 1
- 208000025009 anogenital human papillomavirus infection Diseases 0.000 description 1
- 201000004201 anogenital venereal wart Diseases 0.000 description 1
- 229940124599 anti-inflammatory drug Drugs 0.000 description 1
- 238000011861 anti-inflammatory therapy Methods 0.000 description 1
- 230000000340 anti-metabolite Effects 0.000 description 1
- 230000001028 anti-proliverative effect Effects 0.000 description 1
- 230000000798 anti-retroviral effect Effects 0.000 description 1
- 229940124350 antibacterial drug Drugs 0.000 description 1
- 230000005875 antibody response Effects 0.000 description 1
- 229940111136 antiinflammatory and antirheumatic drug fenamates Drugs 0.000 description 1
- 229940111133 antiinflammatory and antirheumatic drug oxicams Drugs 0.000 description 1
- 229940111131 antiinflammatory and antirheumatic product propionic acid derivative Drugs 0.000 description 1
- 239000003430 antimalarial agent Substances 0.000 description 1
- 229940100197 antimetabolite Drugs 0.000 description 1
- 239000002256 antimetabolite Substances 0.000 description 1
- 239000003443 antiviral agent Substances 0.000 description 1
- 230000007416 antiviral immune response Effects 0.000 description 1
- 229940121357 antivirals Drugs 0.000 description 1
- PYMYPHUHKUWMLA-UHFFFAOYSA-N arabinose Natural products OCC(O)C(O)C(O)C=O PYMYPHUHKUWMLA-UHFFFAOYSA-N 0.000 description 1
- 229940059756 arava Drugs 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 235000009697 arginine Nutrition 0.000 description 1
- 210000004507 artificial chromosome Anatomy 0.000 description 1
- 150000007860 aryl ester derivatives Chemical class 0.000 description 1
- 229940072224 asacol Drugs 0.000 description 1
- 201000009361 ascariasis Diseases 0.000 description 1
- 125000000613 asparagine group Chemical group N[C@@H](CC(N)=O)C(=O)* 0.000 description 1
- 229940009098 aspartate Drugs 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-N aspartic acid group Chemical group N[C@@H](CC(=O)O)C(=O)O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 1
- 210000001130 astrocyte Anatomy 0.000 description 1
- 244000309743 astrovirus Species 0.000 description 1
- AXRYRYVKAWYZBR-GASGPIRDSA-N atazanavir Chemical compound C([C@H](NC(=O)[C@@H](NC(=O)OC)C(C)(C)C)[C@@H](O)CN(CC=1C=CC(=CC=1)C=1N=CC=CC=1)NC(=O)[C@@H](NC(=O)OC)C(C)(C)C)C1=CC=CC=C1 AXRYRYVKAWYZBR-GASGPIRDSA-N 0.000 description 1
- 229960003277 atazanavir Drugs 0.000 description 1
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical group [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 1
- RKUNBYITZUJHSG-SPUOUPEWSA-N atropine Chemical compound O([C@H]1C[C@H]2CC[C@@H](C1)N2C)C(=O)C(CO)C1=CC=CC=C1 RKUNBYITZUJHSG-SPUOUPEWSA-N 0.000 description 1
- 229960000396 atropine Drugs 0.000 description 1
- 230000002238 attenuated effect Effects 0.000 description 1
- AUJRCFUBUPVWSZ-XTZHGVARSA-M auranofin Chemical compound CCP(CC)(CC)=[Au]S[C@@H]1O[C@H](COC(C)=O)[C@@H](OC(C)=O)[C@H](OC(C)=O)[C@H]1OC(C)=O AUJRCFUBUPVWSZ-XTZHGVARSA-M 0.000 description 1
- 229960005207 auranofin Drugs 0.000 description 1
- 229960001799 aurothioglucose Drugs 0.000 description 1
- 230000006470 autoimmune attack Effects 0.000 description 1
- 208000037979 autoimmune inflammatory disease Diseases 0.000 description 1
- 230000005784 autoimmunity Effects 0.000 description 1
- 229960001671 azapropazone Drugs 0.000 description 1
- WOIIIUDZSOLAIW-NSHDSACASA-N azapropazone Chemical compound C1=C(C)C=C2N3C(=O)[C@H](CC=C)C(=O)N3C(N(C)C)=NC2=C1 WOIIIUDZSOLAIW-NSHDSACASA-N 0.000 description 1
- 201000008680 babesiosis Diseases 0.000 description 1
- 229960000190 bacillus calmette–guérin vaccine Drugs 0.000 description 1
- 208000007456 balantidiasis Diseases 0.000 description 1
- 230000004888 barrier function Effects 0.000 description 1
- 230000037429 base substitution Effects 0.000 description 1
- 210000002469 basement membrane Anatomy 0.000 description 1
- 201000010564 basidiobolomycosis Diseases 0.000 description 1
- 229960004669 basiliximab Drugs 0.000 description 1
- 210000003651 basophil Anatomy 0.000 description 1
- 201000010642 baylisascariasis Diseases 0.000 description 1
- 229950000210 beclometasone dipropionate Drugs 0.000 description 1
- 229940092705 beclomethasone Drugs 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- FEJKLNWAOXSSNR-UHFFFAOYSA-N benorilate Chemical compound C1=CC(NC(=O)C)=CC=C1OC(=O)C1=CC=CC=C1OC(C)=O FEJKLNWAOXSSNR-UHFFFAOYSA-N 0.000 description 1
- 229960004277 benorilate Drugs 0.000 description 1
- 229960005430 benoxaprofen Drugs 0.000 description 1
- 125000003236 benzoyl group Chemical group [H]C1=C([H])C([H])=C(C([H])=C1[H])C(*)=O 0.000 description 1
- 125000001743 benzylic group Chemical group 0.000 description 1
- SRBFZHDQGSBBOR-UHFFFAOYSA-N beta-D-Pyranose-Lyxose Natural products OC1COC(O)C(O)C1O SRBFZHDQGSBBOR-UHFFFAOYSA-N 0.000 description 1
- IQFYYKKMVGJFEH-UHFFFAOYSA-N beta-L-thymidine Chemical class O=C1NC(=O)C(C)=CN1C1OC(CO)C(O)C1 IQFYYKKMVGJFEH-UHFFFAOYSA-N 0.000 description 1
- DRTQHJPVMGBUCF-PSQAKQOGSA-N beta-L-uridine Natural products O[C@H]1[C@@H](O)[C@H](CO)O[C@@H]1N1C(=O)NC(=O)C=C1 DRTQHJPVMGBUCF-PSQAKQOGSA-N 0.000 description 1
- 150000001576 beta-amino acids Chemical class 0.000 description 1
- 108091008324 binding proteins Proteins 0.000 description 1
- 230000008827 biological function Effects 0.000 description 1
- 235000010290 biphenyl Nutrition 0.000 description 1
- 239000004305 biphenyl Substances 0.000 description 1
- 229930189065 blasticidin Natural products 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 230000008499 blood brain barrier function Effects 0.000 description 1
- 210000001218 blood-brain barrier Anatomy 0.000 description 1
- 210000001185 bone marrow Anatomy 0.000 description 1
- 229960001169 brivudine Drugs 0.000 description 1
- 206010006451 bronchitis Diseases 0.000 description 1
- 201000006824 bubonic plague Diseases 0.000 description 1
- 230000000981 bystander Effects 0.000 description 1
- LWQQLNNNIPYSNX-UROSTWAQSA-N calcipotriol Chemical compound C1([C@H](O)/C=C/[C@@H](C)[C@@H]2[C@]3(CCCC(/[C@@H]3CC2)=C\C=C\2C([C@@H](O)C[C@H](O)C/2)=C)C)CC1 LWQQLNNNIPYSNX-UROSTWAQSA-N 0.000 description 1
- 229960002882 calcipotriol Drugs 0.000 description 1
- 239000001110 calcium chloride Substances 0.000 description 1
- 229910001628 calcium chloride Inorganic materials 0.000 description 1
- 229940112129 campath Drugs 0.000 description 1
- 229960001838 canakinumab Drugs 0.000 description 1
- 229940095731 candida albicans Drugs 0.000 description 1
- 201000003984 candidiasis Diseases 0.000 description 1
- 229940041011 carbapenems Drugs 0.000 description 1
- 150000001721 carbon Chemical group 0.000 description 1
- 150000004649 carbonic acid derivatives Chemical class 0.000 description 1
- 125000002915 carbonyl group Chemical group [*:2]C([*:1])=O 0.000 description 1
- JLQUFIHWVLZVTJ-UHFFFAOYSA-N carbosulfan Chemical compound CCCCN(CCCC)SN(C)C(=O)OC1=CC=CC2=C1OC(C)(C)C2 JLQUFIHWVLZVTJ-UHFFFAOYSA-N 0.000 description 1
- 150000001732 carboxylic acid derivatives Chemical group 0.000 description 1
- 125000002843 carboxylic acid group Chemical group 0.000 description 1
- 125000006244 carboxylic acid protecting group Chemical group 0.000 description 1
- 208000003295 carpal tunnel syndrome Diseases 0.000 description 1
- 229960003184 carprofen Drugs 0.000 description 1
- IVUMCTKHWDRRMH-UHFFFAOYSA-N carprofen Chemical compound C1=CC(Cl)=C[C]2C3=CC=C(C(C(O)=O)C)C=C3N=C21 IVUMCTKHWDRRMH-UHFFFAOYSA-N 0.000 description 1
- 125000002091 cationic group Chemical group 0.000 description 1
- 230000011748 cell maturation Effects 0.000 description 1
- 230000012292 cell migration Effects 0.000 description 1
- 238000001516 cell proliferation assay Methods 0.000 description 1
- 230000007969 cellular immunity Effects 0.000 description 1
- 230000036755 cellular response Effects 0.000 description 1
- 230000004700 cellular uptake Effects 0.000 description 1
- 229940124587 cephalosporin Drugs 0.000 description 1
- 150000001780 cephalosporins Chemical class 0.000 description 1
- WUTYZMFRCNBCHQ-PSASIEDQSA-N cevimeline Chemical compound C1S[C@H](C)O[C@]21C(CC1)CCN1C2 WUTYZMFRCNBCHQ-PSASIEDQSA-N 0.000 description 1
- 229960001314 cevimeline Drugs 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- AOXOCDRNSPFDPE-UKEONUMOSA-N chembl413654 Chemical class C([C@H](C(=O)NCC(=O)N[C@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@H](CCSC)C(=O)N[C@H](CC(O)=O)C(=O)N[C@H](CC=1C=CC=CC=1)C(N)=O)NC(=O)[C@@H](C)NC(=O)[C@@H](CCC(O)=O)NC(=O)[C@@H](CCC(O)=O)NC(=O)[C@@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H]1N(CCC1)C(=O)CNC(=O)[C@@H](N)CCC(O)=O)C1=CC=C(O)C=C1 AOXOCDRNSPFDPE-UKEONUMOSA-N 0.000 description 1
- NCEXYHBECQHGNR-UHFFFAOYSA-N chembl421 Chemical compound C1=C(O)C(C(=O)O)=CC(N=NC=2C=CC(=CC=2)S(=O)(=O)NC=2N=CC=CC=2)=C1 NCEXYHBECQHGNR-UHFFFAOYSA-N 0.000 description 1
- 125000003636 chemical group Chemical group 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 235000013330 chicken meat Nutrition 0.000 description 1
- 229940038705 chlamydia trachomatis Drugs 0.000 description 1
- 229960005091 chloramphenicol Drugs 0.000 description 1
- WIIZWVCIJKGZOK-RKDXNWHRSA-N chloramphenicol Chemical compound ClC(Cl)C(=O)N[C@H](CO)[C@H](O)C1=CC=C([N+]([O-])=O)C=C1 WIIZWVCIJKGZOK-RKDXNWHRSA-N 0.000 description 1
- 229950006229 chloroprednisone Drugs 0.000 description 1
- 235000012000 cholesterol Nutrition 0.000 description 1
- BHQCQFFYRZLCQQ-OELDTZBJSA-N cholic acid Chemical compound C([C@H]1C[C@H]2O)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC(O)=O)C)[C@@]2(C)[C@@H](O)C1 BHQCQFFYRZLCQQ-OELDTZBJSA-N 0.000 description 1
- 235000019416 cholic acid Nutrition 0.000 description 1
- 229960002471 cholic acid Drugs 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 208000013507 chronic prostatitis Diseases 0.000 description 1
- 229960000724 cidofovir Drugs 0.000 description 1
- 229960002436 cladribine Drugs 0.000 description 1
- 206010073251 clear cell renal cell carcinoma Diseases 0.000 description 1
- 229960005338 clevudine Drugs 0.000 description 1
- GBBJCSTXCAQSSJ-XQXXSGGOSA-N clevudine Chemical class O=C1NC(=O)C(C)=CN1[C@@H]1[C@H](F)[C@@H](O)[C@H](CO)O1 GBBJCSTXCAQSSJ-XQXXSGGOSA-N 0.000 description 1
- 229960002842 clobetasol Drugs 0.000 description 1
- CBGUOGMQLZIXBE-XGQKBEPLSA-N clobetasol propionate Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@H](C)[C@@](C(=O)CCl)(OC(=O)CC)[C@@]1(C)C[C@@H]2O CBGUOGMQLZIXBE-XGQKBEPLSA-N 0.000 description 1
- WDQPAMHFFCXSNU-BGABXYSRSA-N clofazimine Chemical compound C12=CC=CC=C2N=C2C=C(NC=3C=CC(Cl)=CC=3)C(=N/C(C)C)/C=C2N1C1=CC=C(Cl)C=C1 WDQPAMHFFCXSNU-BGABXYSRSA-N 0.000 description 1
- 229960004287 clofazimine Drugs 0.000 description 1
- 229940126523 co-drug Drugs 0.000 description 1
- 238000000975 co-precipitation Methods 0.000 description 1
- 239000011280 coal tar Substances 0.000 description 1
- 201000003486 coccidioidomycosis Diseases 0.000 description 1
- 235000012716 cod liver oil Nutrition 0.000 description 1
- 239000003026 cod liver oil Substances 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- 239000002131 composite material Substances 0.000 description 1
- 238000009833 condensation Methods 0.000 description 1
- 230000005494 condensation Effects 0.000 description 1
- 201000010563 conidiobolomycosis Diseases 0.000 description 1
- 230000021615 conjugation Effects 0.000 description 1
- 239000000470 constituent Substances 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- BMCQMVFGOVHVNG-TUFAYURCSA-N cortisol 17-butyrate Chemical compound C1CC2=CC(=O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@@](C(=O)CO)(OC(=O)CCC)[C@@]1(C)C[C@@H]2O BMCQMVFGOVHVNG-TUFAYURCSA-N 0.000 description 1
- FZCHYNWYXKICIO-FZNHGJLXSA-N cortisol 17-valerate Chemical compound C1CC2=CC(=O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@@](C(=O)CO)(OC(=O)CCCC)[C@@]1(C)C[C@@H]2O FZCHYNWYXKICIO-FZNHGJLXSA-N 0.000 description 1
- ALEXXDVDDISNDU-JZYPGELDSA-N cortisol 21-acetate Chemical compound C1CC2=CC(=O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@@](C(=O)COC(=O)C)(O)[C@@]1(C)C[C@@H]2O ALEXXDVDDISNDU-JZYPGELDSA-N 0.000 description 1
- 229950002276 cortodoxone Drugs 0.000 description 1
- 229940111134 coxibs Drugs 0.000 description 1
- 239000006071 cream Substances 0.000 description 1
- 238000004132 cross linking Methods 0.000 description 1
- 201000010549 croup Diseases 0.000 description 1
- 239000012228 culture supernatant Substances 0.000 description 1
- 238000012258 culturing Methods 0.000 description 1
- 229940064774 cuprimine Drugs 0.000 description 1
- 238000011461 current therapy Methods 0.000 description 1
- 150000001924 cycloalkanes Chemical group 0.000 description 1
- 229940124570 cycloplegic agent Drugs 0.000 description 1
- 230000003500 cycloplegic effect Effects 0.000 description 1
- 201000003146 cystitis Diseases 0.000 description 1
- 201000008167 cystoisosporiasis Diseases 0.000 description 1
- 229960000684 cytarabine Drugs 0.000 description 1
- 230000003412 degenerative effect Effects 0.000 description 1
- 239000007857 degradation product Substances 0.000 description 1
- 230000003413 degradative effect Effects 0.000 description 1
- 239000000412 dendrimer Substances 0.000 description 1
- 229920000736 dendritic polymer Polymers 0.000 description 1
- KXGVEGMKQFWNSR-UHFFFAOYSA-N deoxycholic acid Natural products C1CC2CC(O)CCC2(C)C2C1C1CCC(C(CCC(O)=O)C)C1(C)C(O)C2 KXGVEGMKQFWNSR-UHFFFAOYSA-N 0.000 description 1
- 230000037304 dermatophytes Effects 0.000 description 1
- WBGKWQHBNHJJPZ-LECWWXJVSA-N desonide Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@@H]2[C@@H]1[C@@H]1C[C@H]3OC(C)(C)O[C@@]3(C(=O)CO)[C@@]1(C)C[C@@H]2O WBGKWQHBNHJJPZ-LECWWXJVSA-N 0.000 description 1
- 229960003662 desonide Drugs 0.000 description 1
- 229960004486 desoxycorticosterone acetate Drugs 0.000 description 1
- 229960004833 dexamethasone phosphate Drugs 0.000 description 1
- VQODGRNSFPNSQE-CXSFZGCWSA-N dexamethasone phosphate Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@@H](C)[C@@](C(=O)COP(O)(O)=O)(O)[C@@]1(C)C[C@@H]2O VQODGRNSFPNSQE-CXSFZGCWSA-N 0.000 description 1
- 229950006137 dexfosfoserine Drugs 0.000 description 1
- VGGRNGOEDNBLPH-YJHCMWSWSA-N diapep277 Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)NCC(=O)NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N1[C@H](C(=O)N[C@@H](C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(O)=O)CCC1 VGGRNGOEDNBLPH-YJHCMWSWSA-N 0.000 description 1
- 201000004587 dientamoebiasis Diseases 0.000 description 1
- FKGKZBBDJSKCIS-UHFFFAOYSA-N diethyl-[[6-[[4-(hydroxycarbamoyl)phenyl]carbamoyloxymethyl]naphthalen-2-yl]methyl]azanium;chloride;hydrate Chemical compound O.[Cl-].C1=CC2=CC(C[NH+](CC)CC)=CC=C2C=C1COC(=O)NC1=CC=C(C(=O)NO)C=C1 FKGKZBBDJSKCIS-UHFFFAOYSA-N 0.000 description 1
- 229960002124 diflorasone diacetate Drugs 0.000 description 1
- BOBLHFUVNSFZPJ-JOYXJVLSSA-N diflorasone diacetate Chemical compound C1([C@@H](F)C2)=CC(=O)C=C[C@]1(C)[C@]1(F)[C@@H]2[C@@H]2C[C@H](C)[C@@](C(=O)COC(C)=O)(OC(C)=O)[C@@]2(C)C[C@@H]1O BOBLHFUVNSFZPJ-JOYXJVLSSA-N 0.000 description 1
- 229940063123 diflucan Drugs 0.000 description 1
- 229960003970 diflucortolone valerate Drugs 0.000 description 1
- HUPFGZXOMWLGNK-UHFFFAOYSA-N diflunisal Chemical compound C1=C(O)C(C(=O)O)=CC(C=2C(=CC(F)=CC=2)F)=C1 HUPFGZXOMWLGNK-UHFFFAOYSA-N 0.000 description 1
- 229960000616 diflunisal Drugs 0.000 description 1
- 206010013023 diphtheria Diseases 0.000 description 1
- 229940042406 direct acting antivirals neuraminidase inhibitors Drugs 0.000 description 1
- 229940042399 direct acting antivirals protease inhibitors Drugs 0.000 description 1
- 229940105576 disalcid Drugs 0.000 description 1
- NAGJZTKCGNOGPW-UHFFFAOYSA-N dithiophosphoric acid Chemical class OP(O)(S)=S NAGJZTKCGNOGPW-UHFFFAOYSA-N 0.000 description 1
- 235000020669 docosahexaenoic acid Nutrition 0.000 description 1
- KAUVQQXNCKESLC-UHFFFAOYSA-N docosahexaenoic acid (DHA) Natural products COC(=O)C(C)NOCC1=CC=CC=C1 KAUVQQXNCKESLC-UHFFFAOYSA-N 0.000 description 1
- 229960000735 docosanol Drugs 0.000 description 1
- 229940052761 dopaminergic adamantane derivative Drugs 0.000 description 1
- 208000008576 dracunculiasis Diseases 0.000 description 1
- 238000009510 drug design Methods 0.000 description 1
- 230000036267 drug metabolism Effects 0.000 description 1
- 239000003596 drug target Substances 0.000 description 1
- 208000000718 duodenal ulcer Diseases 0.000 description 1
- 230000008482 dysregulation Effects 0.000 description 1
- 229960002030 edoxudine Drugs 0.000 description 1
- XACKNLSZYYIACO-DJLDLDEBSA-N edoxudine Chemical compound O=C1NC(=O)C(CC)=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 XACKNLSZYYIACO-DJLDLDEBSA-N 0.000 description 1
- 229960003804 efavirenz Drugs 0.000 description 1
- XPOQHMRABVBWPR-ZDUSSCGKSA-N efavirenz Chemical compound C([C@]1(C2=CC(Cl)=CC=C2NC(=O)O1)C(F)(F)F)#CC1CC1 XPOQHMRABVBWPR-ZDUSSCGKSA-N 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 208000006036 elephantiasis Diseases 0.000 description 1
- PEASPLKKXBYDKL-FXEVSJAOSA-N enfuvirtide Chemical compound C([C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC=1C=CC=CC=1)C(N)=O)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(C)=O)[C@@H](C)O)[C@@H](C)CC)C1=CN=CN1 PEASPLKKXBYDKL-FXEVSJAOSA-N 0.000 description 1
- 229960002062 enfuvirtide Drugs 0.000 description 1
- 230000002708 enhancing effect Effects 0.000 description 1
- 229960000980 entecavir Drugs 0.000 description 1
- YXPVEXCTPGULBZ-WQYNNSOESA-N entecavir hydrate Chemical class O.C1=NC=2C(=O)NC(N)=NC=2N1[C@H]1C[C@H](O)[C@@H](CO)C1=C YXPVEXCTPGULBZ-WQYNNSOESA-N 0.000 description 1
- 206010014881 enterobiasis Diseases 0.000 description 1
- 208000010227 enterocolitis Diseases 0.000 description 1
- 230000000967 entomopathogenic effect Effects 0.000 description 1
- 230000007613 environmental effect Effects 0.000 description 1
- 229940088598 enzyme Drugs 0.000 description 1
- 210000003979 eosinophil Anatomy 0.000 description 1
- 208000021373 epidemic keratoconjunctivitis Diseases 0.000 description 1
- 201000004306 epidermodysplasia verruciformis Diseases 0.000 description 1
- 210000000981 epithelium Anatomy 0.000 description 1
- 229950009760 epratuzumab Drugs 0.000 description 1
- 201000005655 esophageal candidiasis Diseases 0.000 description 1
- 210000003238 esophagus Anatomy 0.000 description 1
- RTZKZFJDLAIYFH-UHFFFAOYSA-N ether Substances CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 1
- 229960005293 etodolac Drugs 0.000 description 1
- XFBVBWWRPKNWHW-UHFFFAOYSA-N etodolac Chemical compound C1COC(CC)(CC(O)=O)C2=N[C]3C(CC)=CC=CC3=C21 XFBVBWWRPKNWHW-UHFFFAOYSA-N 0.000 description 1
- 229940062770 evoxac Drugs 0.000 description 1
- 230000001747 exhibiting effect Effects 0.000 description 1
- 208000012997 experimental autoimmune encephalomyelitis Diseases 0.000 description 1
- 210000001723 extracellular space Anatomy 0.000 description 1
- 210000003414 extremity Anatomy 0.000 description 1
- 229960004396 famciclovir Drugs 0.000 description 1
- GGXKWVWZWMLJEH-UHFFFAOYSA-N famcyclovir Chemical compound N1=C(N)N=C2N(CCC(COC(=O)C)COC(C)=O)C=NC2=C1 GGXKWVWZWMLJEH-UHFFFAOYSA-N 0.000 description 1
- 201000003377 familial cold autoinflammatory syndrome 1 Diseases 0.000 description 1
- 229960004979 fampridine Drugs 0.000 description 1
- 206010016235 fasciolopsiasis Diseases 0.000 description 1
- ZPAKPRAICRBAOD-UHFFFAOYSA-N fenbufen Chemical compound C1=CC(C(=O)CCC(=O)O)=CC=C1C1=CC=CC=C1 ZPAKPRAICRBAOD-UHFFFAOYSA-N 0.000 description 1
- 229960001395 fenbufen Drugs 0.000 description 1
- 229950006236 fenclofenac Drugs 0.000 description 1
- IDKAXRLETRCXKS-UHFFFAOYSA-N fenclofenac Chemical compound OC(=O)CC1=CC=CC=C1OC1=CC=C(Cl)C=C1Cl IDKAXRLETRCXKS-UHFFFAOYSA-N 0.000 description 1
- HAWWPSYXSLJRBO-UHFFFAOYSA-N fendosal Chemical compound C1=C(O)C(C(=O)O)=CC(N2C(=CC=3C4=CC=CC=C4CCC=32)C=2C=CC=CC=2)=C1 HAWWPSYXSLJRBO-UHFFFAOYSA-N 0.000 description 1
- 229950005416 fendosal Drugs 0.000 description 1
- 229960001419 fenoprofen Drugs 0.000 description 1
- 229960002679 fentiazac Drugs 0.000 description 1
- 229960000489 feprazone Drugs 0.000 description 1
- 230000004761 fibrosis Effects 0.000 description 1
- 208000005239 filarial elephantiasis Diseases 0.000 description 1
- 235000021323 fish oil Nutrition 0.000 description 1
- 229940013317 fish oils Drugs 0.000 description 1
- 238000000684 flow cytometry Methods 0.000 description 1
- 229960003721 fluclorolone acetonide Drugs 0.000 description 1
- 229940094766 flucloronide Drugs 0.000 description 1
- 229960004884 fluconazole Drugs 0.000 description 1
- 229940042902 flumethasone pivalate Drugs 0.000 description 1
- JWRMHDSINXPDHB-OJAGFMMFSA-N flumethasone pivalate Chemical compound C1([C@@H](F)C2)=CC(=O)C=C[C@]1(C)[C@]1(F)[C@@H]2[C@@H]2C[C@@H](C)[C@@](C(=O)COC(=O)C(C)(C)C)(O)[C@@]2(C)C[C@@H]1O JWRMHDSINXPDHB-OJAGFMMFSA-N 0.000 description 1
- 229960000676 flunisolide Drugs 0.000 description 1
- 229960003973 fluocortolone Drugs 0.000 description 1
- GAKMQHDJQHZUTJ-ULHLPKEOSA-N fluocortolone Chemical compound C1([C@@H](F)C2)=CC(=O)C=C[C@]1(C)[C@@H]1[C@@H]2[C@@H]2C[C@@H](C)[C@H](C(=O)CO)[C@@]2(C)C[C@@H]1O GAKMQHDJQHZUTJ-ULHLPKEOSA-N 0.000 description 1
- FAOZLTXFLGPHNG-KNAQIMQKSA-N fluorometholone Chemical compound C([C@@]12C)=CC(=O)C=C1[C@@H](C)C[C@@H]1[C@]2(F)[C@@H](O)C[C@]2(C)[C@@](O)(C(C)=O)CC[C@H]21 FAOZLTXFLGPHNG-KNAQIMQKSA-N 0.000 description 1
- 229960003590 fluperolone Drugs 0.000 description 1
- HHPZZKDXAFJLOH-QZIXMDIESA-N fluperolone Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1CC[C@@](C(=O)[C@@H](OC(C)=O)C)(O)[C@@]1(C)C[C@@H]2O HHPZZKDXAFJLOH-QZIXMDIESA-N 0.000 description 1
- 229960000618 fluprednisolone Drugs 0.000 description 1
- 229960002390 flurbiprofen Drugs 0.000 description 1
- SYTBZMRGLBWNTM-UHFFFAOYSA-N flurbiprofen Chemical compound FC1=CC(C(C(O)=O)C)=CC=C1C1=CC=CC=C1 SYTBZMRGLBWNTM-UHFFFAOYSA-N 0.000 description 1
- 229960002714 fluticasone Drugs 0.000 description 1
- MGNNYOODZCAHBA-GQKYHHCASA-N fluticasone Chemical compound C1([C@@H](F)C2)=CC(=O)C=C[C@]1(C)[C@]1(F)[C@@H]2[C@@H]2C[C@@H](C)[C@@](C(=O)SCF)(O)[C@@]2(C)C[C@@H]1O MGNNYOODZCAHBA-GQKYHHCASA-N 0.000 description 1
- 230000003325 follicular Effects 0.000 description 1
- XCWFZHPEARLXJI-UHFFFAOYSA-N fomivirsen Chemical compound C1C(N2C3=C(C(NC(N)=N3)=O)N=C2)OC(CO)C1OP(O)(=S)OCC1OC(N(C)C(=O)\N=C(\N)C=C)CC1OP(O)(=S)OCC1OC(N2C3=C(C(NC(N)=N3)=O)N=C2)CC1OP(O)(=S)OCC1OC(N2C(NC(=O)C(C)=C2)=O)CC1OP(O)(=S)OCC1OC(N2C(NC(=O)C(C)=C2)=O)CC1OP(O)(=S)OCC1OC(N2C(NC(=O)C(C)=C2)=O)CC1OP(O)(=S)OCC1OC(N2C3=C(C(NC(N)=N3)=O)N=C2)CC1OP(O)(=S)OCC1OC(N2C(N=C(N)C=C2)=O)CC1OP(O)(=S)OCC(C(C1)OP(S)(=O)OCC2C(CC(O2)N2C(N=C(N)C=C2)=O)OP(O)(=S)OCC2C(CC(O2)N2C(NC(=O)C(C)=C2)=O)OP(O)(=S)OCC2C(CC(O2)N2C(NC(=O)C(C)=C2)=O)OP(O)(=S)OCC2C(CC(O2)N2C(N=C(N)C=C2)=O)OP(O)(=S)OCC2C(CC(O2)N2C(NC(=O)C(C)=C2)=O)OP(O)(=S)OCC2C(CC(O2)N2C(NC(=O)C(C)=C2)=O)OP(O)(=S)OCC2C(CC(O2)N2C(N=C(N)C=C2)=O)OP(O)(=S)OCC2C(CC(O2)N2C(NC(=O)C(C)=C2)=O)OP(O)(=S)OCC2C(CC(O2)N2C(NC(=O)C(C)=C2)=O)OP(O)(=S)OCC2C(CC(O2)N2C3=C(C(NC(N)=N3)=O)N=C2)OP(O)(=S)OCC2C(CC(O2)N2C(N=C(N)C=C2)=O)OP(O)(=S)OCC2C(CC(O2)N2C3=C(C(NC(N)=N3)=O)N=C2)O)OC1N1C=C(C)C(=O)NC1=O XCWFZHPEARLXJI-UHFFFAOYSA-N 0.000 description 1
- 229960001447 fomivirsen Drugs 0.000 description 1
- MLBVMOWEQCZNCC-OEMFJLHTSA-N fosamprenavir Chemical compound C([C@@H]([C@H](OP(O)(O)=O)CN(CC(C)C)S(=O)(=O)C=1C=CC(N)=CC=1)NC(=O)O[C@@H]1COCC1)C1=CC=CC=C1 MLBVMOWEQCZNCC-OEMFJLHTSA-N 0.000 description 1
- 229960003142 fosamprenavir Drugs 0.000 description 1
- 229960005102 foscarnet Drugs 0.000 description 1
- YMDXZJFXQJVXBF-STHAYSLISA-N fosfomycin Chemical compound C[C@@H]1O[C@@H]1P(O)(O)=O YMDXZJFXQJVXBF-STHAYSLISA-N 0.000 description 1
- 229960000308 fosfomycin Drugs 0.000 description 1
- 208000024386 fungal infectious disease Diseases 0.000 description 1
- 244000053095 fungal pathogen Species 0.000 description 1
- 229950010931 furofenac Drugs 0.000 description 1
- 229930182830 galactose Natural products 0.000 description 1
- WIGCFUFOHFEKBI-UHFFFAOYSA-N gamma-tocopherol Natural products CC(C)CCCC(C)CCCC(C)CCCC1CCC2C(C)C(O)C(C)C(C)C2O1 WIGCFUFOHFEKBI-UHFFFAOYSA-N 0.000 description 1
- 229960002963 ganciclovir Drugs 0.000 description 1
- IRSCQMHQWWYFCW-UHFFFAOYSA-N ganciclovir Chemical compound O=C1NC(N)=NC2=C1N=CN2COC(CO)CO IRSCQMHQWWYFCW-UHFFFAOYSA-N 0.000 description 1
- 230000002496 gastric effect Effects 0.000 description 1
- 210000001035 gastrointestinal tract Anatomy 0.000 description 1
- 238000001415 gene therapy Methods 0.000 description 1
- 238000012252 genetic analysis Methods 0.000 description 1
- BRZYSWJRSDMWLG-CAXSIQPQSA-N geneticin Natural products O1C[C@@](O)(C)[C@H](NC)[C@@H](O)[C@H]1O[C@@H]1[C@@H](O)[C@H](O[C@@H]2[C@@H]([C@@H](O)[C@H](O)[C@@H](C(C)O)O2)N)[C@@H](N)C[C@H]1N BRZYSWJRSDMWLG-CAXSIQPQSA-N 0.000 description 1
- 229940062737 gengraf Drugs 0.000 description 1
- 201000006592 giardiasis Diseases 0.000 description 1
- 229930195712 glutamate Natural products 0.000 description 1
- 235000013922 glutamic acid Nutrition 0.000 description 1
- 239000004220 glutamic acid Substances 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 150000004676 glycans Chemical class 0.000 description 1
- 150000002332 glycine derivatives Chemical class 0.000 description 1
- 125000003827 glycol group Chemical group 0.000 description 1
- 229930182470 glycoside Natural products 0.000 description 1
- 150000002338 glycosides Chemical class 0.000 description 1
- 125000003630 glycyl group Chemical group [H]N([H])C([H])([H])C(*)=O 0.000 description 1
- 201000000128 gnathomiasis Diseases 0.000 description 1
- 150000002343 gold Chemical class 0.000 description 1
- ZBKIUFWVEIBQRT-UHFFFAOYSA-N gold(1+) Chemical compound [Au+] ZBKIUFWVEIBQRT-UHFFFAOYSA-N 0.000 description 1
- IRPYFWIZKIOHQN-XTZHGVARSA-N gold;[(2r,3r,4s,5r,6s)-3,4,5-triacetyloxy-6-sulfanyloxan-2-yl]methyl acetate;triethylphosphane Chemical compound [Au].CC[PH+](CC)CC.CC(=O)OC[C@H]1O[C@@H]([S-])[C@H](OC(C)=O)[C@@H](OC(C)=O)[C@@H]1OC(C)=O IRPYFWIZKIOHQN-XTZHGVARSA-N 0.000 description 1
- 208000001786 gonorrhea Diseases 0.000 description 1
- 230000012010 growth Effects 0.000 description 1
- 229940047650 haemophilus influenzae Drugs 0.000 description 1
- 230000003394 haemopoietic effect Effects 0.000 description 1
- 229960002383 halcinonide Drugs 0.000 description 1
- 230000009931 harmful effect Effects 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 210000002443 helper t lymphocyte Anatomy 0.000 description 1
- ODZBBRURCPAEIQ-PIXDULNESA-N helpin Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(\C=C\Br)=C1 ODZBBRURCPAEIQ-PIXDULNESA-N 0.000 description 1
- 230000002607 hemopoietic effect Effects 0.000 description 1
- 229960002897 heparin Drugs 0.000 description 1
- 229920000669 heparin Polymers 0.000 description 1
- 208000002672 hepatitis B Diseases 0.000 description 1
- 208000010710 hepatitis C virus infection Diseases 0.000 description 1
- 229940124724 hepatitis-A vaccine Drugs 0.000 description 1
- 238000005734 heterodimerization reaction Methods 0.000 description 1
- 125000004051 hexyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])* 0.000 description 1
- 229960000857 homatropine Drugs 0.000 description 1
- 208000029080 human African trypanosomiasis Diseases 0.000 description 1
- 230000004727 humoral immunity Effects 0.000 description 1
- 230000008348 humoral response Effects 0.000 description 1
- FWFVLWGEFDIZMJ-FOMYWIRZSA-N hydrocortamate Chemical compound C1CC2=CC(=O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@@](C(=O)COC(=O)CN(CC)CC)(O)[C@@]1(C)C[C@@H]2O FWFVLWGEFDIZMJ-FOMYWIRZSA-N 0.000 description 1
- 229950000208 hydrocortamate Drugs 0.000 description 1
- 229960000890 hydrocortisone Drugs 0.000 description 1
- 229960001067 hydrocortisone acetate Drugs 0.000 description 1
- 229960001524 hydrocortisone butyrate Drugs 0.000 description 1
- 229960003331 hydrocortisone cypionate Drugs 0.000 description 1
- 229960000631 hydrocortisone valerate Drugs 0.000 description 1
- 239000001257 hydrogen Substances 0.000 description 1
- 229910052739 hydrogen Inorganic materials 0.000 description 1
- 230000007062 hydrolysis Effects 0.000 description 1
- 238000006460 hydrolysis reaction Methods 0.000 description 1
- QJHBJHUKURJDLG-UHFFFAOYSA-N hydroxy-L-lysine Natural products NCCCCC(NO)C(O)=O QJHBJHUKURJDLG-UHFFFAOYSA-N 0.000 description 1
- 125000002349 hydroxyamino group Chemical group [H]ON([H])[*] 0.000 description 1
- 239000002471 hydroxymethylglutaryl coenzyme A reductase inhibitor Substances 0.000 description 1
- 208000007188 hymenolepiasis Diseases 0.000 description 1
- 230000009846 hyperplastic epithelial lesion Effects 0.000 description 1
- 230000009610 hypersensitivity Effects 0.000 description 1
- 238000001908 ichthyotherapy Methods 0.000 description 1
- 229960004716 idoxuridine Drugs 0.000 description 1
- 238000007455 ileostomy Methods 0.000 description 1
- 230000005965 immune activity Effects 0.000 description 1
- 230000036737 immune function Effects 0.000 description 1
- 238000002649 immunization Methods 0.000 description 1
- 230000003053 immunization Effects 0.000 description 1
- 230000016784 immunoglobulin production Effects 0.000 description 1
- 230000001861 immunosuppressant effect Effects 0.000 description 1
- 229940124589 immunosuppressive drug Drugs 0.000 description 1
- 230000001024 immunotherapeutic effect Effects 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 208000037951 infantile gastroenteritis Diseases 0.000 description 1
- 201000007119 infective endocarditis Diseases 0.000 description 1
- 230000003960 inflammatory cascade Effects 0.000 description 1
- 108091008042 inhibitory receptors Proteins 0.000 description 1
- 238000002347 injection Methods 0.000 description 1
- 239000007924 injection Substances 0.000 description 1
- 229940090044 injection Drugs 0.000 description 1
- 230000015788 innate immune response Effects 0.000 description 1
- 229960003786 inosine Drugs 0.000 description 1
- 230000010354 integration Effects 0.000 description 1
- 102000006495 integrins Human genes 0.000 description 1
- 108010044426 integrins Proteins 0.000 description 1
- 229940079322 interferon Drugs 0.000 description 1
- 229960004461 interferon beta-1a Drugs 0.000 description 1
- 229960003161 interferon beta-1b Drugs 0.000 description 1
- 229940047124 interferons Drugs 0.000 description 1
- 201000006334 interstitial nephritis Diseases 0.000 description 1
- 201000006675 intestinal schistosomiasis Diseases 0.000 description 1
- 238000011835 investigation Methods 0.000 description 1
- 229960005386 ipilimumab Drugs 0.000 description 1
- 230000001788 irregular Effects 0.000 description 1
- 239000002085 irritant Substances 0.000 description 1
- 231100000021 irritant Toxicity 0.000 description 1
- RGXCTRIQQODGIZ-UHFFFAOYSA-O isodesmosine Chemical compound OC(=O)C(N)CCCC[N+]1=CC(CCC(N)C(O)=O)=CC(CCC(N)C(O)=O)=C1CCCC(N)C(O)=O RGXCTRIQQODGIZ-UHFFFAOYSA-O 0.000 description 1
- 125000001449 isopropyl group Chemical group [H]C([H])([H])C([H])(*)C([H])([H])[H] 0.000 description 1
- 229950011455 isoxepac Drugs 0.000 description 1
- QFGMXJOBTNZHEL-UHFFFAOYSA-N isoxepac Chemical compound O1CC2=CC=CC=C2C(=O)C2=CC(CC(=O)O)=CC=C21 QFGMXJOBTNZHEL-UHFFFAOYSA-N 0.000 description 1
- YYUAYBYLJSNDCX-UHFFFAOYSA-N isoxicam Chemical compound OC=1C2=CC=CC=C2S(=O)(=O)N(C)C=1C(=O)NC=1C=C(C)ON=1 YYUAYBYLJSNDCX-UHFFFAOYSA-N 0.000 description 1
- 229950002252 isoxicam Drugs 0.000 description 1
- VHVPQPYKVGDNFY-ZPGVKDDISA-N itraconazole Chemical compound O=C1N(C(C)CC)N=CN1C1=CC=C(N2CCN(CC2)C=2C=CC(OC[C@@H]3O[C@](CN4N=CN=C4)(OC3)C=3C(=CC(Cl)=CC=3)Cl)=CC=2)C=C1 VHVPQPYKVGDNFY-ZPGVKDDISA-N 0.000 description 1
- 238000005304 joining Methods 0.000 description 1
- 206010023332 keratitis Diseases 0.000 description 1
- 201000010666 keratoconjunctivitis Diseases 0.000 description 1
- DKYWVDODHFEZIM-UHFFFAOYSA-N ketoprofen Chemical compound OC(=O)C(C)C1=CC=CC(C(=O)C=2C=CC=CC=2)=C1 DKYWVDODHFEZIM-UHFFFAOYSA-N 0.000 description 1
- 229960000991 ketoprofen Drugs 0.000 description 1
- 229960004752 ketorolac Drugs 0.000 description 1
- OZWKMVRBQXNZKK-UHFFFAOYSA-N ketorolac Chemical compound OC(=O)C1CCN2C1=CC=C2C(=O)C1=CC=CC=C1 OZWKMVRBQXNZKK-UHFFFAOYSA-N 0.000 description 1
- 210000003734 kidney Anatomy 0.000 description 1
- 229950004244 laninamivir Drugs 0.000 description 1
- 201000000089 larynx squamous papilloma Diseases 0.000 description 1
- 208000037954 latent HSV-1 infection Diseases 0.000 description 1
- 125000000400 lauroyl group Chemical group O=C([*])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- 210000004901 leucine-rich repeat Anatomy 0.000 description 1
- 210000000265 leukocyte Anatomy 0.000 description 1
- 230000021633 leukocyte mediated immunity Effects 0.000 description 1
- 229950008325 levothyroxine Drugs 0.000 description 1
- 229940013926 lialda Drugs 0.000 description 1
- 208000028454 lice infestation Diseases 0.000 description 1
- 229940041028 lincosamides Drugs 0.000 description 1
- 238000001638 lipofection Methods 0.000 description 1
- 201000006506 lobomycosis Diseases 0.000 description 1
- 229940077676 low-energy diet formulations for treatment of obesity Drugs 0.000 description 1
- 210000001165 lymph node Anatomy 0.000 description 1
- 206010025226 lymphangitis Diseases 0.000 description 1
- 208000001419 lymphocytic choriomeningitis Diseases 0.000 description 1
- 210000005210 lymphoid organ Anatomy 0.000 description 1
- 125000003588 lysine group Chemical group [H]N([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 1
- 229940041033 macrolides Drugs 0.000 description 1
- 230000010534 mechanism of action Effects 0.000 description 1
- 229960004961 mechlorethamine Drugs 0.000 description 1
- HAWPXGHAZFHHAD-UHFFFAOYSA-N mechlorethamine Chemical class ClCCN(C)CCCl HAWPXGHAZFHHAD-UHFFFAOYSA-N 0.000 description 1
- 238000002483 medication Methods 0.000 description 1
- 229960001011 medrysone Drugs 0.000 description 1
- 201000001441 melanoma Diseases 0.000 description 1
- 229960004640 memantine Drugs 0.000 description 1
- BUGYDGFZZOZRHP-UHFFFAOYSA-N memantine Chemical compound C1C(C2)CC3(C)CC1(C)CC2(N)C3 BUGYDGFZZOZRHP-UHFFFAOYSA-N 0.000 description 1
- 208000037941 meningococcal disease Diseases 0.000 description 1
- 201000011475 meningoencephalitis Diseases 0.000 description 1
- 229960001810 meprednisone Drugs 0.000 description 1
- PIDANAQULIKBQS-RNUIGHNZSA-N meprednisone Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@@H]2[C@@H]1[C@@H]1C[C@H](C)[C@@](C(=O)CO)(O)[C@@]1(C)CC2=O PIDANAQULIKBQS-RNUIGHNZSA-N 0.000 description 1
- 229960001428 mercaptopurine Drugs 0.000 description 1
- 229960004963 mesalazine Drugs 0.000 description 1
- 210000002901 mesenchymal stem cell Anatomy 0.000 description 1
- 108020004999 messenger RNA Proteins 0.000 description 1
- 201000001198 metagonimiasis Diseases 0.000 description 1
- 230000001394 metastastic effect Effects 0.000 description 1
- 206010061289 metastatic neoplasm Diseases 0.000 description 1
- MYWUZJCMWCOHBA-VIFPVBQESA-N methamphetamine Chemical compound CN[C@@H](C)CC1=CC=CC=C1 MYWUZJCMWCOHBA-VIFPVBQESA-N 0.000 description 1
- 125000000956 methoxy group Chemical group [H]C([H])([H])O* 0.000 description 1
- MMHHPKCJJIFLBQ-QFIPXVFZSA-N methyl (2s)-2-[(2,6-dichlorobenzoyl)amino]-3-[4-[6-(dimethylamino)-1-methyl-2,4-dioxoquinazolin-3-yl]phenyl]propanoate Chemical compound N([C@@H](CC=1C=CC(=CC=1)N1C(C2=CC(=CC=C2N(C)C1=O)N(C)C)=O)C(=O)OC)C(=O)C1=C(Cl)C=CC=C1Cl MMHHPKCJJIFLBQ-QFIPXVFZSA-N 0.000 description 1
- 230000011987 methylation Effects 0.000 description 1
- 238000007069 methylation reaction Methods 0.000 description 1
- 229960004584 methylprednisolone Drugs 0.000 description 1
- 229960003152 metisazone Drugs 0.000 description 1
- 229960000282 metronidazole Drugs 0.000 description 1
- VAOCPAMSLUNLGC-UHFFFAOYSA-N metronidazole Chemical compound CC1=NC=C([N+]([O-])=O)N1CCO VAOCPAMSLUNLGC-UHFFFAOYSA-N 0.000 description 1
- 210000000274 microglia Anatomy 0.000 description 1
- 239000002480 mineral oil Substances 0.000 description 1
- 235000010446 mineral oil Nutrition 0.000 description 1
- 229940110254 minocin Drugs 0.000 description 1
- 229960004023 minocycline Drugs 0.000 description 1
- 229950006616 miroprofen Drugs 0.000 description 1
- OJGQFYYLKNCIJD-UHFFFAOYSA-N miroprofen Chemical compound C1=CC(C(C(O)=O)C)=CC=C1C1=CN(C=CC=C2)C2=N1 OJGQFYYLKNCIJD-UHFFFAOYSA-N 0.000 description 1
- ZAHQPTJLOCWVPG-UHFFFAOYSA-N mitoxantrone dihydrochloride Chemical compound Cl.Cl.O=C1C2=C(O)C=CC(O)=C2C(=O)C2=C1C(NCCNCCO)=CC=C2NCCNCCO ZAHQPTJLOCWVPG-UHFFFAOYSA-N 0.000 description 1
- 229960004169 mitoxantrone hydrochloride Drugs 0.000 description 1
- 229950000844 mizoribine Drugs 0.000 description 1
- 230000001333 moisturizer Effects 0.000 description 1
- 238000001823 molecular biology technique Methods 0.000 description 1
- 239000000178 monomer Substances 0.000 description 1
- 125000004573 morpholin-4-yl group Chemical group N1(CCOCC1)* 0.000 description 1
- 238000010172 mouse model Methods 0.000 description 1
- 208000030194 mouth disease Diseases 0.000 description 1
- 201000007524 mucormycosis Diseases 0.000 description 1
- 208000010805 mumps infectious disease Diseases 0.000 description 1
- 229960003128 mupirocin Drugs 0.000 description 1
- 229930187697 mupirocin Natural products 0.000 description 1
- DDHVILIIHBIMQU-YJGQQKNPSA-L mupirocin calcium hydrate Chemical compound O.O.[Ca+2].C[C@H](O)[C@H](C)[C@@H]1O[C@H]1C[C@@H]1[C@@H](O)[C@@H](O)[C@H](C\C(C)=C\C(=O)OCCCCCCCCC([O-])=O)OC1.C[C@H](O)[C@H](C)[C@@H]1O[C@H]1C[C@@H]1[C@@H](O)[C@@H](O)[C@H](C\C(C)=C\C(=O)OCCCCCCCCC([O-])=O)OC1 DDHVILIIHBIMQU-YJGQQKNPSA-L 0.000 description 1
- 229940014456 mycophenolate Drugs 0.000 description 1
- 229960000951 mycophenolic acid Drugs 0.000 description 1
- 208000031225 myocardial ischemia Diseases 0.000 description 1
- 229940090001 myochrysine Drugs 0.000 description 1
- 125000001419 myristoyl group Chemical group O=C([*])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- PWDYHMBTPGXCSN-VCBMUGGBSA-N n,n'-bis[3,5-bis[(e)-n-(diaminomethylideneamino)-c-methylcarbonimidoyl]phenyl]decanediamide Chemical compound NC(N)=N/N=C(\C)C1=CC(C(=N/N=C(N)N)/C)=CC(NC(=O)CCCCCCCCC(=O)NC=2C=C(C=C(C=2)C(\C)=N\N=C(N)N)C(\C)=N\N=C(N)N)=C1 PWDYHMBTPGXCSN-VCBMUGGBSA-N 0.000 description 1
- 229950006780 n-acetylglucosamine Drugs 0.000 description 1
- DQCKKXVULJGBQN-XFWGSAIBSA-N naltrexone Chemical compound N1([C@@H]2CC3=CC=C(C=4O[C@@H]5[C@](C3=4)([C@]2(CCC5=O)O)CC1)O)CC1CC1 DQCKKXVULJGBQN-XFWGSAIBSA-N 0.000 description 1
- 229960003086 naltrexone Drugs 0.000 description 1
- 210000000822 natural killer cell Anatomy 0.000 description 1
- 201000007970 necrotizing fasciitis Diseases 0.000 description 1
- 230000007896 negative regulation of T cell activation Effects 0.000 description 1
- 230000009707 neogenesis Effects 0.000 description 1
- 229940063121 neoral Drugs 0.000 description 1
- 210000003061 neural cell Anatomy 0.000 description 1
- 230000007171 neuropathology Effects 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 210000000440 neutrophil Anatomy 0.000 description 1
- IJGRMHOSHXDMSA-UHFFFAOYSA-N nitrogen Substances N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 1
- 125000004433 nitrogen atom Chemical group N* 0.000 description 1
- QJGQUHMNIGDVPM-UHFFFAOYSA-N nitrogen group Chemical group [N] QJGQUHMNIGDVPM-UHFFFAOYSA-N 0.000 description 1
- 201000011330 nonpapillary renal cell carcinoma Diseases 0.000 description 1
- UMRZSTCPUPJPOJ-KNVOCYPGSA-N norbornane Chemical compound C1C[C@H]2CC[C@@H]1C2 UMRZSTCPUPJPOJ-KNVOCYPGSA-N 0.000 description 1
- 229940127073 nucleoside analogue Drugs 0.000 description 1
- 125000003835 nucleoside group Chemical group 0.000 description 1
- 229960000988 nystatin Drugs 0.000 description 1
- VQOXZBDYSJBXMA-NQTDYLQESA-N nystatin A1 Chemical compound O[C@H]1[C@@H](N)[C@H](O)[C@@H](C)O[C@H]1O[C@H]1/C=C/C=C/C=C/C=C/CC/C=C/C=C/[C@H](C)[C@@H](O)[C@@H](C)[C@H](C)OC(=O)C[C@H](O)C[C@H](O)C[C@H](O)CC[C@@H](O)[C@H](O)C[C@](O)(C[C@H](O)[C@H]2C(O)=O)O[C@H]2C1 VQOXZBDYSJBXMA-NQTDYLQESA-N 0.000 description 1
- 208000003177 ocular onchocerciasis Diseases 0.000 description 1
- 239000002674 ointment Substances 0.000 description 1
- 125000002811 oleoyl group Chemical group O=C([*])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])/C([H])=C([H])\C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- 238000002515 oligonucleotide synthesis Methods 0.000 description 1
- 235000020660 omega-3 fatty acid Nutrition 0.000 description 1
- 229940012843 omega-3 fatty acid Drugs 0.000 description 1
- 239000006014 omega-3 oil Substances 0.000 description 1
- 208000002042 onchocerciasis Diseases 0.000 description 1
- 229960005343 ondansetron Drugs 0.000 description 1
- 206010030861 ophthalmia neonatorum Diseases 0.000 description 1
- 229940127240 opiate Drugs 0.000 description 1
- 150000002894 organic compounds Chemical class 0.000 description 1
- 229960003104 ornithine Drugs 0.000 description 1
- PGZUMBJQJWIWGJ-ONAKXNSWSA-N oseltamivir phosphate Chemical compound OP(O)(O)=O.CCOC(=O)C1=C[C@@H](OC(CC)CC)[C@H](NC(C)=O)[C@@H](N)C1 PGZUMBJQJWIWGJ-ONAKXNSWSA-N 0.000 description 1
- 229950002610 otelixizumab Drugs 0.000 description 1
- 230000002018 overexpression Effects 0.000 description 1
- 238000007500 overflow downdraw method Methods 0.000 description 1
- 229960002739 oxaprozin Drugs 0.000 description 1
- OFPXSFXSNFPTHF-UHFFFAOYSA-N oxaprozin Chemical compound O1C(CCC(=O)O)=NC(C=2C=CC=CC=2)=C1C1=CC=CC=C1 OFPXSFXSNFPTHF-UHFFFAOYSA-N 0.000 description 1
- 229950005708 oxepinac Drugs 0.000 description 1
- 239000001301 oxygen Chemical group 0.000 description 1
- 229960000649 oxyphenbutazone Drugs 0.000 description 1
- HFHZKZSRXITVMK-UHFFFAOYSA-N oxyphenbutazone Chemical compound O=C1C(CCCC)C(=O)N(C=2C=CC=CC=2)N1C1=CC=C(O)C=C1 HFHZKZSRXITVMK-UHFFFAOYSA-N 0.000 description 1
- 125000001312 palmitoyl group Chemical group O=C([*])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- 125000000913 palmityl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- 229960002566 papillomavirus vaccine Drugs 0.000 description 1
- 229950002111 paquinimod Drugs 0.000 description 1
- 206010033794 paragonimiasis Diseases 0.000 description 1
- 229960002858 paramethasone Drugs 0.000 description 1
- 230000003071 parasitic effect Effects 0.000 description 1
- 230000036961 partial effect Effects 0.000 description 1
- 230000007170 pathology Effects 0.000 description 1
- 108010092853 peginterferon alfa-2a Proteins 0.000 description 1
- 229960003930 peginterferon alfa-2a Drugs 0.000 description 1
- 229960001179 penciclovir Drugs 0.000 description 1
- 230000000149 penetrating effect Effects 0.000 description 1
- 229960001639 penicillamine Drugs 0.000 description 1
- 150000002960 penicillins Chemical class 0.000 description 1
- 229940072223 pentasa Drugs 0.000 description 1
- ONTNXMBMXUNDBF-UHFFFAOYSA-N pentatriacontane-17,18,19-triol Chemical compound CCCCCCCCCCCCCCCCC(O)C(O)C(O)CCCCCCCCCCCCCCCC ONTNXMBMXUNDBF-UHFFFAOYSA-N 0.000 description 1
- 208000011906 peptic ulcer disease Diseases 0.000 description 1
- 239000000137 peptide hydrolase inhibitor Substances 0.000 description 1
- XRQDFNLINLXZLB-CKIKVBCHSA-N peramivir Chemical class CCC(CC)[C@H](NC(C)=O)[C@@H]1[C@H](O)[C@@H](C(O)=O)C[C@H]1NC(N)=N XRQDFNLINLXZLB-CKIKVBCHSA-N 0.000 description 1
- 229960001084 peramivir Drugs 0.000 description 1
- 230000002093 peripheral effect Effects 0.000 description 1
- 230000002688 persistence Effects 0.000 description 1
- 235000019271 petrolatum Nutrition 0.000 description 1
- 239000008177 pharmaceutical agent Substances 0.000 description 1
- 201000001369 pharyngoconjunctival fever Diseases 0.000 description 1
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 1
- 229960002895 phenylbutazone Drugs 0.000 description 1
- VYMDGNCVAMGZFE-UHFFFAOYSA-N phenylbutazonum Chemical compound O=C1C(CCCC)C(=O)N(C=2C=CC=CC=2)N1C1=CC=CC=C1 VYMDGNCVAMGZFE-UHFFFAOYSA-N 0.000 description 1
- 150000004713 phosphodiesters Chemical class 0.000 description 1
- 150000003904 phospholipids Chemical class 0.000 description 1
- 150000008298 phosphoramidates Chemical class 0.000 description 1
- BZQFBWGGLXLEPQ-REOHCLBHSA-N phosphoserine Chemical compound OC(=O)[C@@H](N)COP(O)(O)=O BZQFBWGGLXLEPQ-REOHCLBHSA-N 0.000 description 1
- USRGIUJOYOXOQJ-GBXIJSLDSA-N phosphothreonine Chemical compound OP(=O)(O)O[C@H](C)[C@H](N)C(O)=O USRGIUJOYOXOQJ-GBXIJSLDSA-N 0.000 description 1
- 230000010399 physical interaction Effects 0.000 description 1
- 230000001766 physiological effect Effects 0.000 description 1
- 230000008288 physiological mechanism Effects 0.000 description 1
- 229960001416 pilocarpine Drugs 0.000 description 1
- 125000004193 piperazinyl group Chemical group 0.000 description 1
- 125000003386 piperidinyl group Chemical group 0.000 description 1
- 229960002702 piroxicam Drugs 0.000 description 1
- QYSPLQLAKJAUJT-UHFFFAOYSA-N piroxicam Chemical compound OC=1C2=CC=CC=C2S(=O)(=O)N(C)C=1C(=O)NC1=CC=CC=N1 QYSPLQLAKJAUJT-UHFFFAOYSA-N 0.000 description 1
- 229960000851 pirprofen Drugs 0.000 description 1
- PIDSZXPFGCURGN-UHFFFAOYSA-N pirprofen Chemical compound ClC1=CC(C(C(O)=O)C)=CC=C1N1CC=CC1 PIDSZXPFGCURGN-UHFFFAOYSA-N 0.000 description 1
- 201000009430 pneumonic plague Diseases 0.000 description 1
- 229920000768 polyamine Polymers 0.000 description 1
- 150000004291 polyenes Chemical class 0.000 description 1
- 229920000656 polylysine Polymers 0.000 description 1
- 235000021085 polyunsaturated fats Nutrition 0.000 description 1
- 208000037955 postinfectious encephalomyelitis Diseases 0.000 description 1
- 230000003389 potentiating effect Effects 0.000 description 1
- 229960003101 pranoprofen Drugs 0.000 description 1
- 235000013406 prebiotics Nutrition 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 239000002243 precursor Substances 0.000 description 1
- 150000003117 prednisolones Chemical class 0.000 description 1
- 230000013823 prenylation Effects 0.000 description 1
- 238000002953 preparative HPLC Methods 0.000 description 1
- 208000037953 primary HSV-1 infection Diseases 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 230000007112 pro inflammatory response Effects 0.000 description 1
- 239000006041 probiotic Substances 0.000 description 1
- 235000018291 probiotics Nutrition 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 229940072288 prograf Drugs 0.000 description 1
- 230000002062 proliferating effect Effects 0.000 description 1
- 201000008171 proliferative glomerulonephritis Diseases 0.000 description 1
- 125000001500 prolyl group Chemical group [H]N1C([H])(C(=O)[*])C([H])([H])C([H])([H])C1([H])[H] 0.000 description 1
- 229940021993 prophylactic vaccine Drugs 0.000 description 1
- 150000005599 propionic acid derivatives Chemical class 0.000 description 1
- 201000007094 prostatitis Diseases 0.000 description 1
- 201000001474 proteinuria Diseases 0.000 description 1
- 230000004850 protein–protein interaction Effects 0.000 description 1
- 230000006337 proteolytic cleavage Effects 0.000 description 1
- 229950010131 puromycin Drugs 0.000 description 1
- 150000003217 pyrazoles Chemical class 0.000 description 1
- 125000000719 pyrrolidinyl group Chemical group 0.000 description 1
- MIXMJCQRHVAJIO-TZHJZOAOSA-N qk4dys664x Chemical compound O.C1([C@@H](F)C2)=CC(=O)C=C[C@]1(C)[C@@H]1[C@@H]2[C@@H]2C[C@H]3OC(C)(C)O[C@@]3(C(=O)CO)[C@@]2(C)C[C@@H]1O.C1([C@@H](F)C2)=CC(=O)C=C[C@]1(C)[C@@H]1[C@@H]2[C@@H]2C[C@H]3OC(C)(C)O[C@@]3(C(=O)CO)[C@@]2(C)C[C@@H]1O MIXMJCQRHVAJIO-TZHJZOAOSA-N 0.000 description 1
- 150000007660 quinolones Chemical class 0.000 description 1
- CZFFBEXEKNGXKS-UHFFFAOYSA-N raltegravir Chemical compound O1C(C)=NN=C1C(=O)NC(C)(C)C1=NC(C(=O)NCC=2C=CC(F)=CC=2)=C(O)C(=O)N1C CZFFBEXEKNGXKS-UHFFFAOYSA-N 0.000 description 1
- 229960004742 raltegravir Drugs 0.000 description 1
- 229950004535 rebamipide Drugs 0.000 description 1
- 108700015048 receptor decoy activity proteins Proteins 0.000 description 1
- 230000007115 recruitment Effects 0.000 description 1
- 230000014493 regulation of gene expression Effects 0.000 description 1
- 229940061374 relenza Drugs 0.000 description 1
- 201000010384 renal tubular acidosis Diseases 0.000 description 1
- 238000009877 rendering Methods 0.000 description 1
- 238000002271 resection Methods 0.000 description 1
- 230000000717 retained effect Effects 0.000 description 1
- 229960000329 ribavirin Drugs 0.000 description 1
- HZCAHMRRMINHDJ-DBRKOABJSA-N ribavirin Natural products O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1N=CN=C1 HZCAHMRRMINHDJ-DBRKOABJSA-N 0.000 description 1
- 229940063638 ridaura Drugs 0.000 description 1
- 229960000885 rifabutin Drugs 0.000 description 1
- WDZCUPBHRAEYDL-GZAUEHORSA-N rifapentine Chemical compound O([C@](C1=O)(C)O/C=C/[C@@H]([C@H]([C@@H](OC(C)=O)[C@H](C)[C@H](O)[C@H](C)[C@@H](O)[C@@H](C)\C=C\C=C(C)/C(=O)NC=2C(O)=C3C(O)=C4C)C)OC)C4=C1C3=C(O)C=2\C=N\N(CC1)CCN1C1CCCC1 WDZCUPBHRAEYDL-GZAUEHORSA-N 0.000 description 1
- 229960002599 rifapentine Drugs 0.000 description 1
- 229960000888 rimantadine Drugs 0.000 description 1
- 229960000311 ritonavir Drugs 0.000 description 1
- NCDNCNXCDXHOMX-XGKFQTDJSA-N ritonavir Chemical compound N([C@@H](C(C)C)C(=O)N[C@H](C[C@H](O)[C@H](CC=1C=CC=CC=1)NC(=O)OCC=1SC=NC=1)CC=1C=CC=CC=1)C(=O)N(C)CC1=CSC(C(C)C)=N1 NCDNCNXCDXHOMX-XGKFQTDJSA-N 0.000 description 1
- 239000003419 rna directed dna polymerase inhibitor Substances 0.000 description 1
- 229950010316 rontalizumab Drugs 0.000 description 1
- 201000004700 rosacea Diseases 0.000 description 1
- 229940063635 salagen Drugs 0.000 description 1
- 229940063122 sandimmune Drugs 0.000 description 1
- 208000005687 scabies Diseases 0.000 description 1
- 239000002412 selectin antagonist Substances 0.000 description 1
- 229950011005 semapimod Drugs 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 230000036303 septic shock Effects 0.000 description 1
- 208000013223 septicemia Diseases 0.000 description 1
- 238000002864 sequence alignment Methods 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 210000002966 serum Anatomy 0.000 description 1
- 201000006476 shipyard eye Diseases 0.000 description 1
- 239000013605 shuttle vector Substances 0.000 description 1
- 239000002911 sialidase inhibitor Substances 0.000 description 1
- 229950010077 sifalimumab Drugs 0.000 description 1
- 230000019491 signal transduction Effects 0.000 description 1
- 230000007781 signaling event Effects 0.000 description 1
- 201000009890 sinusitis Diseases 0.000 description 1
- MFFMDFFZMYYVKS-SECBINFHSA-N sitagliptin Chemical compound C([C@H](CC(=O)N1CC=2N(C(=NN=2)C(F)(F)F)CC1)N)C1=CC(F)=C(F)C=C1F MFFMDFFZMYYVKS-SECBINFHSA-N 0.000 description 1
- 229960004034 sitagliptin Drugs 0.000 description 1
- 201000002612 sleeping sickness Diseases 0.000 description 1
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 1
- 125000006850 spacer group Chemical group 0.000 description 1
- 201000000539 sparganosis Diseases 0.000 description 1
- 108010061749 spliceosomal peptide P140 Proteins 0.000 description 1
- 238000003153 stable transfection Methods 0.000 description 1
- 201000002190 staphyloenterotoxemia Diseases 0.000 description 1
- 125000004079 stearyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- 238000009168 stem cell therapy Methods 0.000 description 1
- 238000009580 stem-cell therapy Methods 0.000 description 1
- 230000004936 stimulating effect Effects 0.000 description 1
- 210000002784 stomach Anatomy 0.000 description 1
- 208000003265 stomatitis Diseases 0.000 description 1
- 229940031000 streptococcus pneumoniae Drugs 0.000 description 1
- 229960005322 streptomycin Drugs 0.000 description 1
- 125000003107 substituted aryl group Chemical group 0.000 description 1
- 229950005175 sudoxicam Drugs 0.000 description 1
- IIACRCGMVDHOTQ-UHFFFAOYSA-N sulfamic acid Chemical group NS(O)(=O)=O IIACRCGMVDHOTQ-UHFFFAOYSA-N 0.000 description 1
- 229940124530 sulfonamide Drugs 0.000 description 1
- BDHFUVZGWQCTTF-UHFFFAOYSA-M sulfonate Chemical compound [O-]S(=O)=O BDHFUVZGWQCTTF-UHFFFAOYSA-M 0.000 description 1
- 150000003457 sulfones Chemical group 0.000 description 1
- 150000003462 sulfoxides Chemical class 0.000 description 1
- 239000011593 sulfur Chemical group 0.000 description 1
- 229960000894 sulindac Drugs 0.000 description 1
- MLKXDPUZXIRXEP-MFOYZWKCSA-N sulindac Chemical compound CC1=C(CC(O)=O)C2=CC(F)=CC=C2\C1=C/C1=CC=C(S(C)=O)C=C1 MLKXDPUZXIRXEP-MFOYZWKCSA-N 0.000 description 1
- 230000008093 supporting effect Effects 0.000 description 1
- 230000001629 suppression Effects 0.000 description 1
- 229960004492 suprofen Drugs 0.000 description 1
- 238000001356 surgical procedure Methods 0.000 description 1
- 238000010189 synthetic method Methods 0.000 description 1
- 229940037128 systemic glucocorticoids Drugs 0.000 description 1
- 229960001967 tacrolimus Drugs 0.000 description 1
- 229940061367 tamiflu Drugs 0.000 description 1
- NHKZSTHOYNWEEZ-AFCXAGJDSA-N taribavirin Chemical compound N1=C(C(=N)N)N=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 NHKZSTHOYNWEEZ-AFCXAGJDSA-N 0.000 description 1
- 229950006081 taribavirin Drugs 0.000 description 1
- 229960005311 telbivudine Drugs 0.000 description 1
- IQFYYKKMVGJFEH-CSMHCCOUSA-N telbivudine Chemical class O=C1NC(=O)C(C)=CN1[C@H]1O[C@@H](CO)[C@H](O)C1 IQFYYKKMVGJFEH-CSMHCCOUSA-N 0.000 description 1
- CBPNZQVSJQDFBE-HGVVHKDOSA-N temsirolimus Chemical compound C1C[C@@H](OC(=O)C(C)(CO)CO)[C@H](OC)C[C@@H]1C[C@@H](C)[C@H]1OC(=O)[C@@H]2CCCCN2C(=O)C(=O)[C@](O)(O2)[C@H](C)CCC2C[C@H](OC)/C(C)=C/C=C/C=C/[C@@H](C)C[C@@H](C)C(=O)[C@H](OC)[C@H](O)/C(C)=C/[C@@H](C)C(=O)C1 CBPNZQVSJQDFBE-HGVVHKDOSA-N 0.000 description 1
- 229960004556 tenofovir Drugs 0.000 description 1
- VCMJCVGFSROFHV-WZGZYPNHSA-N tenofovir disoproxil fumarate Chemical compound OC(=O)\C=C\C(O)=O.N1=CN=C2N(C[C@@H](C)OCP(=O)(OCOC(=O)OC(C)C)OCOC(=O)OC(C)C)C=NC2=C1N VCMJCVGFSROFHV-WZGZYPNHSA-N 0.000 description 1
- 229960002871 tenoxicam Drugs 0.000 description 1
- LZNWYQJJBLGYLT-UHFFFAOYSA-N tenoxicam Chemical compound OC=1C=2SC=CC=2S(=O)(=O)N(C)C=1C(=O)NC1=CC=CC=N1 LZNWYQJJBLGYLT-UHFFFAOYSA-N 0.000 description 1
- 229950010127 teplizumab Drugs 0.000 description 1
- 235000019364 tetracycline Nutrition 0.000 description 1
- 150000003522 tetracyclines Chemical class 0.000 description 1
- 229940040944 tetracyclines Drugs 0.000 description 1
- 229960003433 thalidomide Drugs 0.000 description 1
- 150000003568 thioethers Chemical class 0.000 description 1
- 125000003396 thiol group Chemical group [H]S* 0.000 description 1
- ZEMGGZBWXRYJHK-UHFFFAOYSA-N thiouracil Chemical compound O=C1C=CNC(=S)N1 ZEMGGZBWXRYJHK-UHFFFAOYSA-N 0.000 description 1
- 125000000341 threoninyl group Chemical group [H]OC([H])(C([H])([H])[H])C([H])(N([H])[H])C(*)=O 0.000 description 1
- 229960004072 thrombin Drugs 0.000 description 1
- 210000001541 thymus gland Anatomy 0.000 description 1
- 210000001685 thyroid gland Anatomy 0.000 description 1
- XUIIKFGFIJCVMT-UHFFFAOYSA-N thyroxine-binding globulin Natural products IC1=CC(CC([NH3+])C([O-])=O)=CC(I)=C1OC1=CC(I)=C(O)C(I)=C1 XUIIKFGFIJCVMT-UHFFFAOYSA-N 0.000 description 1
- 229960005053 tinidazole Drugs 0.000 description 1
- 229950002345 tiopinac Drugs 0.000 description 1
- 229950006150 tioxaprofen Drugs 0.000 description 1
- 229960003989 tocilizumab Drugs 0.000 description 1
- 229960001350 tofacitinib Drugs 0.000 description 1
- UJLAWZDWDVHWOW-YPMHNXCESA-N tofacitinib Chemical compound C[C@@H]1CCN(C(=O)CC#N)C[C@@H]1N(C)C1=NC=NC2=C1C=CN2 UJLAWZDWDVHWOW-YPMHNXCESA-N 0.000 description 1
- YEZNLOUZAIOMLT-UHFFFAOYSA-N tolfenamic acid Chemical class CC1=C(Cl)C=CC=C1NC1=CC=CC=C1C(O)=O YEZNLOUZAIOMLT-UHFFFAOYSA-N 0.000 description 1
- 229960001017 tolmetin Drugs 0.000 description 1
- UPSPUYADGBWSHF-UHFFFAOYSA-N tolmetin Chemical compound C1=CC(C)=CC=C1C(=O)C1=CC=C(CC(O)=O)N1C UPSPUYADGBWSHF-UHFFFAOYSA-N 0.000 description 1
- 125000005425 toluyl group Chemical group 0.000 description 1
- 206010044008 tonsillitis Diseases 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- 229940035306 topicort Drugs 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 108091006106 transcriptional activators Proteins 0.000 description 1
- 238000010361 transduction Methods 0.000 description 1
- 230000026683 transduction Effects 0.000 description 1
- 230000001131 transforming effect Effects 0.000 description 1
- 238000011269 treatment regimen Methods 0.000 description 1
- 229950007217 tremelimumab Drugs 0.000 description 1
- 229940111528 trexall Drugs 0.000 description 1
- GFNANZIMVAIWHM-OBYCQNJPSA-N triamcinolone Chemical compound O=C1C=C[C@]2(C)[C@@]3(F)[C@@H](O)C[C@](C)([C@@]([C@H](O)C4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 GFNANZIMVAIWHM-OBYCQNJPSA-N 0.000 description 1
- 229940126307 triamcinolone acetate Drugs 0.000 description 1
- YNDXUCZADRHECN-JNQJZLCISA-N triamcinolone acetonide Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@H]3OC(C)(C)O[C@@]3(C(=O)CO)[C@@]1(C)C[C@@H]2O YNDXUCZADRHECN-JNQJZLCISA-N 0.000 description 1
- 229960002117 triamcinolone acetonide Drugs 0.000 description 1
- 150000003852 triazoles Chemical class 0.000 description 1
- 229950000919 tribuzone Drugs 0.000 description 1
- OFVFGKQCUDMLLP-UHFFFAOYSA-N tribuzone Chemical compound O=C1C(CCC(=O)C(C)(C)C)C(=O)N(C=2C=CC=CC=2)N1C1=CC=CC=C1 OFVFGKQCUDMLLP-UHFFFAOYSA-N 0.000 description 1
- 208000003982 trichinellosis Diseases 0.000 description 1
- 201000007588 trichinosis Diseases 0.000 description 1
- 208000009920 trichuriasis Diseases 0.000 description 1
- ZMANZCXQSJIPKH-UHFFFAOYSA-O triethylammonium ion Chemical compound CC[NH+](CC)CC ZMANZCXQSJIPKH-UHFFFAOYSA-O 0.000 description 1
- ITMCEJHCFYSIIV-UHFFFAOYSA-N triflic acid Chemical compound OS(=O)(=O)C(F)(F)F ITMCEJHCFYSIIV-UHFFFAOYSA-N 0.000 description 1
- 229960003962 trifluridine Drugs 0.000 description 1
- VSQQQLOSPVPRAZ-RRKCRQDMSA-N trifluridine Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(C(F)(F)F)=C1 VSQQQLOSPVPRAZ-RRKCRQDMSA-N 0.000 description 1
- 229940078279 trilisate Drugs 0.000 description 1
- UXQDWARBDDDTKG-UHFFFAOYSA-N tromantadine Chemical compound C1C(C2)CC3CC2CC1(NC(=O)COCCN(C)C)C3 UXQDWARBDDDTKG-UHFFFAOYSA-N 0.000 description 1
- 229960000832 tromantadine Drugs 0.000 description 1
- 201000002311 trypanosomiasis Diseases 0.000 description 1
- 230000029069 type 2 immune response Effects 0.000 description 1
- 201000008297 typhoid fever Diseases 0.000 description 1
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 1
- 230000034512 ubiquitination Effects 0.000 description 1
- 238000010798 ubiquitination Methods 0.000 description 1
- 241000724775 unclassified viruses Species 0.000 description 1
- 125000002948 undecyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- 241001529453 unidentified herpesvirus Species 0.000 description 1
- 241000712461 unidentified influenza virus Species 0.000 description 1
- 230000003827 upregulation Effects 0.000 description 1
- DRTQHJPVMGBUCF-UHFFFAOYSA-N uracil arabinoside Natural products OC1C(O)C(CO)OC1N1C(=O)NC(=O)C=C1 DRTQHJPVMGBUCF-UHFFFAOYSA-N 0.000 description 1
- 229940045145 uridine Drugs 0.000 description 1
- VBEQCZHXXJYVRD-GACYYNSASA-N uroanthelone Chemical class C([C@@H](C(=O)N[C@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CS)C(=O)N[C@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O)C(C)C)[C@@H](C)O)NC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@H](CCSC)NC(=O)[C@H](CS)NC(=O)[C@@H](NC(=O)CNC(=O)CNC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CS)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)CNC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CS)NC(=O)CNC(=O)[C@H]1N(CCC1)C(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC(N)=O)C(C)C)[C@@H](C)CC)C1=CC=C(O)C=C1 VBEQCZHXXJYVRD-GACYYNSASA-N 0.000 description 1
- 229940093257 valacyclovir Drugs 0.000 description 1
- 229940070710 valerate Drugs 0.000 description 1
- NQPDZGIKBAWPEJ-UHFFFAOYSA-N valeric acid Chemical compound CCCCC(O)=O NQPDZGIKBAWPEJ-UHFFFAOYSA-N 0.000 description 1
- 229960002149 valganciclovir Drugs 0.000 description 1
- 230000002792 vascular Effects 0.000 description 1
- 229960004914 vedolizumab Drugs 0.000 description 1
- 235000003563 vegetarian diet Nutrition 0.000 description 1
- 229960003636 vidarabine Drugs 0.000 description 1
- 235000005282 vitamin D3 Nutrition 0.000 description 1
- 239000011647 vitamin D3 Substances 0.000 description 1
- 235000019165 vitamin E Nutrition 0.000 description 1
- 239000011709 vitamin E Substances 0.000 description 1
- 229940046009 vitamin E Drugs 0.000 description 1
- 229940021056 vitamin d3 Drugs 0.000 description 1
- BICRTLVBTLFLRD-PTWUADNWSA-N voclosporin Chemical compound CC[C@@H]1NC(=O)[C@H]([C@H](O)[C@H](C)C\C=C\C=C)N(C)C(=O)[C@H](C(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)N(C)C(=O)[C@H](C(C)C)NC(=O)[C@H](CC(C)C)N(C)C(=O)CN(C)C1=O BICRTLVBTLFLRD-PTWUADNWSA-N 0.000 description 1
- 229960005289 voclosporin Drugs 0.000 description 1
- 108010057559 voclosporin Proteins 0.000 description 1
- 229920003169 water-soluble polymer Polymers 0.000 description 1
- 229940075420 xanthine Drugs 0.000 description 1
- 210000005253 yeast cell Anatomy 0.000 description 1
- 229940055760 yervoy Drugs 0.000 description 1
- 229960001028 zanamivir Drugs 0.000 description 1
- 229950007802 zidometacin Drugs 0.000 description 1
- 229960002555 zidovudine Drugs 0.000 description 1
- HBOMLICNUCNMMY-XLPZGREQSA-N zidovudine Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CO)[C@@H](N=[N+]=[N-])C1 HBOMLICNUCNMMY-XLPZGREQSA-N 0.000 description 1
- 229940072168 zocor Drugs 0.000 description 1
- 229960003414 zomepirac Drugs 0.000 description 1
- ZXVNMYWKKDOREA-UHFFFAOYSA-N zomepirac Chemical compound C1=C(CC(O)=O)N(C)C(C(=O)C=2C=CC(Cl)=CC=2)=C1C ZXVNMYWKKDOREA-UHFFFAOYSA-N 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/461—Cellular immunotherapy characterised by the cell type used
- A61K39/4611—T-cells, e.g. tumor infiltrating lymphocytes [TIL], lymphokine-activated killer cells [LAK] or regulatory T cells [Treg]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/462—Cellular immunotherapy characterized by the effect or the function of the cells
- A61K39/4621—Cellular immunotherapy characterized by the effect or the function of the cells immunosuppressive or immunotolerising
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/464—Cellular immunotherapy characterised by the antigen targeted or presented
- A61K39/4643—Vertebrate antigens
- A61K39/46433—Antigens related to auto-immune diseases; Preparations to induce self-tolerance
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/464—Cellular immunotherapy characterised by the antigen targeted or presented
- A61K39/4643—Vertebrate antigens
- A61K39/4644—Cancer antigens
- A61K39/464454—Enzymes
- A61K39/464463—Phosphatases
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0634—Cells from the blood or the immune system
- C12N5/0636—T lymphocytes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
- A61K2239/31—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterized by the route of administration
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
- A61K2239/38—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterised by the dose, timing or administration schedule
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/70—Fusion polypeptide containing domain for protein-protein interaction
- C07K2319/74—Fusion polypeptide containing domain for protein-protein interaction containing a fusion for binding to a cell surface receptor
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Definitions
- the present invention relates to C1ORF32 protein, and its variants, fragments and fusion proteins thereof, pharmaceutical compositions comprising same and methods of use therof for treatment of immune related disorders and infections.
- the balance between proinflammatory mechanisms and the dampening of excessive immune activation is important for treatment of infectious disease and also for treatment of autoimmune disease.
- the former benefits from an activated immune system while the latter requires reduce immune system activity.
- the immune system has the reciprocal tasks to protect the host against invading pathogens, but simultaneously to prevent damage resulting from unwanted reactions to self antigens.
- T cells have the ability to react to a variety of antigens, both self and nonself. Therefore, there are many mechanisms that exist naturally to eliminate potentially self-reactive responses—this is known as natural tolerance.
- the main mechanism for eliminating potential auto-reactive T cells occurs in the thymus and is known as central tolerance. Some potentially autoreactive T cells escape central tolerance and, therefore, peripheral tolerance mechanisms also exist. Despite these mechanisms, some self-reactive T cells may ‘escape’ and be present in the repertoire; it is believed that their activation may lead to autoimmune disease.
- CTLA-4 is the most extensively studied costimulatory molecule which down-regulates immune responses.
- the attributes of immunosuppressive qualities and capacity to induce tolerance have made its recognition as a potential immuno-therapeutic agent for autoimmune mediated inflammatory disorders.
- Abatacept (commercial name: Orencia) is a fusion protein composed of the ECD (extracellular domain) of CTLA-4 fused to the Fc fragment of hIgG1.
- Abatacept is believed to induce costimulation blockade, which has been approved for treating patients with rheumatoid arthritis, by effectively interfering with the inflammatory cascade.
- T helper type 1 (Th1) cells are induced by IL-12 and produce IFN- ⁇ , while T helper type 2 (Th2) cells secrete IL-4, IL-5 and IL-13.
- Th1 cells can mediate proinflammatory or cell-mediated immune responses, whereas Th2 cells mainly promote certain types of humoral immunity.
- Some immune related diseases, such as autoimmune reactions, inflammation, and infection, are characterized by a dysregulation of the pro-versus anti-inflammatory tendencies of the immune system, as well as an imbalance in the Th1 versus Th2 cytokine balance.
- Th1-mediated autoimmune diseases such as multiple sclerosis and rheumatoid arthritis.
- Laquinimod which has demonstrated efficacy in animal models of several autoimmune diseases including MS, shows immunomodulatory effects through Th1/Th2 shift, and does not lead to immunosuppression.
- Glatiramer acetate also induces Th1/Th2 shift with decreased secretion of proinflammatory cytokines, and increased secretion of antiinflammatory cytokines. Furtheremore, GA-specific Th2 cells are able to migrate across the blood-brain barrier and cause in situ bystander suppression of autoaggressive Th1 T cells.
- exhausted T cells functionally impaired T cells which are present during chronic infection and are characterized by reduced proliferative and cytotoxic abilities, express high levels of multiple co-inhibitory receptors such as CTLA-4, PD-1, and LAG3 (Crawford et al., Curr Opin Immunol. 2009; 21:179-186; Kaufmann et al., J Immunol 2009; 182:5891-5897, Sharpe et al., Nat Immunol 2007; 8:239-245).
- the exhausted phenotype can be reversed by blocking co-inhibitory pathways (Rivas et al., J Immunol. 2009 ; 183:4284-91; Golden-Mason et al., J Virol. 2009; 83:9122-30), thus allowing restoration of anti viral immune function, supporting therapeutic application of co-inhibitory blockade in viral infection.
- Blockade of the PD-1/PD-L1 pathway is able to restore functional capabilities to exhausted CTLs (Hofmeyer et al, J. Biomed. & Biotech. Vol. 2011, Art. ID 451694).
- Combining therapeutic vaccination along with the blockade of inhibitory signals could synergistically enhance functional CD8(+) T-cell responses and improve viral control in chronically infected individuals, providing a promising strategy for the treatment of chronic viral infections.
- Antibodies to PD-1 and CTLA-4 are currently in clinical trials in chronic hepatitis C, as promising candidates for combination with both prophylactic and therapeutic vaccines (Diepolder and Obst, Expert Rev Vaccines. 2010 Mar.; 9(3):243-7).
- Regulating costimulation using agonists and antagonists to various costimulatory proteins has been extensively studied as a strategy for treating autoimmune diseases, graft rejection, allergy and cancer. This field has been clinically pioneered by CTLA4-Ig (Abatacept, Orencia®) that is approved for treatment of RA, and by the anti-CTLA4 antibody (Ipilimumab, Yervoy®), recently approved for the treatment of melanoma.
- CTLA4-Ig Abatacept, Orencia®
- Ipilimumab, Yervoy® anti-CTLA4 antibody
- Other costimulation regulators are currently in advanced stages of clinical development including anti PD-1 antibody (MDX-1106) which is in development for treatment of advanced/metastatic clear-cell renal cell carcinoma (RCC) and anti-CD40L Antibody (BG9588, Antova®) for treatment of renal allograft transplantation.
- agents are in clinical development for viral infections, for example the anti PD-1 Ab, MDX-1106, is being tested for treatment of hepatitis C.
- Another example is CP-675,206 (tremelimumab) and anti-CTLA4 Ab which is in a clinical trial in hepatitis C virus-infected patients with hepatocellular carcinoma.
- B cells play a critical role in recognition of foreign antigens and subsequent production of antibodies in the specific humoral adaptive immune responses that provide protection against various types of infectious agents.
- B cells play a critical role in recognition of foreign antigens and they produce the antibodies necessary to provide protection against various type of infectious agents.
- T cell help to B cells is a pivotal process of adaptive immune responses.
- Follicular helper T (Tfh) cells are a subset of CD4+ T cells specialized in B cell help (reviewed by Crotty, Annu. Rev. Immunol. 29: 621-663, 2011).
- Tfh cells express the B cell homing chemokine receptor, CXCRS, which drives Tfh cell migration into B cell follicles within lymph nodes in a CXCL13-dependent manner.
- CXCRS B cell homing chemokine receptor
- Tfh cells selectively express a wealth of surface proteins, which are involved in their selective localization (such as CXCRS) and in direct physical interactions with B cells to provide B cell help.
- CXCRS selective localization
- B cells to provide B cell help.
- costimulatory proteins family which are highly expressed in Tfh cells, including the inducible co-stimulatory receptor ICOS, and the negative costimulators (inhibitory receptors) PD-1 and BTLA (Crotty, Annu. Rev. Immunol. 29: 621-663, 2011).
- the background art fails to provide therapies that target multiple cells and pathways involved in autoimmunity and inflammation, such as Th1, Th17, Th22, Th2, Tregs, or other cells that secrete, or influence other cells that secrete, inflammatory molecules such as cytokines, metalloproteases, chemokines and other molecules.
- therapies that are targeted with regard to providing a balance between excessive immune activation and desirable pro-inflammatory immune activation, for the treatment of autoimmune diseases and infectious disease.
- the present invention is of C1ORF32 protein, and its variants, fragments and fusion proteins thereof, pharmaceutical compositions comprising same and methods of use therof for treatment of immune related disorders and infections.
- diseases may optionally relate to any disease in which it is desirable to induce immune tolerance.
- diseases may optionally relate to any disease in which T cell exhaustion to a foreign pathogenic antigen plays a role.
- C1ORF32 polypeptides as an isolated polypeptide, comprising an amino acid sequence of C1ORF32 IgV domain fragment, set forth in any one of SEQ ID NOs: 29, 30, 41-105, with the proviso that the amino acid sequence does not include the complete, exact sequence of SEQ ID NO: 35.
- the isolated polypeptide has less than 90% identity with SEQ ID NO:35, optionally has less than 85% identity with SEQ ID NO:35 and optionally has less than 80% identity with SEQ ID NO:35.
- the isolated polypeptide consists essentially of the amino acid sequence as set forth in any one of SEQ ID NOs: 29, 30, 41-105, or optionally up to 95% identical thereof. It is further contemplated that optionally the C1ORF32 IgV domain fragment may be extended beyond the border delimited by the end of SEQ ID NO:35, as long as one or more of the above conditions regarding sequence identity are met. A further description of such fragments is provided with regard to Table 1 below.
- SEQ ID NO:29 is shorter than SEQ ID NO:35 but as noted above, for some inventive sequences, the inventive amino acid sequence is longer than SEQ ID NO:35, but still fulfills one or more of the above conditions regarding sequence identity.
- the isolated polypeptide has less than 90% identity with SEQ ID NO:36, optionally has less than 85% identity with SEQ ID NO:36 and optionally has less than 80% identity with SEQ ID NO:36. It is further contemplated that optionally the C1ORF32 IgV domain fragment may be extended beyond the border delimited by the end of SEQ ID NO:36, as long as one or more of the above conditions regarding sequence identity are met.
- an isolated polypeptide comprising a soluble C1ORF32 polypeptide or fragment or variant thereof, having an amino acid substitution preventing a cleavage of the C1ORF32 ECD (SEQ ID NO:14) between amino acids F and A at positions 179 and 180 of any of H19011_1_P8_V1 or H19011_1_P8 (Seq ID NOs: 4 or 5).
- the amino acid substitution in the cleavage site of C1ORF32 ECD (SEQ ID NO:14) at positions 179 and 180 of any of H19011_1_P8_V1 or H19011_1_P8 (Seq ID NOs: 4 or 5) is selected from FA ⁇ GA; FA ⁇ AA; and FA ⁇ GG.
- the polypeptide has an amino acid sequence as set forth in any one of SEQ ID NOs:45, 64, and 96.
- C1ORF32 polypeptides optionally provided as fusion proteins containing a C1ORF32 polypeptide.
- C1ORF32 fusion polypeptides optionally have a first fusion partner comprising part of a C1ORF32 soluble polypeptide, or a sequence homologous thereto, and a second fusion partner composed of a heterologous sequence (respectively non-C1ORF32), fused together directly or indirectly via a peptide linker sequence or a chemical linker.
- the fusion protein comprises the polypeptide as described herein, fused to a heterologous sequence, directly or indirectly via a linker peptide, a polypeptide sequence or a chemical linker.
- the heterologous sequence comprises at least a portion of an immunoglobulin constant domain.
- the constant domain comprises an immunoglobulin heavy chain constant region corresponding to an antibody isotype selected from the group consisting of an IgG1, IgG2, IgG3, IgG4, IgM, IgE, IgA and IgD.
- the immunoglobulin constant domain comprises the hinge, CH2 and CH3 regions of a human IgG immunoglobulin, selected from the group consisting of C ⁇ 1, C ⁇ 2, C ⁇ 3 and C ⁇ 4 chain.
- the fusion protein further comprises a domain that mediates dimerization or multimerization of the fusion protein to form homodimers, heterodimers, homomultimers, or heteromultimers.
- the domain that mediates dimerization or multimerization is selected from the group consisting of one or more cysteines that are capable of forming an intermolecular disulfide bond with a cysteine on the partner fusion protein, a coiled-coil domain, an acid patch, a zinc finger domain, a calcium hand domain,a CHI region, a CL region, a leucine zipper domain, an SH2 (src homology 2) domain, an SH3 (src Homology 3) domain, a PTB (phosphotyrosine binding) domain, a WW domain, a PDZ domain, a 14-3-3 domain, a WD40 domain, an EH domain, a Lim domain, an isoleucine zipper domain, and a dimerization domain of a receptor dimer pair.
- a dimeric protein comprising a first and a second fusion protein, wherein the first and the second fusion proteins comprise the fusion protein as described herein and wherein the first and the second fusion proteins are bound to one another by covalent or noncovalent bonds to form a dimer.
- the isolated polypeptide is at least 80, 90, 95, 96, 97, 98 or 99% homologous to a polypeptide set forth in any one of SEQ ID NOs: 29, 30, 41-105.
- the C1ORF32 polypeptide may be of any species of origin. In further embodiments, the C1ORF32 polypeptide is of murine, non-human primate or human origin.
- the C1ORF32 protein which may optionally comprise a fusion protein, inhibits the inflammatory activity of Th1, Th17, Th22, or other cells that secrete, or cause other cells to secrete, inflammatory molecules, including, but not limited to, IL-1beta, TNF-alpha, TGF-beta, IFN-gamma, IL-17, IL-6, IL-23, IL-22, IL-21, and MMPs.
- the C1ORF32 protein can also increase the suppressive capacity of Tregs or the immunomodulatory activity of Th2 cells.
- the C1ORF32 fusion protein can also increase the production of anti-inflammatory molecules such as the cytokine IL-10.
- the fragment is of at least about 20 amino acids of the extracellular domain of C1ORF32, but no more than 169 amino acids of the extracellular domain, in order to fulfill the conditions regarding sequence identity as described with regard to SEQ ID NO:35 as described above.
- the fragment is of at least about 21, 22, 23, 24, 25 and so forth amino acids of the extracellular domain of C1ORF32, but no more than 100, 101, 102 and so forth, up to 168 amino acids of the extracellular domain, as described above, optionally including any integral value between 20 and 169 amino acids in length, although as noted above, the inventive sequence may optionally have more amino acids than the ECD of SEQ ID NO:35.
- the polypeptide is attached to a detectable or therapeutic moiety.
- a method for prevention of damage to the myelin coat of neural cells in the central nervous system in MS (multiple sclerosis) patients comprising administering to a subject in need thereof a pharmaceutical composition comprising: a soluble molecule having the C1ORF32 polypeptide, selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof; optionally provided as a pharmaceutical composition.
- the fragment is as described above.
- MS Multiple sclerosis
- CNS central nervous system
- MBP myelin basic protein
- PGP proteolipid protein
- MOG myelin oligodendrocyte glycoprotein
- EAE Experimental autoimmune encephalomyelitis
- an isolated soluble C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, fragment, variant, or homolog thereof; optionally as a fusion protein or conjugate, wherein said polypeptide or said fusion protein or conjugate is used for anti-immune related condition immunotherapy for an immune related disorder and/or infection as described herein, optionally provided as a pharmaceutical composition.
- Optionally treating comprises one or more of preventing, curing, managing, reversing, attenuating, alleviating, minimizing, suppressing, managing, or halting the deleterious effects of the above-described diseases.
- managing comprises reducing the severity of the disease, reducing the frequency of episodes of the disease, reducing the duration of such episodes, or reducing the severity of such episodes or a combination thereof.
- the C1ORF32 polypeptides, fragments or variants or homologs thereof, fusion proteins or conjugates comprising same, or pharmaceutical composition comprising same can be used to treat patients who do not respond to TNF blockers.
- the present invention provides a method for combining therapeutic vaccination with an antigen along with administration of the foregoing pharmaceutical composition for treatment of infection.
- the antigen is a viral antigen, a bacterial antigen, fungal antigen and/or other parasite antigen.
- the present invention further provides a method for combining the foregoing pharmaceutical composition, used as adjuvant, along with an antigen in a vaccine, in order to increase the immune response.
- the antigen is a viral antigen, a bacterial antigen, fungal antigen, parasite antigen, and/or other pathogen's antigen.
- FIG. 1 shows a schematic drawing of a full length soluble C1ORF32 protein.
- Signal Peptide is shown in italic face font; two potential start points of IgV are shown in underlined italic and bold shape; IgV domain is in bold face font; amino acid region deleted in H19011_1_P9 (SEQ ID NO:6) as compared to the H19011_1_P8 (SEQ ID NO:4) is shown in dashed underline; the locations of the three SNPs (DSVE ⁇ GSLG) is shown in double underlined italic and bold shape; the location of point mutations ( F A ⁇ G A, F A ⁇ A, FA -> GG ) is shown in bold and dashed underline.
- Transmembrane domain (TM) of H19011_1_P8 (SEQ ID NO:4) is shown in light font with dotted underline; in H19011_1_P9 (SEQ ID NO:6) the TM starts at amino acid residues “FVG . . . ”, 2 amino acids downstream to the start point of the H19011_1_P8 (SEQ ID NO:4) transmembrane domain.
- Vertical bars represent five possible C-terminal end points of the soluble C1ORF32 proteins from position 1 on the left (end of IgV) to position 5 on the right (end of predicted ECD).
- FIG. 2 shows SDS-PAGE results for produced proteins.
- FIG. 3 shows inhibitory effect of Fc-fused C1ORF32 ECD (SEQ ID NO:108), Fc-fused C1ORF32 ECD-Delta DLLPSFAVEIM (SEQ ID NO:110), and C1ORF32 ECD-Delta RTGLLADLLPSFAVEIM (SEQ ID NO:112) on mouse CD4+ T cell IFN ⁇ secretion.
- Purified CD4+CD25 ⁇ T cells 1 ⁇ 10 5 per well, were stimulated with anti-CD3 mAb (2 ug/mL) in the presence of test proteins or control mouse IgG2a at 0, 3 and 10 ⁇ g/ml. Culture supernatants were collected 48 hrs post stimulation and analyzed using mouse IFNy ELISA kit. Results are shown as Mean ⁇ SD of four wells per point (Student's t-test , ***P ⁇ 0.001, compared with control mouse IgG2a).
- FIG. 4 shows inhibitory effect of Fc-fused C1ORF32 ECD (SEQ ID NO:108), Fc-fused C1ORF32 ECD-Delta DLLPSFAVEIM (SEQ ID NO:110), and C1ORF32 ECD-Delta RTGLLADLLPSFAVEIM (SEQ ID NO:112) on expression of the early TCR activation marker, CD69.
- 1 ⁇ 10 5 CD4+CD25 ⁇ T cells were stimulated with plate bound anti-CD3 (2 ⁇ g/ml) together with test proteins or control mIgG2a (10 ⁇ g/ml). Cells were analyzed at 48 hrs for the expression CD69 by flow cytometry (**; P value ⁇ 0.001 compare to control mIgG2A, student's T test).
- FIG. 5 shows inhibitory effect of Fc-fused C1ORF32 ECD (SEQ ID NO:108), (two different batches produced in CHO-S And in CHO-DG44), Fc-fused C1ORF32 ECD-Delta DLLPSFAVEIM (SEQ ID NO:110), and C1ORF32 ECD-Delta RTGLLADLLPSFAVEIM (SEQ ID NO:112) (two different batches produced in CHO-S And in CHO-DG44) on naive T cell proliferation. No inhibition was observed with the IgG2a isotype control.
- the present invention in at least some embodiments, relates to any one of the C1ORF32 proteins, selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, fragments, variants and homologs thereof and fusion proteins and conjugates containing same, and pharmaceutical compositions comprising same, and nucleic acid sequences encoding same, and the use thereof as a therapeutic agent for treatment of immune related disorder and/or infection, and/or optionally the corresponding DNAs or vectors or cells expressing same for use in immunotherapy.
- isolated refers to a compound of interest (for example a polynucleotide or a polypeptide) that is in an environment different from that in which the compound naturally occurs e.g. separated from its natural milieu such as by concentrating a peptide to a concentration at which it is not found in nature. “Isolated” includes compounds that are within samples that are substantially enriched for the compound of interest and/or in which the compound of interest is partially or substantially purified.
- an “immune cell” refers to any cell from the hemopoietic origin including but not limited to T cells, B cells, monocytes, dendritic cells, and macrophages.
- polypeptide refers to a chain of amino acids of any length, regardless of modification (e.g., phosphorylation or glycosylation).
- immune related disease or disorder or condition
- inflammatory disorders and/or “inflammation”, used interchangeably, includes inflammatory abnormalities characterized by disregulated immune response to harmful stimuli, such as pathogens, damaged cells, or irritants. Inflammatory disorders underlie a vast variety of human diseases. Non-immune diseases with etiological origins in inflammatory processes include atherosclerosis, and ischaemic heart disease.
- disorders associated with inflammation include: Chronic prostatitis, Glomerulonephritis, Hypersensitivities, Pelvic inflammatory disease, Reperfusion injury, Sarcoidosis, Vasculitis, Interstitial cystitis, normocomplementemic urticarial vasculitis, pericarditis, myositis, anti-synthetase syndrome, scleritis, macrophage activation syndrome, Bechet's Syndrome, PAPA Syndrome, Blau's Syndrome, gout, adult and juvenile Still's disease, cryropyrinopathy, Muckle-Wells syndrome, familial cold-induced auto-inflammatory syndrome, neonatal onset multisystemic inflammatory disease, familial Mediterranean fever, chronic infantile neurologic, cutaneous and articular syndrome, systemic juvenile idiopathic arthritis, Hyper IgD syndrome, Schnitzler' s syndrome, TNF receptor-associated periodic syndrome (TRAPSP), gingivitis, periodontitis, hepatitis, cirrhosis, pancre
- autoimmune disease should be understood to encompass any disease in which recognition of a “self” antigen (self-reactivity) is at least a part of the disease process.
- the autoimmune diseases should be understood to encompass any disease disorder or condition including one or more of, but not limited to, multiple sclerosis, rheumatoid arthritis; psoriatic arthritis, discoid lupus erythematosus, systemic lupus erythematosus (SLE); ulcerative colitis; Crohn's disease; benign lymphocytic angiitis, autoimmune lymphoproliferative syndrome, sarcoidosis, autoimmune thrombocytopenic purpura, idiopathic thrombocytopenic purpura, pure red cell aplasia, Sjogren's syndrome, rheumatic disease, polymyalgia rheumatica, mixed connective tissue disease, inflammatory rheumatism, degenerative
- multiple sclerosis comprises multiple sclerosis or a related disease, and optionally refers to all types and stages of multiple sclerosis, including, but not limited to: benign multiple sclerosis, relapsing remitting multiple sclerosis, secondary progressive multiple sclerosis, primary progressive multiple sclerosis, progressive relapsing multiple sclerosis, chronic progressive multiple sclerosis, transitional/progressive multiple sclerosis, rapidly worsening multiple sclerosis, clinically-definite multiple sclerosis, malignant multiple sclerosis, also known as Marburg's Variant, and acute multiple sclerosis.
- condition relating to multiple sclerosis include, e.g., Devic's disease, also known as Neuromyelitis Optica; acute disseminated encephalomyelitis, acute demyelinating optic neuritis, demyelinative transverse myelitis, Miller-Fisher syndrome, encephalomyelradiculoneuropathy, acute demyelinative polyneuropathy, tumefactive multiple sclerosis and Balo's concentric sclerosis.
- rheumatoid arthritis comprises rheumatoid arthritis or a related disease and refers to all types and stages of rheumatoid arthritis, including, but not limited to: rheumatoid arthritis, gout and pseudo-gout, juvenile idiopathic arthritis, juvenile rheumatoid arthritis, Still's disease, ankylosing spondylitis, rheumatoid vasculitis.
- conditions relating to rheumatoid arthritis include, e.g., osteoarthritis, sarcoidosis, Henoch-Schönlein purpura, Psoriatic arthritis, Reactive arthritis, Spondyloarthropathy, septic arthritis, Haemochromatosis, Hepatitis, vasculitis, Wegener's granulomatosis, Lyme disease, Familial Mediterranean fever, Hyperimmunoglobulinemia D with recurrent fever, TNF receptor associated periodic syndrome, and Enteropathic arthritis associated with inflammatory bowel disease.
- Uveitis refers to all types and stages of Uveitis, including, but not limited to: anterior uveitis (or iridocyclitis), intermediate uveitis (pars planitis), posterior uveitis (or chorioretinitis) and the panuveitic form.
- inflammatory bowel disease also refers to a related disease and refers to all types and stages of inflammatory bowel disease (IBD), including, but not limited to: Crohn's disease and ulcerative colitis (UC).
- IBD inflammatory bowel disease
- conditions relating to IBD include, e.g., Collagenous colitis, Lymphocytic colitis, Ischaemic colitis, Diversion colitis, Behget's disease, Indeterminate colitis.
- psoriasis also refers to a related disease and refers to all types and stages of psoriasis, including, but not limited to: Nonpustular Psoriasis including Psoriasis vulgaris and Psoriatic erythroderma (erythrodermic psoriasis), Pustular psoriasis including Generalized pustular psoriasis (pustular psoriasis of von Zumbusch), Pustulosis palmaris et plantaris (persistent palmoplantar pustulosis, pustular psoriasis of the Barber type, pustular psoriasis of the extremities), Annular pustular psoriasis, Acrodermatitis continua, Impetigo herpetiformis.
- conditions relating to psoriasis include, e.g., drug-induced psoriasis, Inverse psoriasis, Napkin psoriasis, Seborrheic-like psoriasis, Guttate psoriasis, Nail psoriasis, Psoriatic arthritis.
- type 1 diabetes refers to all types and stages of type 1 diabetes, including, but not limited to: insulin-dependent diabetes mellitus, idiopathic diabetes, juvenile type ldiabetes, maturity onset diabetes of the young, latent autoimmune diabetes in adults, gestational diabetes.
- Conditions relating to type 1 diabetes include, neuropathy including polyneuropathy, mononeuropathy, peripheral neuropathy and autonomicneuropathy; eye complications: glaucoma, cataracts, retinopathy.
- Sjogren's syndrome refers to all types and stages of Sjogren's syndrome, including, but not limited to: Primary Sjogren's syndrome and Secondary Sjogren's syndrome.
- Conditions relating to Sjogren's syndrome include connective tissue disease, such as rheumatoid arthritis, systemic lupus erythematosus, or scleroderma.
- pneumonia polmunary fibrosis
- interstitial nephritis inflammation of the tissue around the kidney's filters
- glomerulonephritis inflammation of the tissue around the kidney's filters
- renal tubular acidosis carpal tunnel syndrome
- peripheral neuropathy cranial neuropathy
- primary biliary cirrhosis PBC
- cirrhosis Inflammation in the esophagus, stomach, pancreas, and liver (including hepatitis)
- Polymyositis Raynaud's phenomenon
- Vasculitis Autoimmune thyroid problems
- lymphoma including hepatitis
- systemic lupus erythematosus refers to all types and stages of systemic lupus erythematosus, including, but not limited to discoid lupus, lupus arthritis, lupus pneumonitis, lupus nephritis.
- Conditions relating to systemic lupus erythematosus include osteoarticular tuberculosis, antiphospholipid antibody syndrome, inflammation of various parts of the heart, such as pericarditis, myocarditis, and endocarditis, Lung and pleura inflammation, pleuritis, pleural effusion, chronic diffuse interstitial lung disease, pulmonary hypertension, pulmonary emboli, pulmonary hemorrhage, and shrinking lung syndrome, lupus headache, Guillain-Barré syndrome, aseptic meningitis, demyelinating syndrome, mononeuropathy, mononeuritis multiplex, myasthenia gravis, myelopathy, cranial neuropathy, polyneuropathy, vasculitis.
- infectious disorder and/or disease includes any disorder, disease and/or condition caused by presence and/or growth of pathogenic biological agent in an individual host organism.
- infectious comprises the disorder, disease and/or condition as above, exhibiting clinically evident illness (i.e., characteristic medical signs and/or symptoms of disease) and/or which is asymtomatic for much or all of it course.
- infection also comprises disorder, disease and/or condition caused by persistence of foreign antigen that lead to exhaustion T cell phenotype characterized by impaired functionality which is manifested as reduced proliferation and cytokine production.
- infectious disorder and/or disease and/or “infection”, further includes any of the below listed infectious disorders, diseases and/or conditions, caused by a bacterial infection, viral infection, fungal infection and /or parasite infection.
- Retroviridae e.g., human immunodeficiency viruses, such as HIV-1 or HIV-2, acquired immune deficiency (AIDS) also referred to as HTLV-III, LAV or HTLV-III/LAV, or HIV-III; and other isolates, such as HIV-LP; Picornaviridae (e.g., polio viruses, hepatitis A virus; enteroviruses, human coxsackie viruses, rhinoviruses, echoviruses);
- Retroviridae e.g., human immunodeficiency viruses, such as HIV-1 or HIV-2, acquired immune deficiency (AIDS) also referred to as HTLV-III, LAV or HTLV-III/LAV, or HIV-III
- AIDS acquired immune deficiency
- HIV-LP e.g., HIV-LP
- Picornaviridae e.g., polio viruses, hepatitis A virus; enteroviruses, human coxsackie viruses,
- Calciviridae e.g., strains that cause gastroenteritis
- Togaviridae e.g., equine encephalitis viruses, rubella viruses
- Flaviridae e.g., dengue viruses, encephalitis viruses, yellow fever viruses
- Coronaviridae e.g., coronaviruses
- Rhabdoviridae e.g., vesicular stomatitis viruses, rabies viruses
- Filoviridae e.g., ebola viruses
- Paramyxoviridae e.g., parainfluenza viruses, mumps virus, measles virus, respiratory syncytial virus
- Orthomyxoviridae e.g., influenza viruses
- Bungaviridae e.g., Hantaan viruses, bunga viruses, phleboviruses and Nairo viruses
- Arena viridae hemorrhagic fever virus
- fungal infection comprises any infection caused by a fungi, optionally including but not limited to Cryptococcus neoformans, Histoplasma capsulatum, Coccidioides immitis, Blastomyces dermatitidis, Chlamydia trachomatis, Candida albicans.
- parasite infection comprises any infection caused by a parasite, optionally including but not limited to protozoa, such as Amebae, Flagellates, Plasmodium falciparum, Toxoplasma gondii, Ciliates, Coccidia, Microsporidia, Sporozoa; helminthes, Nematodes (Roundworms), Cestodes (Tapeworms), Trematodes (Flukes), Arthropods, and aberrant proteins known as prions.
- protozoa such as Amebae, Flagellates, Plasmodium falciparum, Toxoplasma gondii, Ciliates, Coccidia, Microsporidia, Sporozoa
- helminthes Nematodes (Roundworms), Cestodes (Tapeworms), Trematodes (Flukes), Arthropods, and aberrant proteins known as prions.
- An infectious disorder and/or disease caused by bacteria may optionally comprise one or more of Sepsis, septic shock, sinusitis, skin infections, pneumonia, bronchitis, meningitis, Bacterial vaginosis, Urinary tract infection (UCI), Bacterial gastroenteritis, Impetigo and erysipelas, Erysipelas, Cellulitis, anthrax, whooping cough, lyme disease, Brucellosis, enteritis, acute enteritis, Tetanus, diphtheria, Pseudomembranous colitis, Gas gangrene, Acute food poisoning, Anaerobic cellulitis, Nosocomial infections, Diarrhea, Meningitis in infants, Traveller's diarrhea, Hemorrhagic colitis, Hemolytic-uremic syndrome, Tularemia, Peptic ulcer, Gastric and Duodenal ulcers, Legionnaire's Disease, Pontiac fever, Leptospirosis, Liste
- tuberculosis M. avium, M. Intracellulare, M. kansaii, M gordonae ), Staphylococcus aureus, Neisseria gonorrhoeae, Neisseria meningitidis, Listeria monocytogenes, Streptococcus pyogenes (Group A Streptococcus ), Streptococcus agalactiae (Group B Streptococcus ), Streptococcus (viridans group), Streptococcus faecalis, Streptococcus bovis, Streptococcus ( anaerobic sps.), Streptococcus pneumoniae, pathogenic Campylobacter sp., Enterococcus sp Haemophilus influenzae, Bacillus antracis, corynebacterium diphtheriae, corynebacterium sp., Erysipelothr
- Non limiting examples of infectious disorder and/or disease caused by virus is selected from the group consisting of but not limited to acquired immune deficiency (AIDS), West Nile encephalitis, coronavirus infection, rhinovirus infection, influenza, dengue, hemorrhagic fever; an otological infection; severe acute respiratory syndrome (SARS), acute febrile pharyngitis, pharyngoconjunctival fever, epidemic keratoconjunctivitis, infantile gastroenteritis, infectious mononucleosis, Burkitt lymphoma, acute hepatitis, chronic hepatitis, hepatic cirrhosis, hepatocellular carcinoma, primary HSV-1 infection, (gingivostomatitis in children, tonsillitis & pharyngitis in adults, keratoconjunctivitis), latent HSV-1 infection (herpes labialis, cold sores), aseptic meningitis, Cytomegalovirus infection, Cytomegalic inclusion
- An infectious disorder and/or disease caused by fungi optionally includes but is not limited to Allergic bronchopulmonary aspergillosis, Aspergilloma, Aspergillosis, Basidiobolomycosis, Blastomycosis, Candidiasis, Chronic pulmonary aspergillosis, Chytridiomycosis, Coccidioidomycosis, Conidiobolomycosis, Covered smut (barley), Cryptococcosis, Dermatophyte, Dermatophytid, Dermatophytosis, Endothrix, Entomopathogenic fungus, Epizootic lymphangitis, Epizootic ulcerative syndrome, Esophageal candidiasis, Exothrix, Fungemia, Histoplasmosis, Lobomycosis, Massospora cicadina, Mycosis, Mycosphaerella fragariae, Myringomycosis, Paracoccidioidomycos
- infectious disease is a disease caused by any of hepatitis B, hepatitis C, infectious mononucleosis, EBV, cytomegalovirus, AIDS, HIV-1, HIV-2, tuberculosis, malaria and schistosomiasis.
- the term “vaccine” refers to a biological preparation that improves immunity to a particular disease, wherein the vaccine includes an antigen, such as weakened or killed forms of pathogen, its toxins or one of its surface proteins, against which immune responses are elicited.
- a vaccine typically includes an adjuvant as immune potentiator to stimulate the immune system.
- therapeutic vaccine and/or “therapeutic vaccination” refers to a vaccine used to treat ongoing disease, such as infectious disease.
- adjuvant refers to an agent used to stimulate the immune system and increase the response to a vaccine, without having any specific antigenic effect in itself.
- costimulatory polypeptide or “costimulatory molecule” is a polypeptide that, upon interaction with a cell-surface molecule on T cells, modulates T cell responses.
- a “costimulatory signaling” is the signaling activity resulting from the interaction between costimulatory polypeptides on antigen presenting cells and their receptors on T cells during antigen-specific T cell responses.
- the antigen-specific T cell response is believed to be mediated by two signals: 1) engagement of the T cell Receptor (TCR) with antigenic peptide presented in the context of MHC (signal 1), and 2) a second antigen-independent signal delivered by contact between different costimulatory receptor/ligand pairs (signal 2).
- this “second signal” is critical in determining the type of T cell response (activation vs inhibition) as well as the strength and duration of that response, and is regulated by both positive and negative signals from costimulatory molecules, such as the B7 family of proteins.
- B7 polypeptide means a member of the B7 family of proteins that costimulate T cells including, but not limited to B7-1, B7-2, B7-DC, B7-H5, B7-H1, B7-H2, B7-H3, B7-H4, B7-H6, B7-S3 and biologically active fragments and/or variants thereof.
- Representative biologically active fragments include the extracellular domain or fragments of the extracellular domain that costimulate T cells.
- inflammatory molecules refers to molecules that induce inflammatory responses (directly or indirectly) including, but not limited to, cytokines and metalloproteases such as including, but not limited to, IL-1beta, TNF-alpha, TGF-beta, IFN-gamma, IL-17, IL-6, IL-23, IL-22, IL-21, and MMPs.
- cytokines and metalloproteases such as including, but not limited to, IL-1beta, TNF-alpha, TGF-beta, IFN-gamma, IL-17, IL-6, IL-23, IL-22, IL-21, and MMPs.
- the term “vaccine” refers to a biological preparation that improves immunity to a particular disease, wherein the vaccine includes an antigen, such as weakened or killed forms of pathogen, its toxins or one of its surface proteins, against which immune responses are elicited.
- a vaccine typically includes an adjuvant as immune potentiator to stimulate the immune system.
- therapeutic vaccine and/or “therapeutic vaccination” refers to a vaccine used to treat ongoing disease, such as infectious disease.
- adjuvant refers to an agent used to stimulate the immune system and increase the response to a vaccine, without having any specific antigenic effect in itself.
- a “vector” is a replicon, such as a plasmid, phage, or cosmid, into which another DNA segment may be inserted so as to bring about the replication of the inserted segment.
- the vectors described herein can be expression vectors.
- an “expression vector” is a vector that includes one or more expression control sequences
- an “expression control sequence” is a DNA sequence that controls and regulates the transcription and/or translation of another DNA sequence.
- “Operably linked” refers to an arrangement of elements wherein the components so described are configured so as to perform their usual or intended function. Thus, two different polypeptides operably linked together retain their respective biological functions while physically linked together.
- valency refers to the number of binding sites available per molecule.
- a “variant” polypeptide contains at least one amino acid sequence alteration as compared to the amino acid sequence of the corresponding wild-type polypeptide.
- “conservative” amino acid substitutions are substitutions wherein the substituted amino acid has similar structural or chemical properties.
- the term “host cell” refers to prokaryotic and eukaryotic cells into which a recombinant vector can be introduced.
- transformed and transfected encompass the introduction of a nucleic acid (e.g. a vector) into a cell by a number of techniques known in the art.
- the terms “immunologic”, “immunological” or “immune” response is the development of a beneficial humoral (antibody mediated) and/or a cellular (mediated by antigen-specific T cells or their secretion products) response directed against a peptide in a recipient patient.
- a response can be an active response induced by administration of immunogen or a passive response induced by administration of antibody or primed T-cells.
- a cellular immune response is elicited by the presentation of polypeptide epitopes in association with Class I or Class II MHC molecules to activate antigen-specific CD4+ T helper cells and/or CD8+ cytotoxic T cells.
- the response may also involve activation of monocytes, macrophages, NK cells, basophils, dendritic cells, astrocytes, microglia cells, eosinophils, activation or recruitment of neutrophils or other components of innate immunity.
- the presence of a cell-mediated immunological response can be determined by proliferation assays (CD4+ T cells) or CTL (cytotoxic T lymphocyte) assays.
- proliferation assays CD4+ T cells
- CTL cytotoxic T lymphocyte
- an “immunogenic agent” or “immunogen” is capable of inducing an immunological response against itself on administration to a mammal, optionally in conjunction with an adjuvant.
- C1ORF32 refers to the protein encoded by any one of the H19011_1_T8 (SEQ ID NO:1), H19011_1_T9 (SEQ ID NO:2) transcripts reported herein, particularly to proteins as set forth in any one of H19011_1_P8 (SEQ ID NO:4), H19011_1_P8_V1 (SEQ ID NO:5), H19011_1_P9 (SEQ ID NO:6) or H19011_1_P9_V1 (SEQ ID NO:34), variants and fragments thereof, which can have therapeutic effect on immune related disorder and/or infection.
- soluble C1ORF32 or “soluble C1ORF32 proteins/molecules” refers to fragments of C1ORF32 that include some or all of the IgV domain of the C1ORF32 polypeptide, and lack some or all of the intracellular and/or transmembrane domains, wherein said fragments retain a biological activity of inhibition of T cell activation.
- the soluble C1ORF32 molecules used in the methods of the invention may or may not include a signal (leader) peptide sequence.
- N-term refers to the N-terminus
- first N-term refers to the N-terminus
- Particular sequences of interest include but are not limited to SEQ ID NOs: 29, 30, 41-105, and/or 45, 64, or 96. It should be noted that one or more activities and/or functions ascribed herein to any of SEQ ID NOs: 29, 30, 41-105 are also applicable to any of SEQ ID NOs: 45, 64 or 96.
- first N-term and second N-term refer to the two potential start points of the IgV domain, as shown in FIG. 1 .
- #1 option cut point (and “#2 option cut point”) refer to different possible C-terminal end points of the soluble protein—also as shown in FIG. 1 .
- FIG. 1 shows five different possible C-terminal end points, which are as follows: the end of the IgV domain, #1 option cut point, #2 option cut point, the end of the produced protein, and the position before the start of the predicted TM (transmembrane region, which occurs two amino acids after the end of the produced protein).
- Reference to “+1” or “ ⁇ 1” from a reference point indicate one amino acid after or before that point, respectively, with larger numbers indicating a greater number of amino acids after or before that point as stated below.
- the right-most column relates to the SEQ ID NO of the amino acid sequence fused to an
- Fc sequence (hIgG1 C220S-SEQ ID NO 115) to form a fusion protein; for example, the amino acid sequence having SEQ ID NO:14, given as fused the above Fc sequence, has SEQ ID NO:116 as a fusion protein.
- the fragments of the extracellular domain of C1ORF32 can include any sequence corresponding to any portion of or comprising the IgV domain of the extracellular domain of C1ORF32, having any sequence corresponding to residues of H19011_1_P8 (SEQ ID NO:4) starting from any position between 18 and 31 and ending at any position between 157 and 175 or corresponding to residues of H19011_1_P8_V1 (SEQ ID NO:5) starting from any position between 18 and 31 and ending at any position between 157 and 175, or corresponding to residues of H19011_1_P9 (SEQ ID NO:6) starting from any position between 18 and 31 and ending at any position between 159 and 172, or corresponding to residues of H19011_1_P9_V1 (SEQ ID NO:34) starting from any position between 18 and 31 and ending at any position between 159 and 172.
- the base sequences as given above are without a signal peptide.
- the C1ORF32 proteins contain an immunoglobulin domain within the extracellular domain, the IgV domain (or V domain), which is related to the variable domain of antibodies.
- the IgV domain may be responsible for receptor binding, by analogy to the other B7 family members.
- the Ig domain of the extracellular domain includes one disulfide bond formed between intradomain cystein residues, as is typical for this fold and may be important for structure-function. In SEQ ID NO: 4 these cysteines are located at residues 42 and 145.
- the first fusion partner is a soluble fragment of C1ORF32.
- useful fragments are those that retain the ability to bind to their natural receptor or receptors and/or retain the ability to inhibit T cell activation.
- a C1ORF32 polypeptide that is a fragment of full-length C1ORF32 typically has at least 20 percent, 30 percent, 40 percent, 50 percent, 60 percent, 70 percent, 80 percent, 90 percent, 95 percent, 98 percent, 99 percent, 100 percent, or even more than 100 percent of the ability to bind its natural receptor(s) and/or of the ability to inhibit T cell activation as compared to full-length C1ORF32.
- Soluble C1ORF32 polypeptide fragments are fragments of C1ORF32 polypeptides that may be shed, secreted or otherwise extracted from the producing cells.
- the soluble fragments of C1ORF32 polypeptides include fragments of the C1ORF32 extracellular domain that retain C1ORF32 biological activity, such as fragments that retain the ability to bind to their natural receptor or receptors and/or retain the ability to inhibit T cell activation.
- the extracellular domain can include 1, 2, 3, 4, or 5 contiguous amino acids from the transmembrane domain, and/or 1, 2, 3, 4, or 5 contiguous amino acids from the signal sequence.
- the extracellular domain can have 1, 2, 3, 4, 5 or more amino acids removed from the C-terminus, N-terminus, or both.
- the extracellular domain is only the IgV domain as set forth in SEQ ID NO: 29, or fragments or variants thereof, or the region between the conserved cysteines of the IgV domain which are located at residues 42 and 145 of the full-length protein SEQ ID NO:4, corresponding to the sequence set forth in SEQ ID NO: 30: CHFSTSSHQPAVVQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLDCLDSRR TVRVVASKQGSTVTLGDFYRGREITIVHDADLQIGKLMWGDSGLYYC.
- the fragments of the IgV domain can include any sequence corresponding to residues of H19011_1_P8 (SEQ ID NO:4) starting from any position between 18 and 31 and ending at any position between 157 and 175 or corresponding to residues of H19011_1_P8_V1 (SEQ ID NO:5) starting from any position between 18 and 31 and ending at any position between 157 and 175, or corresponding to residues of H19011_1_P9 (SEQ ID NO:6) starting from any position between 18 and 31 and ending at any position between 159 and 172 , or corresponding to residues of H19011_1_P9_V1 (SEQ ID NO:34) starting from any position between 18 and 31 and ending at any position between 159 and 172.
- the C1ORF32 polypeptide fragments are expressed from nucleic acids that include sequences that encode a signal sequence.
- the signal sequence is generally cleaved from the immature polypeptide to produce the mature polypeptide lacking the signal sequence.
- the signal sequence of C1ORF32 can be replaced by the signal sequence of another polypeptide using standard molecule biology techniques to affect the expression levels, secretion, solubility, or other property of the polypeptide.
- the signal sequence that is used to replace the C1ORF32 signal sequence can be any known in the art.
- the fusion protein includes the extracellular domain of C1ORF32, or a fragment thereof fused to an Ig Fc region.
- Recombinant IgC1ORF32 polypeptides, fragments or fusion proteins thereof fusion proteins can be prepared by fusing the coding region of the extracellular domain of C1ORF32 or a fragment thereof to the Fc region of human IgG1 or mouse IgG2a, as described previously (Chapoval, et al., Methods MoI. Med, 45:247-255 (2000)).
- C1ORF32 polypeptides include those that increase biological activity, as indicated by any of the assays described herein, or that increase half life or stability of the protein. Soluble C1ORF32 polypeptides and C1ORF32 fragments, or fusions thereof having C1ORF32 activity, can be engineered to increase biological activity.
- the C1ORF32 polypeptide or fusion protein has been modified with at least one amino acid substitution, deletion, or insertion that increases the binding of the molecule to an immune cell, for example a T cell, and transmits an inhibitory signal into the T cell.
- C1ORF32 polypetpides that are engineered to selectively bind to one type of T cell versus other immune cells.
- the C1ORF32 polypeptide can be engineered to bind optionally to Tregs, Th0, Th1, Th17, Th2 or Th22 cells.
- Preferential binding refers to binding that is at least 10%, 20%, 30%, 40%, 50%, 60%f 70%, 80%, 90%, 95%, or greater for one type of cell over another type of cell.
- C1ORF32 can be engineered to have reduced binding to immune cells relative to wildtype C1ORF32. These variants can be used in combination with variants having stronger binding properties to modulate the immune response with a moderate impact. Also optionally, soluble C1ORF32 polypeptides and C1ORF32 fragments, or fusions thereof having C1ORF32 activity, can be engineered to have an increased half-life relative to wildtype. These variants typically are modified to resist enzymatic degradation. Exemplary modifications include modified amino acid residues and modified peptide bonds that resist enzymatic degradation. Various modifications to achieve this are known in the art.
- variant C1ORF32 polypeptides can be engineered to prevent a cleavage of the full C1ORF32 ECD (SEQ ID NO:14) between amino acids F and A at positions 179 and 180 of H19011_1_P8_V1 or H19011_1_P8 (Seq ID NOs: 4 or 5).
- amino acid insertions, deletions or substitutions that prevent the cleavage of the C1ORF32 polypeptides, fusion proteins, or fragments thereof.
- Suitable amino acid substitutions include conservative and non-conservative substitutions, as described above.
- the amino acid substitution in the cleavage site of C1ORF32 ECD at positions 179 and 180 of H19011_1_P8_V1 or H19011_1_P8 is selected from but not limited to: FA ⁇ GA (as for example disclosed in SEQ ID NO:64); FA ⁇ AA (as for example disclosed in SEQ ID NO:96); and FA ⁇ GG (as for example disclosed in SEQ ID NO:45).
- nonhuman animal includes all vertebrates, e.g., mammals and non-mammals, such as nonhuman primates, sheep, dogs, cats, horses, cows chickens, amphibians, reptiles, etc.
- a “nucleic acid fragment” or an “oligonucleotide” or a “polynucleotide” are used herein interchangeably to refer to a polymer of nucleic acid residues.
- a polynucleotide sequence of the present invention refers to a single or double stranded nucleic acid sequences which is isolated and provided in the form of an RNA sequence, a complementary polynucleotide sequence (cDNA), a genomic polynucleotide sequence and/or a composite polynucleotide sequences (e.g., a combination of the above).
- the present invention encompasses nucleic acid sequences described hereinabove; fragments thereof, sequences hybridizable therewith, sequences homologous thereto e.g., at least 90%, at least 95, 96, 97, 98 or 99% or more identical to the nucleic acid sequences set forth herein, sequences encoding similar polypeptides with different codon usage, altered sequences characterized by mutations, such as deletion, insertion or substitution of one or more nucleotides, either naturally occurring or man induced, either randomly or in a targeted fashion.
- the present invention also encompasses homologous nucleic acid sequences (i.e., which form a part of a polynucleotide sequence of the present invention), which include sequence regions unique to the polynucleotides of the present invention.
- the present invention also encompasses novel polypeptides or portions thereof, which are encoded by the isolated polynucleotide and respective nucleic acid fragments thereof described hereinabove and/or degenerative variants thereof.
- the present invention also encompasses polypeptides encoded by the polynucleotide sequences of the present invention.
- the present invention also encompasses homologues of these polypeptides, such homologues can be at least 90%, at least 95, 96, 97, 98 or 99% or more homologous to the amino acid sequences set forth below, as can be determined using BlastP software of the National Center of Biotechnology Information (NCBI) using default parameters.
- NCBI National Center of Biotechnology Information
- the present invention also encompasses fragments of the above described polypeptides and polypeptides having mutations, such as deletions, insertions or substitutions of one or more amino acids, either naturally occurring or man induced, either randomly or in a targeted fashion.
- biomolecular sequences of the present invention can be efficiently utilized as tissue or pathological markers and as putative drugs or drug targets for treating or preventing a disease.
- Oligonucleotides designed for carrying out the methods of the present invention for any of the sequences provided herein can be generated according to any oligonucleotide synthesis method known in the art such as enzymatic synthesis or solid phase synthesis.
- Equipment and reagents for executing solid-phase synthesis are commercially available from, for example, Applied Biosystems. Any other means for such synthesis may also be employed; the actual synthesis of the oligonucleotides is well within the capabilities of one skilled in the art.
- Oligonucleotides used according to this aspect of the present invention are those having a length selected from a range of about 10 to about 200 bases preferably about 15 to about 150 bases, more preferably about 20 to about 100 bases, most preferably about 20 to about 50 bases.
- the oligonucleotides of the present invention may comprise heterocyclic nucleosides consisting of purines and the pyrimidines bases, bonded in a 3′ to 5′ phosphodiester linkage.
- oligonucleotides are those modified in either backbone, internucleoside linkages or bases, as is broadly described hereinunder. Such modifications can oftentimes facilitate oligonucleotide uptake and resistivity to intracellular conditions.
- oligonucleotides useful according to this aspect of the present invention include oligonucleotides containing modified backbones or non-natural internucleoside linkages. Oligonucleotides having modified backbones include those that retain a phosphorus atom in the backbone, as disclosed in U.S. Pat.
- Preferred modified oligonucleotide backbones include, for example, phosphorothioates, chiral phosphorothioates, phosphorodithioates, phosphotriesters, aminoalkyl phosphotriesters, methyl and other alkyl phosphonates including 3′-alkylene phosphonates and chiral phosphonates, phosphinates, phosphoramidates including 3′-amino phosphoramidate and aminoalkylphosphoramidates, thionophosphoramidates, thionoalkylphosphonates, thionoalkylphosphotriesters, and boranophosphates having normal 3′-5′ linkages, 2′-5′ linked analogs of these, and those having inverted polarity wherein the adjacent pairs of nucleoside units are linked 3′-5′ to 5′-3′ or 2′-5′ to 5′-2′.
- Various salts, mixed salts and free acid forms can also be used.
- modified oligonucleotide backbones that do not include a phosphorus atom therein have backbones that are formed by short chain alkyl or cycloalkyl internucleoside linkages, mixed heteroatom and alkyl or cycloalkyl internucleoside linkages, or one or more short chain heteroatomic or heterocyclic internucleoside linkages.
- oligonucleotides which can be used according to the present invention, are those modified in both sugar and the internucleoside linkage, i.e., the backbone, of the nucleotide units are replaced with novel groups.
- the base units are maintained for complementation with the appropriate polynucleotide target.
- An example for such an oligonucleotide mimetic includes peptide nucleic acid (PNA).
- PNA peptide nucleic acid
- a PNA oligonucleotide refers to an oligonucleotide where the sugar-backbone is replaced with an amide containing backbone, in particular an aminoethylglycine backbone.
- the bases are retained and are bound directly or indirectly to aza nitrogen atoms of the amide portion of the backbone.
- Oligonucleotides of the present invention may also include base modifications or substitutions.
- “unmodified” or “natural” bases include the purine bases adenine (A) and guanine (G), and the pyrimidine bases thymine (T), cytosine (C) and uracil (U).
- Modified bases include but are not limited to other synthetic and natural bases such as 5-methylcytosine (5-me-C), 5-hydroxymethyl cytosine, xanthine, hypoxanthine, 2-aminoadenine, 6-methyl and other alkyl derivatives of adenine and guanine, 2-propyl and other alkyl derivatives of adenine and guanine, 2-thiouracil, 2-thiothymine and 2-thiocytosine, 5-halouracil and cytosine, 5-propynyl uracil and cytosine, 6-azouracil, cytosine and thymine, 5-uracil (pseudouracil), 4-thiouracil, 8-halo, 8-amino, 8-thiol, 8-thioalkyl, 8-hydroxyl and other 8-substituted adenines and guanines, 5-halo particularly 5-bromo, 5-trifluoromethyl and other 5-substituted urac
- 5-substituted pyrimidines include 5-substituted pyrimidines, 6-azapyrimidines and N-2, N-6 and 0-6 substituted purines, including 2-aminopropyladenine, 5-propynyluracil and 5-propynylcytosine.
- 5-methylcytosine substitutions have been shown to increase nucleic acid duplex stability by 0.6-1.2° C. [Sanghvi YS et al. (1993) Antisense Research and Applications, CRC Press, Boca Raton 276-278] and are presently preferred base substitutions, even more particularly when combined with 2′-O-methoxyethyl sugar modifications.
- oligonucleotides of the invention involves chemically linking to the oligonucleotide one or more moieties or conjugates, which enhance the activity, cellular distribution or cellular uptake of the oligonucleotide.
- moieties include but are not limited to lipid moieties such as a cholesterol moiety, cholic acid, a thioether, e.g., hexyl-S-tritylthiol, a thiocholesterol, an aliphatic chain, e.g., dodecandiol or undecyl residues, a phospholipid, e.g., di-hexadecyl-rac-glycerol or triethylammonium 1,2-di-O-hexadecyl-rac-glycero-3-H-phosphonate, a polyamine or a polyethylene glycol chain, or adamantane acetic acid, a palmityl moiety
- polypeptide “peptide” and “protein” are used interchangeably herein to refer to a polymer of amino acid residues. The terms apply to amino acid polymers in which one or more amino acid residue is an analog or mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers. Polypeptides can be modified, e.g., by the addition of carbohydrate residues to form glycoproteins. The terms “polypeptide,” “peptide” and “protein” include glycoproteins, as well as non-glycoproteins.
- Polypeptide products can be biochemically synthesized such as by employing standard solid phase techniques. Such methods include exclusive solid phase synthesis, partial solid phase synthesis methods, fragment condensation, classical solution synthesis. These methods are preferably used when the peptide is relatively short (i.e., 10 kDa) and/or when it cannot be produced by recombinant techniques (i.e., not encoded by a nucleic acid sequence) and therefore involves different chemistry.
- Synthetic polypeptides can be purified by preparative high performance liquid chromatography [Creighton T. (1983) Proteins, structures and molecular principles. WH Freeman and Co. N.Y.] and the composition of which can be confirmed via amino acid sequencing.
- peptides identified according to the teachings of the present invention may be degradation products, synthetic peptides or recombinant peptides as well as peptidomimetics, typically, synthetic peptides and peptoids and semipeptoids which are peptide analogs, which may have, for example, modifications rendering the peptides more stable while in a body or more capable of penetrating into cells.
- Methods for preparing peptidomimetic compounds are well known in the art and are specified, for example, in Quantitative Drug Design, C. A. Ramsden Gd., Chapter 17.2, F. Choplin Pergamon Press (1992), which is incorporated by reference as if fully set forth herein. Further details in this respect are provided hereinunder.
- Peptide bonds (—CO—NH—) within the peptide may be substituted, for example, by N-methylated bonds (—N(CH3)—CO—), ester bonds (—C(R)H—C—O—O—C(R)—N—), ketomethylen bonds (—CO—CH2—), ⁇ -aza bonds (—NH—N(R)—CO—), wherein R is any alkyl, e.g., methyl, carba bonds (—CH2—NH—), hydroxyethylene bonds (—CH(OH)—CH2—), thioamide bonds (—CS—NH—), olefinic double bonds (—CH ⁇ CH—), retro amide bonds (—NH—CO—), peptide derivatives (—N(R)—CH2—CO—), wherein R is the “normal” side chain, naturally presented on the carbon atom.
- Natural aromatic amino acids, Trp, Tyr and Phe may be substituted by synthetic non-natural acid such as Phenylglycine, TIC, naphthylelanine (Nol), ring-methylated derivatives of Phe, halogenated derivatives of Phe or o-methyl-Tyr.
- synthetic non-natural acid such as Phenylglycine, TIC, naphthylelanine (Nol), ring-methylated derivatives of Phe, halogenated derivatives of Phe or o-methyl-Tyr.
- the peptides of the present invention may also include one or more modified amino acids or one or more non-amino acid monomers (e.g. fatty acids, complex carbohydrates etc).
- amino acid or “amino acids” is understood to include the 20 naturally occurring amino acids; those amino acids often modified post-translationally in vivo, including, for example, hydroxyproline, phosphoserine and phosphothreonine; and other unusual amino acids including, but not limited to, 2-aminoadipic acid, hydroxylysine, isodesmosine, nor-valine, nor-leucine and ornithine.
- amino acid includes both D- and L-amino acids.
- the peptides of the present invention are preferably utilized in therapeutics which require the peptides to be in soluble form, the peptides of the present invention preferably include one or more non-natural or natural polar amino acids, including but not limited to serine and threonine which are capable of increasing peptide solubility due to their hydroxyl-containing side chain.
- the peptides of the present invention can be generated using recombinant techniques such as described by Bitter et al., (1987) Methods in Enzymol. 153:516-544, Studier et al. (1990) Methods in Enzymol. 185:60-89, Brisson et al. (1984) Nature 310:511-514, Takamatsu et al. (1987) EMBO J. 6:307-311, Coruzzi et al. (1984) EMBO J. 3:1671-1680 and Brogli et al., (1984) Science 224:838-843, Gurley et al. (1986) Mol. Cell. Biol. 6:559-565 and Weissbach & Weissbach, 1988, Methods for Plant Molecular Biology, Academic Press, NY, Section VIII, pp 421-463.
- a nucleic acid construct according to the present invention may be used, which includes at least a coding region of one of the above nucleic acid sequences, and further includes at least one cis acting regulatory element.
- cis acting regulatory element refers to a polynucleotide sequence, preferably a promoter, which binds a trans acting regulator and regulates the transcription of a coding sequence located downstream thereto.
- Any suitable promoter sequence can be used by the nucleic acid construct of the present invention.
- the promoter utilized by the nucleic acid construct of the present invention is active in the specific cell population transformed.
- cell type-specific and/or tissue-specific promoters include promoters such as albumin that is liver specific [Pinkert et al., (1987) Genes Dev. 1:268-277], lymphoid specific promoters [Calame et al., (1988) Adv. Immunol. 43:235-275]; in particular promoters of T-cell receptors [Winoto et al., (1989) EMBO J. 8:729-733] and immunoglobulins; [Banerji et al.
- neuron-specific promoters such as the neurofilament promoter [Byrne et al. (1989) Proc. Natl. Acad. Sci. USA 86:5473-5477], pancreas-specific promoters [Edlunch et al. (1985) Science 230:912-916] or mammary gland-specific promoters such as the milk whey promoter (U.S. Pat. No. 4,873,316 and European
- the nucleic acid construct of the present invention can further include an enhancer, which can be adjacent or distant to the promoter sequence and can function in up regulating the transcription therefrom.
- the nucleic acid construct of the present invention preferably further includes an appropriate selectable marker and/or an origin of replication.
- the nucleic acid construct utilized is a shuttle vector, which can propagate both in E. coli (wherein the construct comprises an appropriate selectable marker and origin of replication) and be compatible for propagation in cells, or integration in a gene and a tissue of choice.
- the construct according to the present invention can be, for example, a plasmid, a bacmid, a phagemid, a cosmid, a phage, a virus or an artificial chromosome.
- suitable constructs include, but are not limited to, pcDNA3, pcDNA3.1 (+/ ⁇ ), pGL3, PzeoSV2 (+/ ⁇ ), pDisplay, pEF/myc/cyto, pCMV/myc/cyto each of which is commercially available from Invitrogen Co. (www.invitrogen.com).
- retroviral vector and packaging systems are those sold by Clontech, San Diego, Calif., including Retro-X vectors pLNCX and pLXSN, which permit cloning into multiple cloning sites and the transgene is transcribed from CMV promoter.
- Vectors derived from Mo-MuLV are also included such as pBabe, where the transgene will be transcribed from the 5′LTR promoter.
- nucleic acid transfer techniques include transfection with viral or non-viral constructs, such as adenovirus, lentivirus, Herpes simplex I virus, or adeno-associated virus (AAV) and lipid-based systems.
- viral or non-viral constructs such as adenovirus, lentivirus, Herpes simplex I virus, or adeno-associated virus (AAV) and lipid-based systems.
- Useful lipids for lipid-mediated transfer of the gene are, for example, DOTMA, DOPE, and DC-Chol [Tonkinson et al., Cancer Investigation, 14(1): 54-65 (1996)].
- the most preferred constructs for use in gene therapy are viruses, most preferably adenoviruses, AAV, lentiviruses, or retroviruses.
- a viral construct such as a retroviral construct includes at least one transcriptional promoter/enhancer or locus-defining elements, or other elements that control gene expression by other means such as alternate splicing, nuclear RNA export, or post-translational modification of messenger.
- Such vector constructs also include a packaging signal, long terminal repeats (LTRs) or portions thereof, and positive and negative strand primer binding sites appropriate to the virus used, unless it is already present in the viral construct.
- LTRs long terminal repeats
- such a construct typically includes a signal sequence for secretion of the peptide from a host cell in which it is placed.
- the signal sequence for this purpose is a mammalian signal sequence or the signal sequence of the polypeptides of the present invention.
- the construct may also include a signal that directs polyadenylation, as well as one or more restriction sites and a translation termination sequence.
- a signal that directs polyadenylation will typically include a 5′ LTR, a tRNA binding site, a packaging signal, an origin of second-strand DNA synthesis, and a 3′ LTR or a portion thereof.
- Other vectors can be used that are non-viral, such as cationic lipids, polylysine, and dendrimers.
- vectors preferably expression vectors, containing a nucleic acid encoding a protein of the invention, or derivatives, fragments, analogs or homologs thereof.
- vector refers to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked.
- plasmid refers to a circular double stranded DNA loop into which additional DNA segments can be ligated.
- viral vector is another type of vector, wherein additional DNA segments can be ligated into the viral genome.
- vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors).
- Other vectors e.g., non-episomal mammalian vectors
- certain vectors are capable of directing the expression of genes to which they are operatively-linked. Such vectors are referred to herein as “expression vectors”.
- expression vectors of utility in recombinant DNA techniques are often in the form of plasmids.
- plasmid and “vector” can be used interchangeably as the plasmid is the most commonly used form of vector.
- the invention is intended to include such other forms of expression vectors, such as viral vectors (e.g., replication defective retroviruses, adenoviruses and adeno-associated viruses), which serve equivalent functions.
- viral vectors e.g., replication defective retroviruses, adenoviruses and adeno-associated viruses
- the recombinant expression vectors of the invention comprise a nucleic acid of the invention in a form suitable for expression of the nucleic acid in a host cell, which means that the recombinant expression vectors include one or more regulatory sequences, selected on the basis of the host cells to be used for expression, that is operatively-linked to the nucleic acid sequence to be expressed.
- “operably-linked” is intended to mean that the nucleotide sequence of interest is linked to the regulatory sequences in a manner that allows for expression of the nucleotide sequence (e.g., in an in vitro transcription/translation system or in a host cell when the vector is introduced into the host cell).
- regulatory sequence is intended to include promoters, enhancers and other expression control elements (e.g., polyadenylation signals). Such regulatory sequences are described, for example, in Goeddel, Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, Calif. (1990). Regulatory sequences include those that direct constitutive expression of a nucleotide sequence in many types of host cell and those that direct expression of the nucleotide sequence only in certain host cells (e.g., tissue-specific regulatory sequences). It will be appreciated by those skilled in the art that the design of the expression vector can depend on such factors as the choice of the host cell to be transformed, the level of expression of protein desired, etc.
- the expression vectors of the invention can be introduced into host cells to thereby produce proteins or peptides, including fusion proteins or peptides, encoded by nucleic acids as described herein.
- the recombinant expression vectors of the invention can be designed for production of variant proteins in prokaryotic or eukaryotic cells.
- proteins of the invention can be expressed in bacterial cells such as Escherichia coli, insect cells (using baculovirus expression vectors) yeast cells or mammalian cells. Suitable host cells are discussed further in Goeddel, Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, Calif. (1990).
- the recombinant expression vector can be transcribed and translated in vitro, for example using T7 promoter regulatory sequences and T7 polymerase.
- Fusion vectors add a number of amino acids to a protein encoded therein, to the amino or C terminus of the recombinant protein.
- Such fusion vectors typically serve three purposes: (i) to increase expression of recombinant protein; (ii) to increase the solubility of the recombinant protein; and (iii) to aid in the purification of the recombinant protein by acting as a ligand in affinity purification.
- a proteolytic cleavage site is introduced at the junction of the fusion moiety and the recombinant protein to enable separation of the recombinant protein from the fusion moiety subsequent to purification of the fusion protein.
- enzymes, and their cognate recognition sequences include Factor Xa, thrombin, PreScission, TEV and enterokinase.
- Typical fusion expression vectors include pGEX (Pharmacia Biotech Inc; Smith and Johnson, 1988.
- GST glutathione S-transferase
- Suitable inducible non-fusion E. coli expression vectors include pTrc (Amrann et al., (1988) Gene 69:301-315) and pET 11d (Studier et al., Gene Expression Technology:
- pET11a-d have N terminal T7 tag.
- One strategy to maximize recombinant protein expression in E. coli is to express the protein in a host bacterium with an impaired capacity to proteolytically cleave the recombinant protein. See, e.g., Gottesman, Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, Calif. (1990) 119-128.
- Another strategy is to alter the nucleic acid sequence of the nucleic acid to be inserted into an expression vector so that the individual codons for each amino acid are those preferentially utilized in E. coli (see, e.g., Wada, et al., 1992. Nucl. Acids Res. 20: 2111-2118).
- nucleic acid sequences of the invention can be carried out by standard DNA synthesis techniques.
- Another strategy to solve codon bias is by using BL21-codon plus bacterial strains (Invitrogen) or Rosetta bacterial strain (Novagen), these strains contain extra copies of rare E.coli tRNA genes.
- the expression vector encoding for the protein of the invention is a yeast expression vector.
- yeast expression vectors for expression in yeast Saccharomyces cerevisiae include pYepSec1 (Baldari, et al., 1987. EMBO J. 6: 229-234), pMFa (Kurjan and Herskowitz, 1982. Cell 30: 933-943), pJRY88 (Schultz et al., 1987. Gene 54: 113-123), pYES2 (Invitrogen Corporation, San Diego, Calif.), and picZ (InVitrogen Corp, San Diego, Calif.).
- polypeptides of the present invention can be produced in insect cells using baculovirus expression vectors.
- Baculovirus vectors available for expression of proteins in cultured insect cells include the pAc series (Smith, et al., 1983. Mol. Cell. Biol. 3: 2156-2165) and the pVL series (Lucklow and Summers, 1989. Virology 170: 31-39).
- a nucleic acid of the invention is expressed in mammalian cells using a mammalian expression vector.
- mammalian expression vectors include pCDM8 (Seed, 1987. Nature 329: 840) and pMT2PC (Kaufman, et al., 1987. EMBO J. 6: 187-195), pIRESpuro (Clontech), pUB6 (Invitrogen), pCEP4 (Invitrogen) pREP4 (Invitrogen), pcDNA3 (Invitrogen).
- the expression vector's control functions are often provided by viral regulatory elements.
- promoters are derived from polyoma, adenovirus 2, cytomegalovirus, Rous Sarcoma Virus, and simian virus 40.
- suitable expression systems for both prokaryotic and eukaryotic cells see, e.g., Chapters 16 and 17 of Sambrook, et al., Molecular Cloning: A Laboratory Manual. 2nd ed., Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1989.
- the recombinant mammalian expression vector is capable of directing expression of the nucleic acid preferentially in a particular cell type (e.g., tissue-specific regulatory elements are used to express the nucleic acid).
- tissue-specific regulatory elements are known in the art.
- suitable tissue-specific promoters include the albumin promoter (liver-specific; Pinkert, et al., 1987. Genes Dev. 1: 268-277), lymphoid-specific promoters (Calame and Eaton, 1988. Adv. Immunol. 43: 235-275), in particular promoters of T cell receptors (Winoto and Baltimore, 1989. EMBO J.
- promoters are also encompassed, e.g., the murine hox promoters (Kessel and Gruss, 1990. Science 249: 374-379) and the alpha-fetoprotein promoter (Campes and Tilghman, 1989. Genes Dev. 3: 537-546).
- the present invention in at least some embodiments further provides a recombinant expression vector comprising a DNA molecule of the invention cloned into the expression vector in an antisense orientation. That is, the DNA molecule is operatively-linked to a regulatory sequence in a manner that allows for expression (by transcription of the DNA molecule) of an RNA molecule that is antisense to mRNA encoding for protein of the invention.
- Regulatory sequences operatively linked to a nucleic acid cloned in the antisense orientation can be chosen that direct the continuous expression of the antisense RNA molecule in a variety of cell types, for instance viral promoters and/or enhancers, or regulatory sequences can be chosen that direct constitutive, tissue specific or cell type specific expression of antisense RNA.
- the antisense expression vector can be in the form of a recombinant plasmid, phagemid or attenuated virus in which antisense nucleic acids are produced under the control of a high efficiency regulatory region, the activity of which can be determined by the cell type into which the vector is introduced.
- host cell and “recombinant host cell” are used interchangeably herein. It is understood that such terms refer not only to the particular subject cell but also to the progeny or potential progeny of such a cell. Because certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope of the term as used herein.
- a host cell can be any prokaryotic or eukaryotic cell.
- protein of the invention can be produced in bacterial cells such as E. coli, insect cells, yeast, plant or mammalian cells (such as Chinese hamster ovary cells (CHO) or COS or 293 cells).
- mammalian cells such as Chinese hamster ovary cells (CHO) or COS or 293 cells.
- Other suitable host cells are known to those skilled in the art.
- Vector DNA can be introduced into prokaryotic or eukaryotic cells via conventional transformation or transfection techniques.
- transformation and “transfection” are intended to refer to a variety of art-recognized techniques for introducing foreign nucleic acid (e.g., DNA) into a host cell, including calcium phosphate or calcium chloride co-precipitation, DEAE-dextran-mediated transfection, lipofection, or electroporation. Suitable methods for transforming or transfecting host cells can be found in Sambrook, et al. (Molecular Cloning: A Laboratory Manual. 2nd ed., Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1989), and other laboratory manuals.
- a gene that encodes a selectable marker (e.g., resistance to antibiotics) is generally introduced into the host cells along with the gene of interest.
- selectable markers include those that confer resistance to drugs, such as G418, hygromycin, puromycin, blasticidin and methotrexate.
- Nucleic acids encoding a selectable marker can be introduced into a host cell on the same vector as that encoding protein of the invention or can be introduced on a separate vector. Cells stably transfected with the introduced nucleic acid can be identified by drug selection (e.g., cells that have incorporated the selectable marker gene will survive, while the other cells die).
- a host cell of the invention such as a prokaryotic or eukaryotic host cell in culture, can be used to produce (i.e., express) protein of the invention.
- the present invention in at least some embodiments further provides methods for producing proteins of the invention using the host cells of the invention.
- the method comprises culturing the host cell of the present invention (into which a recombinant expression vector encoding protein of the invention has been introduced) in a suitable medium such that the protein of the invention is produced.
- the method further comprises isolating protein of the invention from the medium or the host cell.
- nucleotide sequences encoding the protein of the invention under the control of expression control sequences optimized for expression in a desired host.
- sequences may include optimized transcriptional and/or translational regulatory sequences (such as altered Kozak sequences).
- the C1ORF32 polypeptides as described herein may optionally be isolated as naturally-occurring polypeptides, or from any source whether natural, synthetic, semi-synthetic or recombinant Accordingly, the C1ORF32 proteins may be isolated as naturally-occurring proteins from any species, particularly mammalian, including bovine, ovine, porcine, murine, equine, and preferably human. Alternatively, the C1ORF32 proteins may be isolated as recombinant polypeptides that are expressed in prokaryote or eukaryote host cells, or isolated as a chemically synthesized polypeptide.
- C1ORF32 fusion polypeptides have a first fusion partner comprising all or a part of a C1ORF32 protein fused to a second polypeptide directly or via a linker peptide sequence or a chemical linker useful to connect the two proteins.
- the C1ORF32 polypeptide may or may not contain the native signal peptide.
- the C1ORF32 polypeptide may optionally be fused to a second polypeptide to form a fusion protein as described herein.
- the presence of the second polypeptide can alter the solubility, stability, affinity and/or valency of the C1ORF32 fusion polypeptide.
- valency refers to the number of binding sites available per molecule.
- the second polypeptide is a polypeptide from a different source or different protein.
- the C1ORF32 protein or fragment is selected for its activity for the treatment of immune related disorder and/or infection and/or according to one or more in vitro biological activities as described herein.
- the second polypeptide contains one or more domains of an immunoglobulin heavy chain constant region, preferably having an amino acid sequence corresponding to the hinge, CH2 and CH3 regions of a human immunoglobulin C ⁇ 1, C ⁇ 2, C ⁇ 3 or C ⁇ 4, chains or to the hinge, CH2 and CH3 regions of a murine immunoglobulin Cy2a chain.
- SEQ ID NO: 20 provides exemplary sequence for the hinge, CH2 and CH3 regions of a human immunoglobulin Cy1.
- the fusion protein is a dimeric fusion protein.
- the dimer results from the covalent bonding of Cys residue in the hinge region of two of the Ig heavy chains that are the same Cys residues that are disulfide linked in dimerized normal Ig heavy chains.
- Such proteins are referred to as IgC1ORF32 polypeptides, fragments or fusion proteins thereof.
- the immunoglobulin constant domain may contain one or more amino acid insertions, deletions or substitutions that enhance binding to specific cell types, increase the bioavailablity, or increase the stability of the C1ORF32 polypeptides, fusion proteins, or fragments thereof.
- Suitable amino acid substitutions include conservative and non-conservative substitutions, as described above.
- the fusion proteins optionally contain a domain that functions to dimerize or multimerize two or more fusion proteins.
- the peptide/polypeptide linker domain can either be a separate domain, or alternatively can be contained within one of the other domains (C1ORF32 polypeptide or second polypeptide) of the fusion protein.
- the domain that functions to dimerize or multimerize the fusion proteins can either be a separate domain, or alternatively can be contained within one of the other domains (C1ORF32 polypeptide, second polypeptide or peptide/polypeptide linker domain) of the fusion protein.
- the dimerization/multimerization domain and the peptide/polypeptide linker domain are the same. Further specific, illustrative and non-limiting examples of dimerization/multimerization domains and linkers are given below.
- Fusion proteins disclosed herein are of formula I: N-R1-R2-R3-C wherein “N” represents the N-terminus of the fusion protein, “C” represents the C-terminus of the fusion protein.
- R1 is a C1ORF32 polypeptide
- R2 is an optional peptide/polypeptide or chemical linker domain
- R3 is a second polypeptide.
- R3 may be a C1ORF32 polypeptide and R1 may be a second polypeptide.
- linkers are described in greater detail below.
- the fusion protein comprises the C1ORF32 polypeptide fragments selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, fused, optionally by a linker peptide of one or more amino acids (e.g. GS) to one or more “half-life extending moieties”.
- a “half-life extending moiety” is any moiety, for example, a polypeptide, small molecule or polymer, that, when appended to protein, extends the in vivo half-life of that protein in the body of a subject (e.g., in the plasma of the subject).
- a half-life extending moiety is, in an embodiment of the invention, polyethylene glycol (PEG), monomethoxy PEG (mPEG) or an immunoglobulin (Ig).
- PEG is a 5, 10, 12, 20, 30, 40 or 50 kDa moiety or larger or comprises about 12000 ethylene glycol units (PEG12000).
- the fusion protein may also optionally be prepared by chemical synthetic methods and the “join” effected chemically, either during synthesis or post-synthesis.
- Cross-linking and other such methods may optionally be used (optionally also with the above described genetic level fusion methods), as described for example in U.S. Pat. No. 5,547,853 to Wallner et al, which is hereby incorporated by reference as if fully set forth herein as a non-limiting example only.
- a fusion protein may be prepared from a protein of the invention by fusion with a portion of an immunoglobulin comprising a constant region of an immunoglobulin. More preferably, the portion of the immunoglobulin comprises a heavy chain constant region which is optionally and more preferably a human heavy chain constant region.
- the heavy chain constant region is most preferably an IgG heavy chain constant region, and optionally and most preferably is an Fc chain, most preferably an IgG Fc fragment that comprises the hinge, CH2 and CH3 domains.
- the Fc chain may optionally be a known or “wild type” Fc chain, or alternatively may be mutated or truncated.
- the Fc portion of the fusion protein may optionally be varied by isotype or subclass, may be a chimeric or hybrid, and/or may be modified, for example to improve effector functions, control of half-life, tissue accessibility, augment biophysical characteristics such as stability, and improve efficiency of production (and less costly).
- Many modifications useful in construction of disclosed fusion proteins and methods for making them are known in the art, see for example Mueller, et al, MoI. Immun , 34(6):441-452 (1997), Swann, et al., Cur. Opin. Immun , 20:493-499 (2008), and Presta, Cur. Opin. Immun 20:460-470 (2008).
- the Fc region is the native IgG1, IgG2, or IgG4 Fc region.
- the Fc region is a hybrid, for example a chimeric consisting of IgG2/IgG4 Fc constant regions.
- Modications to the Fc region include, but are not limited to, IgG4 modified to prevent binding to Fc gamma receptors and complement, IgG1 modified to improve binding to one or more Fc gamma receptors, IgG1 modified to minimize effector function (amino acid changes), IgG1 with altered/no glycan (typically by changing expression host or substuting the Asn at position 297), and IgG1 with altered pH-dependent binding to FcRn.
- the Fc region may include the entire hinge region, or less than the entire hinge region.
- the Fc domain may contain one or more amino acid insertions, deletions or substitutions that reduce binding to the low affinity inhibitory Fc receptor CD32B (Fc ⁇ RIIB) and retain wild-type levels of binding to or enhance binding to the low affinity activating Fc receptor CD16A (Fc ⁇ RIIIA)
- IgG2-4 hybrids and IgG4 mutants that have reduced binding to FcR (Fc receptor) which increase their half life.
- Representative IgG2-4 hybrids and IgG4 mutants are described in Angal, S. et al., Molecular Immunology, 30(1):105-108 (1993); Mueller, J. et al., Molecular Immunology, 34(6): 441-452 (1997); and U.S. Pat. No. 6,982,323 to Wang et al.
- the IgG1 and/or IgG2 domain is deleted; for example, Angal et al. describe IgG1 and IgG2 having serine 241 replaced with a proline.
- the Fc domain contains amino acid insertions, deletions or substitutions that enhance binding to CD16A.
- a large number of substitutions in the Fc domain of human IgG1 that increase binding to CD16A and reduce binding to CD32B are known in the art and are described in Stavenhagen, et al., Cancer Res., 57(18):8882-90 (2007).
- Exemplary variants of human IgG1 Fc domains with reduced binding to CD32B and/or increased binding to CD16A contain F243L, R929P, Y300L, V3051 or P296L substitutions. These amino acid substitutions may be present in a human IgG1 Fc domain in any combination.
- the human IgG1 Fc domain variant contains a F243L, R929P and Y300L substitution. In another embodiment, the human IgG1 Fc domain variant contains a F243L, R929P, Y300L, V3051 and P296L substitution. In another embodiment, the human IgG1 Fc domain variant contains an N297A/Q substitution, as these mutations abolishFcyR binding.
- Non-limiting, illustrative, exemplary types of mutations are described in US Patent Application No. 20060034852, published on Feb. 16, 2006, hereby incorporated by reference as if fully set forth herein.
- the term “Fc chain” also optionally comprises any type of Fc fragment.
- Non-limiting, illustrative examples of mutations to Fc which may be made to modulate the activity of the fusion protein include the following changes (given with regard to the Fc sequence nomenclature as given by Kabat, from Kabat EA et al: Sequences of Proteins of Immunological Interest. US Department of Health and Human Services, NIH, 1991): 220C ⁇ S; 233-238 ELLGGP ⁇ EAEGAP; 265D ⁇ A, preferably in combination with 434N ⁇ A; 297N ⁇ A (for example to block N-glycosylation); 318-322 EYKCK ⁇ AYACA; 330-331AP ⁇ SS; or a combination thereof (see for example M.
- the construct for the Fc chain which features the above changes optionally and preferably comprises a combination of the hinge region with the CH2 and CH3 domains.
- the above mutations may optionally be implemented to enhance desired properties or alternatively to block non-desired properties.
- aglycosylation of antibodies was shown to maintain the desired binding functionality while blocking depletion of T-cells or triggering cytokine release, which may optionally be undesired functions (see M. Clark, “Chemical Immunol and Antibody Engineering”, pp 1-31).
- Substitution of 331proline for serine may block the ability to activate complement, which may optionally be considered an undesired function (see M. Clark, “Chemical Immunol and Antibody Engineering”, pp 1-31).
- Changing 330 alanine to serine in combination with this change may also enhance the desired effect of blocking the ability to activate complement.
- Residues 235 and 237 were shown to be involved in antibody-dependent cell-mediated cytotoxicity (ADCC), such that changing the block of residues from 233-238 as described may also block such activity if ADCC is considered to be an undesirable function.
- ADCC antibody-dependent cell-mediated cytotoxicity
- Residue 220 is normally a cysteine for Fc from IgG1, which is the site at which the heavy chain forms a covalent linkage with the light chain.
- this residue may be changed to another amino acid residue (e.g., serine), to avoid any type of covalent linkage (see M. Clark, “Chemical Immunol and Antibody Engineering”, pp 1-31) or by deletion or truncation.
- residues 265 and 434 may optionally be implemented to reduce or block binding to the Fc receptor, which may optionally block undesired functionality of Fc related to its immune system functions (see “Binding site on Human IgG1 for Fc Receptors”, Shields et al, Vol 276, pp 6591-6604, 2001).
- the fusion protein includes the C1ORF32 fragment fused to an Ig Fc region.
- Recombinant Ig-C1ORF32 fragment polypeptides can be prepared by fusing the coding region of the C1ORF32 fragment to the Fc region of human IgG1 or mouse IgG2a, as described previously (Chapoval, et al., Methods MoI. Med, 45:247-255 (2000)).
- C1ORF32 fusion protein comprising an amino acid sequence of human C1ORF32 ECD fragment fused to murine or human immunoglobulin Fc.
- said fusion protein comprises the amino acid sequence set forth in anyone of SEQ ID NOs: 29, 30, 41-105, and/or 45, 64, or 96, fused to human IgG1 Fc set forth in any one of SEQ ID NOs: 20, 21, 115.
- the amino acid sequence of said fusion protein is set forth in SEQ ID NO: 39, 108-112, 116-190; optionally and preferably, the amino acid sequence is set forth in any of SEQ ID NOs:112, 120 or alternatively in any one of SEQ ID NOs:110, 136.
- the aforementioned exemplary fusion proteins can incorporate any combination of the variants described herein.
- the terminal lysine of the aforementioned exemplary fusion proteins is deleted.
- the disclosed fusion proteins can be isolated using standard molecular biology techniques. For example, an expression vector containing a DNA sequence encoding a C1ORF32
- ECD fragments or fusion proteins thereof fusion protein is transfected into 293 cells by calcium phosphate precipitation and cultured in serum-free DMEM. The supernatant is collected at 72 h and the fusion protein is purified by Protein G, or preferably Protein A SEPHAROSE® columns (Pharmacia, Uppsala, Sweden).
- a DNA sequence encoding a C1ORF32 fragments fusion protein is transfected into GPEx® retrovectors and expressed in CHO-S cells following four rounds of retrovector transduction. The protein is clarified from supernatants using protein A chromatography.
- the second polypeptide may have a conjugation domain through which additional molecules can be bound to the C1ORF32 fragments fusion proteins.
- the conjugated molecule is capable of targeting the fusion protein to a particular organ or tissue; further specific, illustrative, non-limiting examples of such targeting domains and/or molecules are given below.
- conjugated molecule is another immunomodulatory agent that can enhance or augment the effects of the C1ORF32 fusion protein.
- conjugated molecule is Polyethylene Glycol (PEG).
- the disclosed C1ORF32 fusion proteins optionally contain a peptide or polypeptide linker domain that separates the C1ORF32 polypeptide from the second polypeptide.
- the linker domain contains the hinge region of an immunoglobulin.
- the hinge region is derived from a human immunoglobulin. Suitable human immunoglobulins that the hinge can be derived from include IgG, IgD and IgA.
- the hinge region is derived from human IgG. Amino acid sequences of immunoglobulin hinge regions and other domains are well known in the art.
- C1ORF32 fusion polypeptides contain the hinge, CH2 and CH3 regions of a human immunoglobulin C ⁇ 1 chain, optionally with the Cys at position 220 (according to full length human IgG1, position 5 in SEQ ID NO: 20) replaced with a Ser (SEQ ID NO: 115) having at least 85%, 90%, 95%, 99% or 100% sequence homology to amino acid sequence set forth in SEQ ID NO: 20:
- the hinge can be further shortened to remove amino acids 1, 2, 3, 4, 5, or combinations thereof of any one of SEQ ID NOs: 20 or 115. In one embodiment, amino acids 1-5 of any one of SEQ ID NOs: 20 or 115 are deleted.
- C1ORF32 fusion polypeptides contain the CH2 and CH3 regions of a human immunoglobulin C ⁇ 1 chain having at least 85%, 90%, 95%, 99% or 100% sequence homology to amino acid sequence set forth in SEQ ID NO: 21:
- the C1ORF32 fusion polypeptides contain the CH2 and CH3 regions of a murine immunoglobulin Cy2a chain at least 85%, 90%, 95%, 99% or 100% sequence homology to amino acid sequence set forth in SEQ ID NO:31:
- the linker domain contains a hinge region of an immunoglobulin as described above, and further includes one or more additional immunoglobulin domains.
- Suitable peptide/polypeptide linker domains include naturally occurring or non-naturally occurring peptides or polypeptides.
- Peptide linker sequences are at least 2 amino acids in length.
- the peptide or polypeptide domains are flexible peptides or polypeptides.
- a “flexible linker” herein refers to a peptide or polypeptide containing two or more amino acid residues joined by peptide bond(s) that provides increased rotational freedom for two polypeptides linked thereby than the two linked polypeptides would have in the absence of the flexible linker. Such rotational freedom allows two or more antigen binding sites joined by the flexible linker to each access target antigen(s) more efficiently.
- Exemplary flexible peptides/polypeptides include, but are not limited to, the amino acid sequences Gly-Ser (SEQ ID NO: 24), Gly-Ser-Gly-Ser (SEQ ID NO: 25), Ala-Ser (SEQ ID NO:26), Gly-Gly-Gly-Ser (SEQ ID NO: 27), Gly4-Ser (SEQ ID NO: 106), (Gly4-Ser)2 (SEQ ID NO: 107), (Gly4-Ser)3 (SEQ ID NO: 32) and (Gly4-Ser)4 (SEQ ID NO: 33). Additional flexible peptide/polypeptide sequences are well known in the art.
- the fusion proteins disclosed herein optionally contain a dimerization or multimerization domain that functions to dimerize or multimerize two or more fusion proteins.
- the domain that functions to dimerize or multimerize the fusion proteins can either be a separate domain, or alternatively can be contained within one of the other domains (C1ORF32 polypeptide, second polypeptide, or peptide/polypeptide linker domain) of the fusion protein.
- Dimerization or multinierization can occur between or among two or more fusion proteins through dimerization or multimerization domains. Alternatively, dimerization or multimerization of fusion proteins can occur by chemical crosslinking. The dimers or multimers that are formed can be homodimeric/homomultimeric or heterodimeric/heteromultimeric.
- the second polypeptide “partner” in the C1ORF32 fusion polypeptides may be comprised of one or more other proteins, protein fragments or peptides as described herein, including but not limited to any immunoglobulin (Ig) protein or portion thereof, preferably the Fc region, or a portion of a biologically or chemically active protein such as the papillomavirus E7 gene product, melanoma-associated antigen p97), and HIV env protein (gp120).
- the “partner” is optionally selected to provide a soluble dimer/multimer and/or for one or more other biological activities as described herein.
- a “dimerization domain” is formed by the association of at least two amino acid residues or of at least two peptides or polypeptides (which may have the same, or different, amino acid sequences).
- the peptides or polypeptides may interact with each other through covalent and/or non-covalent associations).
- Optional dimerization domains contain at least one cysteine that is capable of forming an intermolecular disulfide bond with a cysteine on the partner fusion protein.
- the dimerization domain can contain one or more cysteine residues such that disulfide bond(s) can form between the partner fusion proteins.
- dimerization domains contain one, two or three to about ten cysteine residues.
- the dimerization domain is the hinge region of an immunoglobulin.
- Additional exemplary dimerization domains can be any known in the art and include, but not limited to, coiled coils, acid patches, zinc fingers, calcium hands, a C H 1-C L pair, an “interface” with an engineered “knob” and/or “protruberance” as described in U.S. Pat. No. 5,821,333, leucine zippers (e.g., from jun and/or fos) (U.S. Patent No.
- yeast transcriptional activator GCN4 SH2 (src homology 2), SH3 (src Homology 3) (Vidal, et al, Biochemistry, 43, 7336-44 ((2004)), phosphotyrosine binding (PTB) (Zhou, et al., Nature, 378:584-592 (1995)), WW (Sudol, Prog, Biochys.
- NGF nerve growth factor
- NT-3 neurotrophin-3
- IL-8 interleukin-8
- VEGF vascular endothelial growth factor
- VEGF-C vascular endothelial growth factor
- VEGF-D vascular endothelial growth factor
- PDGF members and brain-derived neurotrophic factor (BDNF)
- BDNF brain-derived neurotrophic factor
- the polypeptide pairs can be identified by methods known in the art, including yeast two hybrid screens. Yeast two hybrid screens are described in U.S. Pat. Nos.
- a “multimerization domain” is a domain that causes three or more peptides or polypeptides to interact with each other through covalent and/or non-covalent association(s).
- Suitable multimerization domains include, but are not limited to, coiled-coil domains.
- a coiled-coil is a peptide sequence with a contiguous pattern of mainly hydrophobic residues spaced 3 and 4 residues apart, usually in a sequence of seven amino acids (heptad repeat) or eleven amino acids (undecad repeat), which assembles (folds) to form a multimeric bundle of helices. Coiled-coils with sequences including some irregular distribution of the 3 and 4 residues spacing are also contemplated.
- Hydrophobic residues are in particular the hydrophobic amino acids Val, Ile, Leu, Met, Tyr, Phe and Trp. “Mainly hydrophobic” means that at least 50% of the residues must be selected from the mentioned hydrophobic amino acids.
- the coiled coil domain may be derived from laminin In the extracellular space, the heterotrimeric coiled coil protein laminin plays an important role in the formation of basement membranes. Hence, the multifunctional oligomeric structure is required for laminin function. Coiled coil domains may also be derived from the thrombospondins in which three (TSP-I and TSP-2) or five (TSP-3, TSP-4 and TSP-5) chains are connected, or from COMP (COMPcc) (Guo, et at., EMBO J, 1998, 17: 5265-5272) which folds into a parallel five-stranded coiled coil (Malashkevich, et al., Science, 274: 761-765 (1996)).
- VASP vasodialator-stimulated phosphoprotein
- CMP matrilin-1
- viral fusion peptides soluble NSF (N-ethylmaleimide-sensitive factor) Attachment Protein receptor (SNARE) complexes
- leucine-rich repeats certain tRNA synthetases
- C1ORF32 polypeptides, fusion proteins, or fragments thereof can be induced to form multimers by binding to a second multivalent polypeptide, such as an antibody.
- Antibodies suitable for use to multimerize C1ORF32 polypeptides, fusion proteins, or fragments thereof include, but are not limited to, IgM antibodies and cross-linked, multivalent IgG, IgA, IgD, or IgE complexes.
- Dimerization or multimerization can occur between or among two or more fusion proteins through dimerization or multimerization domains, including those described above. Alternatively, dimerization or multimerization of fusion proteins can occur by chemical crosslinking. Fusion protein dimers can be homodimers or heterodimers. Fusion protein multimers can be homomultimers or heteromultimers.
- Fusion protein dimers as disclosed herein are of formula II: N-R1-R2-R3-C N-R4-R5-R6-C or, alternatively, are of formula N-R1-R2-R3-C C-R4-R5-R6-N wherein the fusion proteins of the dimer provided by formula II are defined as being in a parallel orientation and the fusion proteins of the dimer provided by formula III are defined as being in an antiparallel orientation. Parallel and antiparallel dimers are also referred to as cis and trans dimers, respectively.
- N and “C” represent the N- and C-termini of the fusion protein, respectively.
- the fusion protein constituents “R1”, “R2” and “R3” are as defined above with respect to formula I.
- R4 is a C1ORF32 polypeptide or a second polypeptide
- R5 is an optional peptide/polypeptide linker domain
- R6 is a C1ORF32 polypeptide or a second polypeptide
- R6′ is a second polypeptide when “R4” is a C1ORF32 polypeptide.
- R1 is a C1ORF32 polypeptide
- R4 is also a C1ORF32 polypeptide
- R3” and “R6” are both second polypeptides.
- heterodimers may contain domain orientations that meet these conditions (i.e., for a dimer according to formula II, “R1” and “R4” are both C1ORF32 polypeptides, “R2” and “R5” are both peptide/polypeptide linker domains and “R3” and “R6” are both second polypeptides), however the species of one or more of these domains is not identical.
- R3 and “R6” may both be C1ORF32 polypeptides
- one polypeptide may contain a wild-type C1ORF32 amino acid sequence while the other polypeptide may be a variant C1ORF32 polypeptide.
- An exemplary variant C1ORF32 polypeptide is C1ORF32 polypeptide that has been modified to have increased or decreased binding to a target cell, increased activity on immune cells, increased or decreased half life or stability.
- Dimers of fusion proteins that contain either a CHI or CL region of an immunoglobulin as part of the polypeptide linker domain preferably form heterodimers wherein one fusion protein of the dimer contains a CHI region and the other fusion protein of the dimer contains a CL region.
- Fusion proteins can also be used to form multimers.
- multimers may be parallel multimers, in which all fusion proteins of the multimer are aligned in the same orientation with respect to their N- and C-termini.
- Multimers may be antiparallel multimers, in which the fusion proteins of the multimer are alternatively aligned in opposite orientations with respect to their N- and C-termini.
- Multimers (parallel or antiparallel) can be either homomultimers or heteromultimers.
- the fusion protein is optionally produced in dimeric form; more preferably, the fusion is performed at the genetic level as described below, by joining polynucleotide sequences corresponding to the two (or more) proteins, portions of proteins and/or peptides, such that a joined or fused protein is produced by a cell according to the joined polynucleotide sequence.
- a description of preparation for such fusion proteins is described with regard to U.S. Pat. No. 5,851,795 to Linsley et al, which is hereby incorporated by reference as if fully set forth herein as a non-limiting example only.
- the C1ORF32 polypeptides and fusion proteins can contain a targeting domain to target the molecule to specific sites in the body.
- Optional targeting domains target the molecule to areas of inflammation.
- Exemplary targeting domains are antibodies, or antigen binding fragments thereof that are specific for inflamed tissue or to a proinflammatory cytokine including but not limited to IL17, IL-4, IL-6, IL-12, IL-21, IL-22, and IL-23.
- the targeting domain may target the molecule to the CNS or may bind to VCAM-I on the vascular epithelium.
- Additional targeting domains can be peptide aptamers specific for a proinflammatory molecule.
- the C1ORF32 fusion protein can include a binding partner specific for a polypeptide displayed on the surface of an immune cell, for example a T cell.
- the targeting domain specifically targets activated immune cells.
- Optional immune cells that are targeted include Th0, Th1, Th 17, Th2 and Th22 T cells, other cells that secrete, or cause other cells to secrete inflammatory molecules including, but not limited to, IL-1beta, TNF-alpha, TGF-beta, IFN-gamma, IL-17, IL-6, IL-23, IL-22, IL-21, and MMPs, and Tregs.
- a targeting domain for Tregs may bind specifically to CD25.
- Dimerization or multimierization can occur between or among two or more fusion proteins through dimerization or multimerization domains Alternatively, dimerization or multimerization of fusion proteins can occur by chemical crosslinking.
- the dimers or multimers that are formed can be homodimeric/homomultimeric or heterodimeric/heteromultimeric.
- the second polypeptide “partner” in the C1ORF32 fusion polypeptides may be comprised of one or more other proteins, protein fragments or peptides as described herein, including but not limited to any immunoglobulin (Ig) protein or portion thereof, preferably the Fc region, or a portion of a biologically or chemically active protein such as the papillomavirus E7 gene product, melanoma-associated antigen p97), and HIV env protein (gp120).
- the “partner” is optionally selected to provide a soluble dimer/multimer and/or for one or more other biological activities as described herein.
- a protein according to the present invention is a linear molecule
- various functional groups can be added to the termini of linear forms of the protein according to at least some embodiments of the invention.
- the functional groups improve the activity of the protein with regard to one or more characteristics, including but not limited to, improvement in stability, penetration (through cellular membranes and/or tissue barriers), tissue localization, efficacy, decreased clearance, decreased toxicity, improved selectivity, improved resistance to expulsion by cellular pumps, and the like.
- the free N-terminus of one of the sequences contained in the compositions according to at least some embodiments of the invention will be termed as the N-terminus of the composition, and the free C-terminal of the sequence will be considered as the C-terminus of the composition.
- Either the C-terminus or the N-terminus of the sequences, or both, can be linked to a carboxylic acid functional groups or an amine functional group, respectively.
- Non-limiting examples of suitable functional groups are described in Green and Wuts, “Protecting Groups in Organic Synthesis”, John Wiley and Sons, Chapters 5 and 7, 1991, the teachings of which are incorporated herein by reference.
- Preferred protecting groups are those that facilitate transport of the active ingredient attached thereto into a cell, for example, by reducing the hydrophilicity and increasing the lipophilicity of the active ingredient, these being an example for “a moiety for transport across cellular membranes”.
- moieties can optionally and preferably be cleaved in vivo, either by hydrolysis or enzymatically, inside the cell.
- Ditter et al. J. Pharm. Sci. 57:783 (1968); Ditter et al., J. Pharm. Sci. 57:828 (1968); Ditter et al., J. Pharm. Sci. 58:557 (1969); King et al., Biochemistry 26:2294 (1987); Lindberg et al., Drug Metabolism and Disposition 17:311 (1989); and Tunek et al., Biochem. Pharm. 37:3867 (1988), Anderson et al., Arch. Biochem. Biophys.
- Hydroxyl protecting groups include esters, carbonates and carbamate protecting groups
- Amine protecting groups include alkoxy and aryloxy carbonyl groups, as described above for N-terminal protecting groups.
- Carboxylic acid protecting groups include aliphatic, benzylic and aryl esters, as described above for C-terminal protecting groups.
- the carboxylic acid group in the side chain of one or more glutamic acid or aspartic acid residue in a composition of the present invention is protected, preferably with a methyl, ethyl, benzyl or substituted benzyl ester, more preferably as a benzyl ester.
- Non-limiting, illustrative examples of N-terminal protecting groups include acyl groups (—CO—R1) and alkoxy carbonyl or aryloxy carbonyl groups (—CO—O—R1), wherein R1 is an aliphatic, substituted aliphatic, benzyl, substituted benzyl, aromatic or a substituted aromatic group.
- acyl groups include but are not limited to acetyl, (ethyl)-CO—, n-propyl-CO—, iso-propyl-CO—, n-butyl-CO—, sec-butyl-CO—, t-butyl-CO—, hexyl, lauroyl, palmitoyl, myristoyl, stearyl, oleoyl phenyl-CO—, substituted phenyl-CO—, benzyl-CO— and (substituted benzyl)-CO—.
- alkoxy carbonyl and aryloxy carbonyl groups include CH3—O—CO—, (ethyl)-O—CO—, n-propyl-O—CO—, iso-propyl-O—CO—, n-butyl-O—CO—, sec-butyl-O—CO—, t-butyl-O—CO—, phenyl-O—CO—, substituted phenyl-O—CO— and benzyl-O—CO—, (substituted benzyl)-O—CO—, Adamantan, naphtalen, myristoleyl, toluen, biphenyl, cinnamoyl, nitrobenzoy, toluoyl, furoyl, benzoyl, cyclohexane, norbornane, or Z-caproic.
- one to four glycine residues can be present in the N-terminus of the molecule.
- the carboxyl group at the C-terminus of the compound can be protected, for example, by a group including but not limited to an amide (i.e., the hydroxyl group at the C-terminus is replaced with —NH 2 , —NHR 2 and —NR 2 R 3 ) or ester (i.e. the hydroxyl group at the C-terminus is replaced with —OR 2 ).
- R 2 and R 3 are optionally independently an aliphatic, substituted aliphatic, benzyl, substituted benzyl, aryl or a substituted aryl group.
- R 2 and R 3 can optionally form a C4 to C8 heterocyclic ring with from about 0-2 additional heteroatoms such as nitrogen, oxygen or sulfur.
- suitable heterocyclic rings include piperidinyl, pyrrolidinyl, morpholino, thiomorpholino or piperazinyl.
- C-terminal protecting groups include but are not limited to —NH 2 , —NHCH 3 , —N(CH 3 ) 2 , —NH(ethyl), —N(ethyl) 2 , —N(methyl) (ethyl), —NH(benzyl), -N(C1-C4 alkyl)(benzyl), —NH(phenyl), —N(C1-C4 alkyl) (phenyl), —OCH 3 , —O-(ethyl), —O-(n-propyl), —O-(n-butyl), —O-(iso-propyl), —O-(sec-butyl), —O-(t-butyl), —O-benz yl and —O-phenyl.
- a “peptidomimetic organic moiety” can optionally be substituted for amino acid residues in the composition of this invention both as conservative and as non-conservative substitutions. These moieties are also termed “non-natural amino acids” and may optionally replace amino acid residues, amino acids or act as spacer groups within the peptides in lieu of deleted amino acids.
- the peptidomimetic organic moieties optionally and preferably have steric, electronic or configurational properties similar to the replaced amino acid and such peptidomimetics are used to replace amino acids in the essential positions, and are considered conservative substitutions. However such similarities are not necessarily required. According to preferred embodiments of the present invention, one or more peptidomimetics are selected such that the composition at least substantially retains its physiological activity as compared to the native protein according to the present invention.
- Peptidomimetics may optionally be used to inhibit degradation of the peptides by enzymatic or other degradative processes.
- the peptidomimetics can optionally and preferably be produced by organic synthetic techniques.
- suitable peptidomimetics include D amino acids of the corresponding L amino acids, tetrazol (Zabrocki et al., J. Am. Chem. Soc. 110:5875-5880 (1988)); isosteres of amide bonds (Jones et al., Tetrahedron Lett. 29: 3853-3856 (1988)); LL-3-amino-2-propenidone-6-carboxylic acid (LL-Acp) (Kemp et al., J.
- exemplary peptidomimetics include hydroxy-1,2,3,4-tetrahydroisoquinoline-3-carboxylate (Miyake et al., J. Takeda Res. Labs 43:53-76 (1989)); 1,2,3,4-tetrahydro-isoquinoline-3-carboxylate (Kazmierski et al., J. Am. Chem. Soc.
- HIC histidine isoquinolone carboxylic acid
- Exemplary, illustrative but non-limiting non-natural amino acids include beta-amino acids (beta3 and beta2), homo-amino acids, cyclic amino acids, aromatic amino acids, Pro and Pyr derivatives, 3-substituted Alanine derivatives, Glycine derivatives, ring-substituted Phe and Tyr Derivatives, linear core amino acids or diamino acids. They are available from a variety of suppliers, such as Sigma-Aldrich (USA) for example.
- any part of a protein according to at least some embodiments of the invention may optionally be chemically modified, i.e. changed by addition of functional groups.
- the side amino acid residues appearing in the native sequence may optionally be modified, although as described below alternatively other parts of the protein may optionally be modified, in addition to or in place of the side amino acid residues.
- the modification may optionally be performed during synthesis of the molecule if a chemical synthetic process is followed, for example by adding a chemically modified amino acid.
- chemical modification of an amino acid when it is already present in the molecule (“in situ” modification) is also possible.
- the amino acid of any of the sequence regions of the molecule can optionally be modified according to any one of the following exemplary types of modification (in the peptide conceptually viewed as “chemically modified”).
- Non-limiting exemplary types of modification include carboxymethylation, acylation, phosphorylation, glycosylation or fatty acylation.
- Ether bonds can optionally be used to join the serine or threonine hydroxyl to the hydroxyl of a sugar.
- Amide bonds can optionally be used to join the glutamate or aspartate carboxyl groups to an amino group on a sugar (Garg and Jeanloz, Advances in Carbohydrate Chemistry and Biochemistry, Vol. 43, Academic Press (1985); Kunz, Ang. Chem. Int. Ed.
- Acetal and ketal bonds can also optionally be formed between amino acids and carbohydrates.
- Fatty acid acyl derivatives can optionally be made, for example, by acylation of a free amino group (e.g., lysine) (Toth et al., Peptides: Chemistry, Structure and Biology, Rivier and Marshal, eds., ESCOM Publ., Leiden, 1078-1079 (1990)).
- Examples of the numerous known modifications typically include, but are not limited to: acetylation, acylation, amidation, ADP-ribosylation, glycosylation, GPI anchor formation, covalent attachment of a lipid or lipid derivative, methylation, myristylation, pegylation, prenylation, phosphorylation, ubiquitination, or any similar process.
- modifications optionally include the addition of a cycloalkane moiety to a biological molecule, such as a protein, as described in PCT Application No. WO 2006/050262, hereby incorporated by reference as if fully set forth herein. These moieties are designed for use with biomolecules and may optionally be used to impart various properties to proteins.
- any point on a protein may be modified.
- pegylation of a glycosylation moiety on a protein may optionally be performed, as described in PCT Application No. WO 2006/050247, hereby incorporated by reference as if fully set forth herein.
- One or more polyethylene glycol (PEG) groups may optionally be added to O-linked and/or N-linked glycosylation.
- the PEG group may optionally be branched or linear.
- any type of water-soluble polymer may be attached to a glycosylation site on a protein through a glycosyl linker.
- Proteins according to at least some embodiments of the invention may be modified to have an altered glycosylation pattern (i.e., altered from the original or native glycosylation pattern).
- altered means having one or more carbohydrate moieties deleted, and/or having at least one glycosylation site added to the original protein.
- N-linked refers to the attachment of the carbohydrate moiety to the side chain of an asparagine residue.
- the tripeptide sequences, asparagine-X-serine and asparagine-X-threonine, where X is any amino acid except proline, are the recognition sequences for enzymatic attachment of the carbohydrate moiety to the asparagine side chain.
- X is any amino acid except proline
- O-linked glycosylation refers to the attachment of one of the sugars N-acetylgalactosamine, galactose, or xylose to a hydroxyamino acid, most commonly serine or threonine, although 5-hydroxyproline or 5-hydroxylysine may also be used.
- Addition of glycosylation sites to proteins according to at least some embodiments of the invention is conveniently accomplished by altering the amino acid sequence of the protein such that it contains one or more of the above-described tripeptide sequences (for N-linked glycosylation sites).
- the alteration may also be made by the addition of, or substitution by, one or more serine or threonine residues in the sequence of the original protein (for O-linked glycosylation sites).
- the protein's amino acid sequence may also be altered by introducing changes at the DNA level.
- Another means of increasing the number of carbohydrate moieties on proteins is by chemical or enzymatic coupling of glycosides to the amino acid residues of the protein.
- the sugars may be attached to (a) arginine and histidine, (b) free carboxyl groups, (c) free sulfhydryl groups such as those of cysteine, (d) free hydroxyl groups such as those of serine, threonine, or hydroxyproline, (e) aromatic residues such as those of phenylalanine, tyrosine, or tryptophan, or (f) the amide group of glutamine.
- Removal of any carbohydrate moieties present on proteins may be accomplished chemically or enzymatically.
- Chemical deglycosylation requires exposure of the protein to trifluoromethanesulfonic acid, or an equivalent compound. This treatment results in the cleavage of most or all sugars except the linking sugar (N-acetylglucosamine or N-acetylgalactosamine), leaving the amino acid sequence intact.
- therapeutic agent is any one of the C1ORF32 proteins and polypeptides fragments according to at least some embodiments of the present invention, and/or fusion proteins and/or multimeric proteins comprising same, and/or nucleic acid sequence or fragments thereof encoding same.
- the therapeutic agents can be used to treat immune related disorders as recited herein, and/or autoimmune disorders as recited herein, and/or infectious disorders as recited herein, and/or for blocking and/or promoting immune costimulation mediated by the C1ORF32 polypeptides in a subject.
- the therapeutic agents can be used to prevent pathologic inhibition of T cell activity, such as that directed against chronic infections; and/or prevent pathologic stimulation of T cell activity, such as that directed against autoantigens in autoimmune diseases.
- these molecules can be administered to cells in culture, in vitro or ex vivo, or to human subjects, e.g., in vivo, to treat, prevent and to diagnose a variety of disorders.
- Preferred subjects include human patients, having disorders mediated by cells expressing the C1ORF32 protein, and cells that possess C1ORF32 activity.
- the therapeutic agents can be used to inhibit T cell activation, as can be manifested for example by T cell proliferation and cytokine secretion.
- a method of treating immune related disorders as recited herein, and/or autoimmune disorders as recited herein, and/or infectious disorders as recited herein, and/or for blocking or promoting immune stimulation mediated by the C1ORF32 polypeptide in a subject by administering to a subject in need thereof an effective amount of any one of the therapeutic agents and/or a pharmaceutical composition comprising any of the therapeutic agents and further comprising a pharmaceutically acceptable diluent or carrier.
- the subject according to the present invention is a mammal, preferably a human which is diagnosed with one of the disease, disorder or conditions described hereinabove, or alternatively is predisposed to at least one infectious disorder, and/or immune related disorder.
- Treatment refers to both therapeutic treatment and prophylactic or preventative measures. Those in need of treatment include those already with the disorder as well as those in which the disorder is to be prevented. Hence, the mammal to be treated herein may have been diagnosed as having the disorder or may be predisposed or susceptible to the disorder. “Mammal” for purposes of treatment refers to any animal classified as a mammal, including humans, domestic and farm animals, and zoo, sports, or pet animals, such as dogs, horses, cats, cows, etc. Preferably, the mammal is human.
- treating refers to preventing, delaying the onset of, curing, reversing, attenuating, alleviating, minimizing, suppressing or halting the deleterious effects of the above-described diseases, disorders or conditions. It also includes managing the disease as described above. By “manage” it is meant reducing the severity of the disease, reducing the frequency of episodes of the disease, reducing the duration of such episodes, reducing the severity of such episodes and the like.
- Treating can be effected by specifically upregulating the amount and/or the expression of at least one of the polypeptides of the present invention in the subject.
- upregulation may be effected by administering to the subject at least one of the polypeptides of the present invention (e.g., recombinant or synthetic) or an active portion thereof, as described herein.
- the polypeptides of the present invention e.g., recombinant or synthetic
- administration of polypeptides is preferably confined to small peptide fragments (e.g., about 100 amino acids).
- the polypeptide or peptide may optionally be administered in as part of a pharmaceutical composition, described in more detail below.
- treatment of the above-described diseases according to at least some embodiments of the present invention may be combined with other treatment methods known in the art (i.e., combination therapy), as described herein.
- the therapeutic agents and/or a pharmaceutical composition comprising same, as recited herein, according to at least some embodiments of the present invention can also be used in combination with one or more of the following agents to regulate an immune response: soluble gp39 (also known as CD40 ligand (CD40L), CD154, T-BAM, TRAP), soluble CD29, soluble CD40, soluble CD80 (e.g. ATCC 68627), soluble CD86, soluble CD28 (e.g. 68628), soluble CD56, soluble Thy-1, soluble CD3, soluble TCR, soluble VLA-4, soluble VCAM-1, soluble LECAM-1, soluble ELAM-1, soluble CD44, antibodies reactive with gp39 (e.g.
- ATCC HB-10916, ATCC HB-12055 and ATCC HB-12056 antibodies reactive with CD40 (e.g. ATCC HB-9110), antibodies reactive with B7 (e.g. ATCC HB-253, ATCC CRL-2223, ATCC CRL-2226, ATCC HB-301, ATCC HB-11341, etc), antibodies reactive with CD28 (e.g. ATCC HB-11944 or mAb 9.3), antibodies reactive with LFA-1 (e.g.
- antibodies reactive with LFA-2 antibodies reactive with IL-2, antibodies reactive with IL-12, antibodies reactive with IFN-gamma, antibodies reactive with CD2, antibodies reactive with CD48, antibodies reactive with any ICAM (e.g., ICAM-1 (ATCC CRL-2252), ICAM-2 and ICAM-3), antibodies reactive with CTLA4 (e.g.
- the combination can include the therapeutic agents and/or a pharmaceutical composition comprising same, according to at least some embodiments of the invention and one other immunosuppressive agent; the therapeutic agents and/or a pharmaceutical composition comprising same, as recited herein, with two other immunosuppressive agents, the therapeutic agents and/or a pharmaceutical composition comprising same, as recited herein, with three other immunosuppressive agents, etc.
- the determination of the optimal combination and dosages can be determined and optimized using methods well known in the art.
- the therapeutic agent according to the present invention and one or more other therapeutic agents can be administered in either order or simultaneously.
- the invention also encompasses the use of the therapeutic agents and/or a pharmaceutical composition comprising same according to at least some embodiments of the invention in combination with other pharmaceutical agents to treat immune system diseases.
- autoimmune disease may be treated with molecules according to at least some embodiments of the invention in conjunction with, immunosuppressants such as corticosteroids, cyclosporin, cyclophosphamide, prednisone, azathioprine, methotrexate, rapamycin, tacrolimus, biological agents such as TNF-alpha blockers or antagonists, immunosuppressive agents (e.g., antibodies against other lymphocyte surface markers (e.g., CD40, alpha-4 integrin) or against cytokines), other fusion proteins (e.g., CTLA-4-Ig (Orencia®), TNFR-Ig (Enbrel®)), TNF-alpha blockers such as Enbrel, Remicade, Cimzia and Humira, cyclophosphamide (CTX)
- MTX methotrexate
- Rheumatrex® i.e. Rheumatrex®, Trexall®
- belimumab i.e. Benlysta®
- immunosuppressive drugs e.g., cyclosporin A, FK506-like compounds, rapamycin compounds, or steroids
- anti-proliferatives cytotoxic agents, or other compounds that may assist in immunosuppression.
- interferons such as IFN-beta-1a (REBIF®.
- AVONEX® and CINNOVEX ®) and IFN-beta-1b BETASERON®, EXTAVIA®, BETAFERON®, ZIFERON®
- glatiramer acetate COPAXONE®
- TYSABRI® natalizumab
- NOVANTRONE® mitoxantrone
- treatment of multiple sclerosis using the agents according to at least some embodiments of the present invention may be combined with, for example, any known therapeutic agent or method for treating multiple sclerosis.
- known therapeutic agent or method for treating multiple sclerosis include interferon class, IFN-beta-1a (REBIF®, AVONEX® and CINNOVEX®) and IFN-beta-1b (BETASERON®, EXTAVIA®, BETAFERON®, ZIFERON®); glatiramer acetate (COPAXONE®), a polypeptide; natalizumab (TYSABRI®); and mitoxantrone (NOVANTRONE®), a cytotoxic agent, Fampridine (AMPYRA®).
- IFN-beta-1a REBIF®, AVONEX® and CINNOVEX®
- IFN-beta-1b BETASERON®, EXTAVIA®, BETAFERON®, ZIFERON®
- drugs include corticosteroids, methotrexate, cyclophosphamide, azathioprine, and intravenous immunoglobulin (IVIG), inosine, Ocrelizumab (R1594), Mylinax (Caldribine), alemtuzumab (Campath), daclizumab (Zenapax), Panaclar/dimethyl fumarate (BG-12), Teriflunomide (HMR1726), fingolimod (FTY720), laquinimod (ABR216062), as well as Haematopoietic stem cell transplantation, Neurovax, Rituximab (Rituxan) BCG vaccine, low dose naltrexone, helminthic therapy, angioplasty, venous stents, and alternative therapy, such as vitamin D, polyunsaturated fats, medical marijuana.
- IVIG intravenous immunoglobulin
- inosine Ocrelizumab (R1594)
- Mylinax Cal
- treatment of rheumatoid arthritis using the agents according to at least some embodiments of the present invention may be combined with, for example, any known therapeutic agent or method for treating rheumatoid arthritis.
- known therapeutic agents or methods for treating rheumatoid arthritis include glucocorticoids, nonsteroidal anti-inflammatory drug (NSAID) such as salicylates, or cyclooxygenase-2 inhibitors, ibuprofen and naproxen, diclofenac, indomethacin, etodolac Disease-modifying antirheumatic drugs (DMARDs)-Oral DMARDs: Auranofin (Ridaura), Azathioprine (Imuran), Cyclosporine (Sandimmune, Gengraf, Neoral, generic), D-Penicillamine (Cuprimine), Hydroxychloroquine (Plaquenil), IM gold Gold sodium thiomalate (Myochrysine) Aurothi
- NSAID non
- Biologic DMARDs TNF- ⁇ blockers including Adalimumab (Humira), Etanercept (Enbrel), Infliximab (Remicade), golimumab (Simponi), certolizumab pegol (Cimzia), and other Biological DMARDs, such as Anakinra (Kineret), Rituximab (Rituxan), Tocilizumab (Actemra), CD28 inhibitor including Abatacept (Orencia) and Belatacept.
- treatment of IBD using the agents according to at least some embodiments of the present invention may be combined with, for example, any known therapeutic agent or method for treating IBD.
- known therapeutic agents or methods for treating IBD include immunosuppression to control the symptom, such as prednisone, Mesalazine (including Asacol, Pentasa, Lialda, Aspiro),azathioprine (Imuran), methotrexate, or 6-mercaptopurine, steroids, Ondansetron, TNF- ⁇ blockers (including infliximab, adalimumab golimumab, certolizumab pegol), Orencia (abatacept), ustekinumab (Stelara®), Briakinumab (ABT-874), Certolizumab pegol (Cimzia®), ITF2357 (givinostat), Natalizumab (Tysabri), Firategrast (SB -683699), Remicade
- treatment of psoriasis using the agents according to at least some embodiments of the present invention may be combined with, for example, any known therapeutic agent or method for treating psoriasis.
- known therapeutics for treating psoriasis include topical agents, typically used for mild disease, phototherapy for moderate disease, and systemic agents for severe disease.
- Non-limiting examples of topical agents bath solutions and moisturizers, mineral oil, and petroleum jelly; ointment and creams containing coal tar, dithranol (anthralin), corticosteroids like desoximetasone (Topicort), Betamethasone, fluocinonide, vitamin D3 analogues (for example, calcipotriol), and retinoids.
- Non-limiting examples of phototherapy sunlight; wavelengths of 311-313 nm, psoralen and ultraviolet A phototherapy (PUVA).
- Non-limiting examples of systemic agents Biologics, such as interleukin antagonists, TNF- ⁇ blockers including antibodies such as infliximab (Remicade), adalimumab (Humira), golimumab, certolizumab pegol, and recombinant TNF- ⁇ decoy receptor, etanercept (Enbrel); drugs that target T cells, such as efalizumab (Xannelim/Raptiva), alefacept (Ameviv), dendritic cells such Efalizumab; monoclonal antibodies (MAbs) targeting cytokines, including anti-IL-12/IL-23 (ustekinumab (brand name Stelara)) and anti-Interleukin-17; Briakinumab (ABT-874); small molecules, including but not limited to ISA247; Immunosuppressants, such as methotrexate, cyclosporine; vitamin A and retinoids (synthetic forms of vitamin A); and
- treatment of type 1 diabetes using the agents according to at least some embodiments of the present invention may be combined with, for example, any known therapeutic agent or method for treating type ldiabetes.
- known therapeutics for treating type 1 diabetes include insulin, insulin analogs, islet transplantation, stem cell therapy including PROCHYMAL®, non-insulin therapies such as il-1beta inhibitors including Anakinra (Kineret®), Abatacept (Orencia®), Diamyd, alefacept (Ameviv®), Otelixizumab, DiaPep277 (Hsp60 derived peptide), Alpha 1-Antitrypsin, Prednisone, azathioprine, Ciclosporin, El-INT (an injectable islet neogenesis therapy comprising an epidermal growth factor analog and a gastrin analog), statins including Zocor®, Simlup®, Simcard®, Simvacor®, Sitagliptin (dipeptidyl peptidas
- treatment of uveitis using the agents according to at least some embodiments of the present invention may be combined with, for example, any known therapeutic agent or method for treating uveitis.
- known therapeutics for treating uveitis include corticosteroids, topical cycloplegics, such as atropine or homatropine, or injection of PSTTA (posterior subtenon triamcinolone acetate), antimetabolite medications, such as methotrexate, TNF- ⁇ blockers (including infliximab, adalimumab, etanercept, golimumab, certolizumab pegol).
- treatment for Sjogren's syndrome using the agents according to at least some embodiments of the present invention may be combined with, for example, any known therapeutic agent or method for treating for Sjogren's syndrome.
- known therapeutics for treating for Sjogren' s syndrome include Cyclosporine, pilocarpine (Salagen) and cevimeline (Evoxac), Hydroxychloroquine (Plaquenil), cortisone (prednisone and others) and/or azathioprine (Imuran) or cyclophosphamide (Cytoxan), Dexamethasone, Thalidomide, Dehydroepiandrosterone, NGX267, Rebamipide, FID 114657, Etanercept, Raptiva, Belimumab, MabThera (rituximab); Anakinra, intravenous immune globulin (IVIG), Allogeneic Mesenchymal Stem Cells (AlloMSC),
- treatment for systemic lupus erythematosus using the agents according to at least some embodiments of the present invention may be combined with, for example, any known therapeutic agent or method for treating for systemic lupus erythematosus.
- known therapeutics for treating for systemic lupus erythematosus include corticosteroids and Disease-modifying antirheumatic drugs (DMARDs), commonly anti-malarial drugs such as plaquenil and immunosuppressants (e.g.
- methotrexate and azathioprine Hydroxychloroquine, cytotoxic drugs (e.g., cyclophosphamide and mycophenolate), Hydroxychloroquine (HCQ), Benlysta (belimumab), nonsteroidal anti-inflammatory drugs, Prednisone, Cellcept, Prograf, Atacicept, Lupuzor, Intravenous Immunoglobulins (IVIGs), CellCept (mycophenolate mofetil), Orencia, CTLA4-IgG4m (RG2077), rituximab, Ocrelizumab, Epratuzumab, CNTO 136, Sifalimumab (MEDI-545), A-623 (formerly AMG 623), AMG 557, Rontalizumab, paquinimod (ABR-215757), LY2127399, CEP-33457, Dehydroepiandrosterone, Levothyroxine, abetimus sodium (LIP 394),
- the therapeutic agents and/or a pharmaceutical composition comprising same, as recited herein, according to at least some embodiments of the invention, may be administered as the sole active ingredient or together with other drugs in immunomodulating regimens or other anti-inflammatory agents e.g. for the treatment or prevention of allo- or xenograft acute or chronic rejection or inflammatory or autoimmune disorders, or to induce tolerance.
- calcineurin inhibitor e.g. cyclosporin A or FK506
- an immunosuppressive macrolide e.g. rapamycine or a derivative thereof; e.g. 40-O-(2-hydroxy)ethyl-rapamycin
- a lymphocyte homing agent e.g.
- immunosuppressive monoclonal antibodies e.g., monoclonal antibodies to leukocyte receptors, e.g., MHC, CD2, CD3, CD4, CD 1 la/CD18, CD7, CD25, CD 27, B7, CD40, CD
- CTLA4-Ig (abatacept, ORENCIA® or belatacept), CD28-Ig, B7-H4-Ig, or other costimulatory agents, or adhesion molecule inhibitors, e.g. mAbs or low molecular weight inhibitors including LFA-1 antagonists, Selectin antagonists and VLA-4 antagonists.
- the therapeutic agents and/or a pharmaceutical composition comprising same are administered in conjunction with other immunosuppressive/immunomodulatory or anti-inflammatory therapy, e.g. as herein above specified
- dosages of the co-administered immunosuppressant, immunomodulatory or anti-inflammatory compound will of course vary depending on the type of co-drug employed, e.g. whether it is a steroid or a cyclosporin, on the specific drug employed, on the condition being treated and so forth.
- the therapeutic agents and/or a pharmaceutical composition comprising same, as recited herein, can be administered in combination with one or more additional therapeutic agents used for treatment of bacterial infections, including, but not limited to, antibiotics including
- Aminoglycosides Carbapenems, Cephalosporins, Macrolides, Lincosamides, Nitrofurans, penicillins, Polypeptides, Quinolones, Sulfonamides, Tetracyclines, drugs against mycobacteria including but not limited to Clofazimine, Cycloserine, Cycloserine, Rifabutin, Rifapentine, Streptomycin and other antibacterial drugs such as Chloramphenicol, Fosfomycin, Metronidazole, Mupirocin, and Tinidazole.
- the therapeutic agents and/or a pharmaceutical composition comprising same, as recited herein, can be administered in combination with one or more additional therapeutic agents used for treatment of viral infections, including, but not limited to, antiviral drugs such as oseltamivir (brand name Tamiflu) and zanamivir (brand name Relenza) Arbidol—adamantane derivatives (Amantadine, Rimantadine)—neuraminidase inhibitors (Oseltamivir, Laninamivir, Peramivir, Zanamivir) nucleotide analog reverse transcriptase inhibitor including Purine analogue guanine (Aciclovir#/Valacyclovir, Ganciclovir/Valganciclovir, Penciclovir/Famciclovir) and adenine (Vidarabine), Pyrimidine analogue, uridine (Idoxuridine, Trifluridine, Edoxudine), thymine (Brivudine), cytosine (
- the therapeutic agents and/or a pharmaceutical composition comprising same, as recited herein, can be administered in combination with one or more additional therapeutic agents used for treatment of fungal infections, including, but not limited to, antifungal drugs of the Polyene antifungals, Imidazole, triazole, and thiazole antifungals, Allylamines, Echinocandins or other anti fungal drugs.
- additional therapeutic agents used for treatment of fungal infections including, but not limited to, antifungal drugs of the Polyene antifungals, Imidazole, triazole, and thiazole antifungals, Allylamines, Echinocandins or other anti fungal drugs.
- an upregulating method may optionally be effected by specifically upregulating the amount (optionally expression) in the subject of at least one of the polypeptides of the present invention or active portions thereof.
- biomolecular sequences of this aspect of the present invention may be used as valuable therapeutic tools in the treatment of diseases, disorders or conditions in which altered activity or expression of the wild-type gene product (known protein) is known to contribute to disease, disorder or condition onset or progression.
- a soluble variant thereof may be used as an antagonist which competes with the receptor for binding the ligand, to thereby terminate signaling from the receptor.
- immune cells preferably T cells
- T cells can be contacted in vivo or ex vivo with the therapeutic agents to modulate immune responses.
- the T cells contacted with the therapeutic agents can be any cell which expresses the T cell receptor, including ⁇ / ⁇ and ⁇ / ⁇ T cell receptors.
- T-cells include all cells which express CD3, including T-cell subsets which also express CD4 and CDS.
- T-cells include both naive and memory cells and effector cells such as CTL.
- T-cells also include cells such as Th1, Tc1, Th2, Tc2, Th3, Th17, Th22, Treg, and Tr1 cells.
- T-cells also include NKT-cells and similar unique classes of the T-cell lineage.
- the additional therapeutic agent functions to inhibit or reduce T cell activation through a separate pathway.
- the additional therapeutic agent is a CTL A-4 fusion protein, such as CTLA-4-Ig (abatacept).
- CTLA-4-Ig fusion proteins compete with the co-stimulatory receptor, CD28, on T cells for binding to CD80/CD86 (B7-1/B7-2) on antigen presenting cells, and thus function to inhibit T cell activation.
- the additional therapeutic agent is a CTLA-4-Ig fusion protein known as belatacept. Belatacept contains two amino acid substitutions (L104E and A29Y) that markedly increase its avidity to CD86 in vivo.
- the additional therapeutic agent is Maxy-4.
- the second therapeutic agent is cyclophosphamide (CTX).
- Cyclophosphamide (the generic name for Endoxan®, Cytoxan®, Neosar®, Procytox®, RevimmuneTM), also known as cytophosphane, is a nitrogen mustard alkylating agent from the oxazophorines group. It is used to treat various types of cancer and some autoimmune disorders.
- IgC1ORF32 polypeptides, fragments or fusion proteins thereof and CTX are coadministered in effective amount to prevent or treat a chronic autoimmune disease or disorder such as Systemic lupus erythematosus (SLE).
- SLE Systemic lupus erythematosus
- Cyclophosphamide is the primary drug used for diffuse proliferative glomerulonephritis in patients with renal lupus.
- the combination therapy is administered in an effective amount to reduce the blood or serum levels of anti-double stranded DNA (anti-ds DNA) auto antibodies and/or to reduce proteinuria in a patient in need thereof.
- anti-ds DNA anti-double stranded DNA
- the second therapeutic is Tysabri or another therapeutic for MS.
- IgC1ORF32 polypeptides, fragments or fusion proteins thereof is cycled with Tysabri or used during a drug holiday in order to allow less frequent dosing with the second therapeutic and reduce the risk of side effects such as PML and to prevent resistance to the second therapeutic.
- the second therapeutic agent preferentially treats chronic inflammation, whereby the treatment regimen targets both acute and chronic inflammation.
- the second therapeutic is a TNF-alpha blocker.
- the second therapeutic agent is a small molecule that inhibits or reduces differentiation, proliferation, activity, and/or cytokine production and/or secretion by Th1, Th17, Th22, and/or other cells that secrete, or cause other cells to secrete, inflammatory molecules, including, but not limited to, IL-1beta, TNF-alpha, TGF-beta, IFN-gamma, IL-17, IL-6, IL-23, IL-22, IL-21, and MMPs.
- inflammatory molecules including, but not limited to, IL-1beta, TNF-alpha, TGF-beta, IFN-gamma, IL-17, IL-6, IL-23, IL-22, IL-21, and MMPs.
- the second therapeutic agent is a small molecule that interacts with Tregs, enhances Treg activity, promotes or enhances IL-10 secretion by Tregs, increases the number of Tregs, increases the suppressive capacity of Tregs, or combinations thereof.
- small molecules are organic molecules, preferably small organic compounds having a molecular weight of more than 100 and less than about 2,500 daltons, more preferably between 100 and 2000, more preferably between about 100 and about 1250, more preferably between about 100 and about 1000, more preferably between about 100 and about 750, more preferably between about 200 and about 500 daltons.
- Small molecules comprise functional groups necessary for structural interaction with proteins, particularly hydrogen bonding, and typically include at least an amine, carbonyl, hydroxyl or carboxyl group, preferably at least two of the functional chemical groups.
- the small molecules often comprise cyclical carbon or heterocyclic structures andlor aromatic or polyaromatic structures substituted with one or more of the above functional groups.
- Small molecules also include biomolecules including peptides, saccharides, fatty acids, steroids, purines, pyrimidines, derivatives, structural analogs or combinations thereof.
- the small molecule is retinoic acid or a derivative thereof.
- the examples below demonstrate that retinoic acid inhibits or reduces differentiation and/or activity of ThI 7 cells.
- the compositions are used in combination or succession with compounds that increase Treg activity or production.
- Exemplary Treg enhancing agents include but are not limited to glucocorticoid fluticasone, salmeteroal, antibodies to IL-12, IFN-gamma, and IL-4; vitamin D3, and dexamethasone, and combinations thereof.
- Antibodies to other proinflammatory molecules can also be used in combination or alternation with the disclosed C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof.
- Preferred antibodies bind to IL-6, IL-23, IL-22 or IL-21.
- rapamycin compound includes the neutral tricyclic compound rapamycin, rapamycin derivatives, rapamycin analogs, and other macrolide compounds which are thought to have the same mechanism of action as rapamycin (e.g., inhibition of cytokine function).
- rapamycin compounds includes compounds with structural similarity to rapamycin, e.g., compounds with a similar macrocyclic structure, which have been modified to enhance their therapeutic effectiveness. Exemplary Rapamycin compounds are known in the art.
- FK506-Hke compounds includes FK506, and FK506 derivatives and analogs, e.g., compounds with structural similarity to FK506, e.g., compounds with a similar macrocyclic structure which have been modified to enhance their therapeutic effectiveness.
- FK506-like compounds include, for example, those described in WO 00101385.
- rapamycin compound as used herein does not include FK506-like compounds.
- anti-inflammatory agents include, but are not limited to, anti-inflammatory agents.
- the anti-inflammatory agent can be non-steroidal, steroidal, or a combination thereof.
- One embodiment provides oral compositions containing about 1% (w/w) to about 5% (w/w), typically about 2.5 (w/w) or an anti-inflammatory agent.
- non-steroidal anti-inflammatory agents include, without limitation, oxicams, such as piroxicam, isoxicam, tenoxicam, sudoxicam; salicylates, such as aspirin, disalcid, benorylate, trilisate, safapryn, solprin, diflunisal, and fendosal; acetic acid derivatives, such as diclofenac, fenclofenac, indomethacin, sulindac, tolmetin, isoxepac, furofenac, tiopinac, zidometacin, acematacin, fentiazac, zomepirac, clmdanac, oxepinac, felbmac, and ketorolac; fenamates, such as mefenamic, meclofenamic, flufenamic, niflumic, and tolfenamic acids; propionic acid derivatives, such as
- steroidal anti-inflammatory drugs include, without limitation, corticosteroids such as hydrocortisone, hydroxyl-triamcinolone, alpha-methyl dexamethasone, dexamethasone-phosphate, beclomethasone dipropionates, clobetasol valerate, desonide, desoxymethasone, desoxycorticosterone acetate, dexamethasone, dichlorisone, diflorasone diacetate, diflucortolone valerate, fluadrenolone, fluclorolone acetonide, fludrocortisone, flumethasone pivalate, fiuosinolone acetonide, fluocinonide, flucortine butylesters, fluocortolone, fluprednidene (fluprednylidene) acetate, flurandrenolone, halcinonide, hydrocortisone acetate, hydrocortisone butyrate
- immune cells preferably T cells
- C1ORF32 fusion polypeptides can be contacted in vivo or ex vivo with C1ORF32 fusion polypeptides to decrease or inhibit immune responses including, but not limited to inflammation.
- immune cells preferably T cells
- C1ORF32 fusion polypeptides can be contacted in vivo or ex vivo with C1ORF32 fusion polypeptides to decrease or inhibit T cell exhaustion, optionally in combination with another therapeutic agent.
- the costimulatory pathway is modulated to achieve a desired immune system balance.
- the T cells contacted with C1ORF32 fusion polypeptides can be any cell which expresses the T cell receptor, including ⁇ / ⁇ and ⁇ / ⁇ T cell receptors.
- T-cells include all cells which express CD3, including T-cell subsets which also express CD4 and CDS.
- T-cells include both naive and memory cells and effector cells such as CTL.
- T-cells also include cells such as Th1, Tc1, Th2, Tc2, Th3, Th17, Th22, Treg, and Trl cells.
- T-cells also include NKT-cells and similar unique classes of the T-cell lineage.
- compositions can be used to modulate Th1, Th17, Th22, or other cells that secrete, or cause other cells to secrete, inflammatory molecules, including, but not limited to, IL-1beta, TNF-alpha, TGF-beta, IFN-gamma, IL-17, IL-6, IL-23, IL-22, IL-21, and MMPs.
- the compositions can also be used to increase or promote the activity of Tregs, increase the production of cytokines such as IL-10 from Tregs, increase the differentiation of Tregs, increase the number of Tregs, or increase the survival of Tregs.
- compositions can also be used to increase or promote the activity of Th2 cells, increase the production of cytokines such as IL-10 or IL-4 from Th2 cells, increase the differentiation of Th2 cells, increase the number of Th2 cells, or increase the survival of Th2 cells.
- cytokines such as IL-10 or IL-4
- treatment of T cell exhaustion encompasses the modulation of cytokine secretion, or other cells that secrete, or cause other cells to secrete, inflammatory molecules, including, but not limited to, IL-2, TNF-alpha, IFN-gamma, 15 Granzyme B and MMPs or modulate the expression of molecues of the costimulatory/coinhibtory-family including, but not limited to PD-1, Tim3, CTLA4 and LAGS.
- the disclosed C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof, are administered in combination with a second therapeutic.
- Combination therapies may be useful in immune modulation.
- C1ORF32 polypeptide, selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof can be used to attenuate or reverse the activity of a pro-inflammatory drug, and/or limit the adverse effects of such drugs.
- C1ORF32 compositions can be used to modulate the production of antibodies by B cells by contacting the B cells with an effective amount of the C1ORF32 composition to inhibit or reduce antibody production by the B cell relative to a control.
- the C1ORF32 compositions can also modulate the production of cytokines by the B cells.
- the C1ORF32 polypeptides, fragments or fusion proteins thereof, selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof, according to at least some embodiments of the present invention are potentially used for therapy of diseases that require down-regulation of costimulatory pathways and or such that require downregulation of Th1 and/or Th17 responses.
- a further embodiment provides methods for treating or alleviating one or more symptoms of inflammation.
- the compositions and methods disclosed are useful for treating chronic and persistent inflammation. Inflammation in general can be treated using the disclosed C1ORF32 polypeptides or fragment or fusions thereof.
- An immune response including inflammation can be inhibited or reduced in a subject, preferably a human, by administering an effective amount of C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof, to inhibit or reduce the biological activity of an immune cell or to reduce the amounts of proinflammatory molecules at a site of inflammation.
- exemplary proinflammatory molecules include, but are not limited to, IL-1beta, TNF-alpha, TGF-beta, IFN-gamma, IL-17, IL-6, IL-23, IL-22, IL-21, and MMPs.
- Th1 and Th17 are exemplary T cells that can be targeted for inhibition by C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof, to inhibit or reduce inflammation.
- the C1ORF32 polypeptides, fragments or fusion proteins thereof are useful for treating inflammation by any or all of the following: inhibiting or reducing differentiation of Th1, Thl7, Th22, and/or other cells that secrete, or cause other cells to secrete, inflammatory molecules, including, but not limited to, IL-1beta, TNF-alpha, TGF-beta, IFN-gamma, IL-17, IL-6, IL-23, IL-22, IL-21, and MMPs; inhibiting or reducing activity of ThI, Th 17, Th22, and/or other cells that secrete, or cause other cells to secrete, inflammatory molecules, including, but not limited to, IL-1beta, TNF-alpha, TGF-beta, IFN-gamma, IL-17, IL-6, IL-23, IL-22, IL-21, and MMPs; inhibiting or reducing the Th1, Thl7, Th22, and/or other cells that secrete, or cause other cells to secret
- C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof can also enhance Th2 immune responses.
- C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof can also act directly on Th2 cells to promote or enhance production of IL-4, IL-5 or IL-10, or to increase the number of Th2 cells, resulting in inhibition of Th1 and/or Th17, and in immune modulation via a Th1/Th2 shift.
- C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof can cause Tregs to have an enhanced suppressive effect on an immune response.
- Tregs can suppress differentiation, proliferation, activity, and/or cytokine production and/or secretion by Th1, Th17, Th22, and/or other cells that secrete, or cause other cells to secrete, inflammatory molecules, including, but not limited to, IL-1beta, TNF-alpha, TGF-beta, IFN-gamma, IL-17, IL-6, IL-23, IL-22, IL-21, and MMPs.
- C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof can cause Tregs to have an enhanced suppressive effect on Th1 and/or Th17 cells to reduce the level of IFN-gamma and IL-17 produced, respectively.
- C1ORF32polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof can also act directly on Tregs to promote or enhance production of IL-10 to suppress the Th1 and/or Th17 pathway, and/or to increase the number of Tregs.
- C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof can cause Th2 to have an enhanced modulatory effect on an immune response.
- Th2 cells can modulate differentiation, proliferation, activity, and/or cytokine production and/or secretion by Th1, Th17, Th22, and/or other cells that secrete, or cause other cells to secrete, inflammatory molecules, including, but not limited to, IL-1beta, TNF-alpha, TGF-beta, IFN-gamma, IL-17, IL-6, IL-23, IL-22, IL-21, and MMPs.
- C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof can cause Th2 cells to have an enhanced modulatory effect on Th1 and/or Th17 cells to reduce the level of IFN-gamma and IL-17 produced, respectively.
- C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof can also act directly on Th2 cells to promote or enhance production of IL-10 to suppress the Th1 and/or Th17 pathway, and/or to increase the number of Th2 cells.
- C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof acts at multiple points in multiple T cell pathways.
- polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof can inhibit the differentiation of naive T cells into either Th1 or Th17 cells.
- polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof can interact with Th1 cells or Th17 cells, or both to inhibit or reduce the production of proinflammatory molecules.
- C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof may increase the differentiation of and/or promote Th2 responses resulting in an immunomdulatory effect on the Th1 and/or Th17 pathways to reduce the level of INF-gamma and/or IL-17 produced.
- C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof enhances the production of IL-10 from cells such as Th2 and/or Tregs, which in turn inhibits the activity of Th1 and/or Th17 cells.
- C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof can affect Tregs to have an enhanced suppressive effect on Th1 and/or Th17 pathways to reduce the level of INF-gamma and/or IL-17 produced. Additionally, C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof can enhance the production of IL-10 which inhibits the activity of Th1 and/or Th17 cells.
- One method for inhibiting or reducing inflammation includes administering an effective amount of a C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof to inhibit Th1 development in a subject in need thereof.
- Inflammation can be inhibited or reduced by blocking naive T cells from differentiating into Th1 cells by administering C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof.
- the C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof may inhibit or reduce proliferation of Th1 cells.
- C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof may also reduce naive T cells from differentiating into Th1 cells, by blocking antigen presenting cell maturation.
- C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof increase the differentiation of Th2 cells and thereby reduce the number of Th1 cells in a subject.
- the amount of proinflammatory molecules such as INF-gamma can be reduced or contained.
- INF-gamma stimulates the production or release of other proinflammatory molecules including IL-1beta, TNF-alpha, and MMPs.
- the levels of these other proinflammatory molecules can be controlled, thereby reducing inflammatory responses.
- Another embodiment provides a method of inhibiting or reducing inflammation in a subject by administering to the subject an effective amount of a C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof to inhibit or reduce production of proinflammatory molecules by Th1 cells.
- a C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof to inhibit or reduce production of proinflammatory molecules by Th1 cells.
- Exemplary proinflammatory molecules produced by Th1 cells includes IFN-gamma.
- the C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof can interact directly with the Th1 cell and inhibit or reduce IFN-gamma production by the Th1 cells.
- the amount of proinflammatory molecules is regulated rather than the population of Th1 cells.
- Inflammation can also be inhibited or reduced in a subject by administering an effective amount of a C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof, to inhibit or block naive T cells from developing into Th17 cells.
- the C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof increases the suppressive activity of Tregs on the differentiation of naive T cells into Th17 cells by an amount sufficient to reduce the number of Th17 cells in a subject.
- the C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof inhibits or reduces proliferation of Th17 cells.
- C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof may also reduce naive T cells from differentiating into Th17 cells, by blocking antigen presenting cell maturation. By reducing the population of Th17 cells in a subject, the amount of IL-17 can be reduced, as well as IL-22 and IL-21.
- IL-17 is a proinflammatory cytokine that causes increases in other proinflammatory molecules such as IL-1beta, TNF-alpha, and MMPs. Thus, by reducing the amount of IL-17 these other proinflammatory molecules can be reduced, thereby reducing or inhibiting inflammation.
- Still another embodiment provides a method for treating inflammation in a subject by administering an effective amount of C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof, to inhibit production of IL-17 by Th17 cells, as well as IL-22 and IL-21.
- the C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof can act directly on Th17 cells, for example by binding to Th17 cells resulting in inhibition of IL-17 (or IL-22 and IL-21) production by those Th17 cells.
- inhibition or reduction of IL-17 (and IL-22 or IL-21) leads to the reduction of other proinflammatory molecules, thereby reducing or inhibitng inflammation.
- the disclosed C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof can be used to inhibit both the Th1 and Th17 pathways simultaneously.
- Using one anti-inflammatory agent to inhibit two separate pathways provides more robust inhibition or reduction of the immune response.
- Inflammation can also be treated by administering C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof thereof to a subject in an amount effective to enhance Th2 responses, and the suppressive activity of IL-10 producing cells, and to enhance suppressive or modulatory activity on the Th1 and/or Th17 pathways.
- the disclosed C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof cause an increased suppressive effect on IFN-gamma and/or IL-17 production.
- Another embodiment provides a method for treating inflammation by administering an effective amount of C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof to increase production of IL-10 by Th2, Tregs or other immune cells.
- the C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof can interact directly with with immune cells to increase IL-10 production.
- Still another embodiment provides a method for treating inflammation by administering an effective amount of C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof to inhibit or interfere with the Th1 pathway and Th17 pathway, and to enhance the suppressive effect on the Th1 and/or Th17 pathways by Th2 cells.
- C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof to inhibit or interfere with the Th1 pathway and Th17 pathway, and to enhance the suppressive effect on the Th1 and/or Th17 pathways by Th2 cells.
- the C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof can also be administered to a subject in an amount effective to increase Th2 cell populations or numbers.
- IL-10 production can be increased relative to a control by contacting Th2 cells, Tregs or other immune cells with an effective amount of C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof having C1ORF32 activity.
- the increase can occur in vitro or in vivo.
- Representative inflammatory or autoimmune diseases and disorders that may be treated using C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof include, but are not limited to multiple sclerosis, rheumatoid arthritis, type I diabetes, psoriasis, systemic lupus erythematosus, inflammatory bowel disease, uveitis, and Sjogren's syndrome.
- C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof acts at multiple points in the inflammatory pathway master regulator to control the expression and/or activity of effectory cytokines such as IFN-gamma and TNF-alpha. Therefore, the C1ORF32 compositions described herein are particularly useful for treating patients that do not respond to TNF-alpha blockers such as Enbrel, Remicade, Cimzia and Humira, or where TNF-alpha blockers are not safe or effective. In addition, because of its activity as a master regulator in the inflammatory pathway, the C1ORF32 compositions disclosed are particularly useful for treating chronic and persistent inflammation.
- the C1ORF32 compositions described herein are used to treat relapsing and/or remitting multiple sclerosis.
- Epitope spreading refers to the ability of B and T cell immune response to diversify both at the level of specificity, from a single determinant to many sites on an auto antigen, and at the level of V gene usage (Monneaux, F. et al., Arthritis & Rheumatism, 46(6): 1430-1438 (2002). Epitope spreading is not restricted to systemic autoimmune disease. It has been described in T cell dependent organ specific diseases such as Diabetes mellitus type 1 and multiple sclerosis in humans, and EAE induced experimental animals with a variety of myelin proteins.
- Epitope spreading involves the acquired recognition of new epitopes in the same self molecule as well as epitopes residing in proteins that are associated in the same macromolecular complex. Epitope spreading can be assessed by measuring delayed-type hypersensitivity (DTH) responses, methods of which are known in the art.
- DTH delayed-type hypersensitivity
- One embodiment provides a method for inhibiting or reducing epitope spreading in a subject by administering to the subject an effective amount of C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof.
- the C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof inhibits epitope spreading in individuals with multiple sclerosis.
- the C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof inhibits or blocks multiple points of the inflammation pathway.
- Yet another embodiment provides a method for inhibiting or reducing epitope spreading in subjects with multiple sclerosis by administering to a subject an effective amount of C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof to inhibit or reduce differentiation of, proliferation of, activity of, and/or cytokine production and/or secretion by Th1, Th17, Th22, and/or other cells that secrete, or cause other cells to secrete, inflammatory molecules, including, but not limited to, IL-1beta, TNF-alpha, TGF-beta, IFN-gamma, IL-17, IL-6, IL-23, IL-22, IL-21, and MMPs.
- C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof
- Another embodiment provides a method for treating multiple sclerosis by administering to a subject an effective amount of C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof thereof to interact with Tregs, enhance Treg activity, promote or enhances IL-10 secretion by Tregs, increase the number of Tregs, increase the suppressive capacity of Tregs, or combinations thereof.
- Another embodiment provides a method for treating multiple sclerosis by administering to a subject an effective amount of C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof to interact with Th2 cells, enhance Th2 activity, promote or enhance IL-10 secretion by Th2 cells, increase the number of Th2 cells, increase the modulatory capacity of Th2 cells, or combinations thereof.
- C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof to interact with Th2 cells, enhance Th2 activity, promote or enhance IL-10 secretion by Th2 cells, increase the number of Th2 cells, increase the modulatory capacity of Th2 cells, or combinations thereof.
- the present invention provides a method for inducing or re-establishing immune tolerance in a subject by administering to the subject an effective amount of C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof.
- the C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof induces tolerance in individuals with immune related diseases.
- the C1ORF32 polypeptide, fragment or fusion protein thereof induces tolerance in individuals with multiple sclerosis or any other immune related disease as described herein.
- the C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof inhibits or blocks multiple points of the inflammation pathway.
- the C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof induces tolerance in individuals with rheumatoid arthritis.
- Another embodiment provides a method for treating immune related diseases by administering to a subject an effective amount of C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof to induce immune tolerance by interacting with Tregs, enhancing Treg activity, increasing the number of Tregs, increase the suppressive capacity of Tregs, or combinations thereof.
- Another embodiment provides a method for treating immune related diseases by administering to a subject an effective amount of C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof to promote or enhance IL-10 secretion by immune cells.
- Therapeutic agents according to at least some embodiments of the invention are used for_for adoptive immunotherapy.
- the invention provides methods for in vivo or ex vivo tolerance induction, comprising administering effective amount of the therapeutic agent according to at least some embodiments, to a patient or to leukocytes isolated from the patient, in order to induce differentiation of tolerogenic regulatory cells; followed by ex-vivo enrichment and expansion of said cells and reinfusion of the tolerogenic regulatory cells to said patient.
- immune responses can be enhanced in a patient by removing immune cells from the patient, contacting immune cells in vitro with an agent that inhibits C1ORF32 activity, and/or which inhibits the interaction of C1ORF32 with its natural binding partners, and reintroducing the in vitro stimulated immune cells into the patient.
- a method of modulating immune responses involves isolating immune cells from a patient, transfecting them with a nucleic acid molecule encoding a form of C1ORF32, such that the cells express all or a portion of the C1ORF32 polypeptide according to various embodiments of the present invention on their surface, and reintroducing the transfected cells into the patient.
- the transfected cells have the capacity to modulate immune responses in the patient.
- the present invention features a pharmaceutical composition comprising a therapeutically effective amount of a therapeutic agent according to the present invention.
- the therapeutic agent could be any one of soluble C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof or a corresponding nucleic acid sequence encoding.
- the pharmaceutical composition according to the present invention is further used for the treatment of immune related disorder and/or infection as described herein.
- the therapeutic agents of the present invention can be provided to the subject alone, or as part of a pharmaceutical composition where they are mixed with a pharmaceutically acceptable carrier.
- “pharmaceutically acceptable carrier” includes any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible.
- the carrier is suitable for intravenous, intramuscular, subcutaneous, parenteral, spinal or epidermal administration (e.g., by injection or infusion).
- the active compound i.e., soluble C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof or a corresponding nucleic acid sequence encoding.
- the pharmaceutical compounds according to at least some embodiments of the present invention may include one or more pharmaceutically acceptable salts.
- a “pharmaceutically acceptable salt” refers to a salt that retains the desired biological activity of the parent compound and does not impart any undesired toxicological effects (see e.g., Berge, S. M., et al. (1977) J. Pharm. Sci. 66: 1-19). Examples of such salts include acid addition salts and base addition salts.
- Acid addition salts include those derived from nontoxic inorganic acids, such as hydrochloric, nitric, phosphoric, sulfuric, hydrobromic, hydroiodic, phosphorous and the like, as well as from nontoxic organic acids such as aliphatic mono- and dicarboxylic acids, phenyl-substituted alkanoic acids, hydroxy alkanoic acids, aromatic acids, aliphatic and aromatic sulfonic acids and the like.
- nontoxic inorganic acids such as hydrochloric, nitric, phosphoric, sulfuric, hydrobromic, hydroiodic, phosphorous and the like
- nontoxic organic acids such as aliphatic mono- and dicarboxylic acids, phenyl-substituted alkanoic acids, hydroxy alkanoic acids, aromatic acids, aliphatic and aromatic sulfonic acids and the like.
- Base addition salts include those derived from alkaline earth metals, such as sodium, potassium, magnesium, calcium and the like, as well as from nontoxic organic amines, such as N,N′-dibenzylethylenediamine, N-methylglucamine, chloroprocaine, choline, diethanolamine, ethylenediamine, procaine and the like.
- a pharmaceutical composition according to at least some embodiments of the present invention also may include one or more pharmaceutically acceptable anti-oxidants.
- pharmaceutically acceptable antioxidants include: (1) water soluble antioxidants, such as ascorbic acid, cysteine hydrochloride, sodium bisulfate, sodium metabisulfite, sodium sulfite and the like; (2) oil-soluble antioxidants, such as ascorbyl palmitate, butylated hydroxyanisole (BHA), butylated hydroxytoluene (BHT), lecithin, propyl gallate, alpha-tocopherol, and the like; and (3) metal chelating agents, such as citric acid, ethylenediamine tetraacetic acid (EDTA), sorbitol, tartaric acid, phosphoric acid, and the like.
- water soluble antioxidants such as ascorbic acid, cysteine hydrochloride, sodium bisulfate, sodium metabisulfite, sodium sulfite and the like
- oil-soluble antioxidants such as ascorby
- a pharmaceutical composition according to at least some embodiments of the present invention also may include additives such as detergents and solubilizing agents (e.g., TWEEN 20 (polysorbate-20), TWEEN 80 (polysorbate-80)) and preservatives (e.g., Thimersol, benzyl alcohol) and bulking substances (e.g., lactose, mannitol).
- additives such as detergents and solubilizing agents (e.g., TWEEN 20 (polysorbate-20), TWEEN 80 (polysorbate-80)) and preservatives (e.g., Thimersol, benzyl alcohol) and bulking substances (e.g., lactose, mannitol).
- aqueous and nonaqueous carriers examples include water, buffered saline of various buffer content (e.g., Tris-HCl, acetate, phosphate), pH and ionic strength, ethanol, polyols (such as glycerol, propylene glycol, polyethylene glycol, and the like), and suitable mixtures thereof, vegetable oils, such as olive oil, and injectable organic esters, such as ethyl oleate.
- Proper fluidity can be maintained, for example, by the use of coating materials, such as lecithin, by the maintenance of the required particle size in the case of dispersions, and by the use of surfactants.
- compositions may also contain adjuvants such as preservatives, wetting agents, emulsifying agents and dispersing agents. Prevention of presence of microorganisms may be ensured both by sterilization procedures, supra, and by the inclusion of various antibacterial and antifungal agents, for example, paraben, chlorobutanol, phenol sorbic acid, and the like. It may also be desirable to include isotonic agents, such as sugars, sodium chloride, and the like into the compositions. In addition, prolonged absorption of the injectable pharmaceutical form may be brought about by the inclusion of agents which delay absorption such as aluminum monostearate and gelatin.
- Pharmaceutically acceptable carriers include sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion.
- the use of such media and agents for pharmaceutically active substances is known in the art. Except insofar as any conventional media or agent is incompatible with the active compound, use thereof in the pharmaceutical compositions according to at least some embodiments of the present invention is contemplated. Supplementary active compounds can also be incorporated into the compositions.
- compositions typically must be sterile and stable under the conditions of manufacture and storage.
- the composition can be formulated as a solution, microemulsion, liposome, or other ordered structure suitable to high drug concentration.
- the carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), and suitable mixtures thereof.
- the proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants.
- isotonic agents for example, sugars, polyalcohols such as mannitol, sorbitol, or sodium chloride in the composition.
- Prolonged absorption of the injectable compositions can be brought about by including in the composition an agent that delays absorption, for example, monostearate salts and gelatin.
- Sterile injectable solutions can be prepared by incorporating the active compound in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by sterilization microfiltration.
- dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above.
- the preferred methods of preparation are vacuum drying and freeze-drying (lyophilization) that yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
- Sterile injectable solutions can be prepared by incorporating the active compound in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by sterilization microfiltration.
- dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above.
- the preferred methods of preparation are vacuum drying and freeze-drying (lyophilization) that yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
- the amount of active ingredient which can be combined with a carrier material to produce a single dosage form will vary depending upon the subject being treated, and the particular mode of administration.
- the amount of active ingredient which can be combined with a carrier material to produce a single dosage form will generally be that amount of the composition which produces a therapeutic effect. Generally, out of one hundred per cent, this amount will range from about 0.01 per cent to about ninety-nine percent of active ingredient, preferably from about 0.1 per cent to about 70 per cent, most preferably from about I per cent to about 30 per cent of active ingredient in combination with a pharmaceutically acceptable carrier.
- Dosage regimens are adjusted to provide the optimum desired response (e.g., a therapeutic response). For example, a single bolus may be administered, several divided doses may be administered over time or the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation. It is especially advantageous to formulate parenteral compositions in dosage unit form for ease of administration and uniformity of dosage.
- Dosage unit form as used herein refers to physically discrete units suited as unitary dosages for the subjects to be treated; each unit contains a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier.
- a composition of the present invention can be administered via one or more routes of administration using one or more of a variety of methods known in the art.
- routes and/or mode of administration will vary depending upon the desired results.
- Preferred routes of administration for therapeutic agents according to at least some embodiments of the present invention include intravascular delivery (e.g. injection or infusion), intravenous, intramuscular, intradermal, intraperitoneal, subcutaneous, spinal, oral, enteral, rectal, pulmonary (e.g. inhalation), nasal, topical (including transdermal, buccal and sublingual), intravesical, intravitreal, intraperitoneal, vaginal, brain delivery (e.g.
- CNS delivery e.g. intrathecal, perispinal, and intra-spinal
- parenteral including subcutaneous, intramuscular, intraperitoneal, intravenous (IV) and intradermal
- transdermal either passively or using iontophoresis or electroporation
- transmucosal e.g., sublingual administration, nasal, vaginal, rectal, or sublingual
- administration or administration via an implant or other parenteral routes of administration, for example by injection or infusion, or other delivery routes and/or forms of administration known in the art.
- parenteral administration means modes of administration other than enteral and topical administration, usually by injection, and includes, without limitation, intravenous, intramuscular, intraarterial, intrathecal, intracapsular, intraorbital, intracardiac, intradermal, intraperitoneal, transtracheal, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal, epidural and intrastemal injection and infusion or using bioerodible inserts, and can be formulated in dosage forms appropriate for each route of administration.
- a protein, a therapeutic agent or a pharmaceutical composition according to at least some embodiments of the present invention can be administered intraperitoneally or intravenously.
- compositions of the present invention can be delivered to the lungs while inhaling and traverse across the lung epithelial lining to the blood stream when delivered either as an aerosol or spray dried particles having an aerodynamic diameter of less than about 5 microns.
- a wide range of mechanical devices designed for pulmonary delivery of therapeutic products can be used, including but not limited to nebulizers, metered dose inhalers, and powder inhalers, all of which are familiar to those skilled in the art.
- Some specific examples of commercially available devices are the Ultravent nebulizer (Mallinckrodt Inc., St.
- Nektar, Alkermes and Mannkind all have inhalable insulin powder preparations approved or in clinical trials where the technology could be applied to the formulations described herein.
- compositions disclosed herein are administered to a subject in a therapeutically effective amount.
- effective amount or “therapeutically effective amount” means a dosage sufficient to treat, inhibit, or alleviate one or more symptoms of the disorder being treated or to otherwise provide a desired pharmacologic and/or physiologic effect.
- the precise dosage will vary according to a variety of factors such as subject-dependent variables (e.g., age, immune system health, etc.), the disease, and the treatment being effected.
- polypeptide compositions disclosed herein and nucleic acids encoding the same as further studies are conducted, information will emerge regarding appropriate dosage levels for treatment of various conditions in various patients, and the ordinary skilled worker, considering the therapeutic context, age, and general health of the recipient, will be able to ascertain proper dosing.
- the selected dosage depends upon the desired therapeutic effect, on the route of administration, and on the duration of the treatment desired.
- dosage levels of 0.0001 to 100 mg/kg of body weight daily are administered to mammals and more usually 0.001 to 20 mg/kg.
- dosages can be 0.3 mg/kg body weight, 1 mg/kg body weight, 3 mg/kg body weight, 5 mg/kg body weight or 10 mg/kg body weight or within the range of 1-10 mg/kg.
- An exemplary treatment regime entails administration once per week, once every two weeks, once every three weeks, once every four weeks, once a month, once every 3 months or once every three to 6 months.
- dosage may be lower.
- Dosage regimens are adjusted to provide the optimum desired response (e.g., a therapeutic response). For example, a single bolus may be administered, several divided doses may be administered over time or the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation. It is especially advantageous to formulate parenteral compositions in dosage unit form for ease of administration and uniformity of dosage.
- Dosage unit form refers to physically discrete units suited as unitary dosages for the subjects to be treated; each unit contains a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier.
- the specification for the dosage unit forms according to at least some embodiments of the present invention are dictated by and directly dependent on (a) the unique characteristics of the active compound and the particular therapeutic effect to be achieved, and (b) the limitations inherent in the art of compounding such an active compound for the treatment of sensitivity in individuals.
- the polypeptide formulation may be administered in an amount between 0.0001 to 100 mg/kg weight of the patient/day, preferably between 0.001 to 20.0 mg/kg/day, according to any suitable timing regimen.
- a therapeutic composition according to at least some embodiments according to at least some embodiments of the present invention can be administered, for example, three times a day, twice a day, once a day, three times weekly, twice weekly or once weekly, once every two weeks or 3, 4, 5, 6, 7 or 8 weeks.
- the composition can be administered over a short or long period of time (e.g., 1 week, 1 month, 1 year, 5 years).
- therapeutic agent can be administered as a sustained release formulation, in which case less frequent administration is required. Dosage and frequency vary depending on the half-life of the therapeutic agent in the patient. In general, the half-life for fusion proteins may vary widely.
- the dosage and frequency of administration can vary depending on whether the treatment is prophylactic or therapeutic. In prophylactic applications, a relatively low dosage is administered at relatively infrequent intervals over a long period of time. Some patients continue to receive treatment for the rest of their lives. In therapeutic applications, a relatively high dosage at relatively short intervals is sometimes required until progression of the disease is reduced or terminated, and preferably until the patient shows partial or complete amelioration of symptoms of disease. Thereafter, the patient can be administered a prophylactic regime.
- Actual dosage levels of the active ingredients in the pharmaceutical compositions of the present invention may be varied so as to obtain an amount of the active ingredient which is effective to achieve the desired therapeutic response for a particular patient, composition, and mode of administration, without being toxic to the patient.
- the selected dosage level will depend upon a variety of pharmacokinetic factors including the activity of the particular compositions of the present invention employed, the route of administration, the time of administration, the rate of excretion of the particular compound being employed, the duration of the treatment, other drugs, compounds and/or materials used in combination with the particular compositions employed, the age, sex, weight, condition, general health and prior medical history of the patient being treated, and like factors well known in the medical arts.
- the polypeptide compositions are administered locally, for example by injection directly into a site to be treated.
- the injection causes an increased localized concentration of the polypeptide compositions which is greater than that which can be achieved by systemic administration.
- the protein may be administered locally to a site near the CNS.
- an arthritic disorder like Rheumatoid Arthritis
- the protein may be administered locally to the synovium in the affected joint.
- the polypeptide compositions can be combined with a matrix as described above to assist in creating a increased localized concentration of the polypeptide compositions by reducing the passive diffusion of the polypeptides out of the site to be treated.
- compositions of the present invention may be administered with medical devices known in the art.
- a pharmaceutical composition according to at least some embodiments of the present invention can be administered with a needles hypodermic injection device, such as the devices disclosed in U.S. Pat. Nos. 5,399,163; 5,383,851; 5,312,335; 5,064,413; 4,941,880; 4,790,824; or 4,596,556.
- a needles hypodermic injection device such as the devices disclosed in U.S. Pat. Nos. 5,399,163; 5,383,851; 5,312,335; 5,064,413; 4,941,880; 4,790,824; or 4,596,556.
- Examples of well-known implants and modules useful in the present invention include: U.S. Pat. No. 4,487,603, which discloses an implantable micro-infusion pump for dispensing medication at a controlled rate; U.S. Pat. No.
- the active compounds can be prepared with carriers that will protect the compound against rapid release, such as a controlled release formulation, including implants, transdermal patches, and microencapsulated delivery systems.
- a controlled release formulation including implants, transdermal patches, and microencapsulated delivery systems.
- Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid. Many methods for the preparation of such formulations are patented or generally known to those skilled in the art. See, e.g., Sustained and Controlled Release Drug Delivery Systems, J. R. Robinson, ed., Marcel Dekker, Inc., New York, 1978.
- compositions can be administered with medical devices known in the art.
- a therapeutic composition according to at least some embodiments of the present invention can be administered with a needles hypodermic injection device, such as the devices disclosed in U.S. Pat. Nos. 5,399,163; 5,383,851; 5,312,335; 5,064,413; 4,941,880; 4,790,824; or 4,596,556.
- a needles hypodermic injection device such as the devices disclosed in U.S. Pat. Nos. 5,399,163; 5,383,851; 5,312,335; 5,064,413; 4,941,880; 4,790,824; or 4,596,556.
- Examples of well-known implants and modules useful in the present invention include: U.S. Pat. No. 4,487,603, which discloses an implantable micro-infusion pump for dispensing medication at a controlled rate; U.S. Pat. No.
- C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof according to at least some embodiments of the present invention can be formulated to ensure proper distribution in vivo.
- the blood-brain barrier excludes many highly hydrophilic compounds.
- the therapeutic compounds according to at least some embodiments of the present invention cross the BBB (if desired)
- they can be formulated, for example, in liposomes.
- liposomes see, e.g., U.S. Pat. Nos. 4,522,811; 5,374,548; and 5,399,331.
- the liposomes may comprise one or more moieties which are selectively transported into specific cells or organs, thus enhance targeted drug delivery (see, e.g., V. V. Ranade (1989) J. Clin. Pharmacol. 29:685).
- exemplary targeting moieties include folate or biotin (see, e.g., U.S. Pat. No. 5,416,016 to Low et al.); mannosides (Umezawa et al., (1988) Biochem. Biophys. Res. Commun. 153:1038); antibodies (P. G. Bloeman et al. (1995) FEBS Lett. 357:140; M. Owais et al. (1995) Antimicrob. Agents Chemother.
- compositions disclosed herein are administered in an aqueous solution, by parenteral injection.
- the formulation may also be in the form of a suspension or emulsion.
- pharmaceutical compositions are provided including effective amounts of a peptide or polypeptide, and optionally include pharmaceutically acceptable diluents, preservatives, solubilizers, emulsifiers, adjuvants and/or carriers.
- compositions optionally include one or more for the following: diluents, sterile water, buffered saline of various buffer content (e.g., Tris-HCl, acetate, phosphate), pH and ionic strength; and additives such as detergents and solubilizing agents (e.g., TWEEN 20 (polysorbate-20), TWEEN 80 (polysorbate-80)), anti-oxidants (e.g., water soluble antioxidants such as ascorbic acid, sodium metabisulfite, cysteine hydrochloride, sodium bisulfate, sodium metabisulfite, sodium sulfite; oil-soluble antioxidants, such as ascorbyl palmitate, butylated hydroxyanisole (BHA), butylated hydroxytoluene (BHT), lecithin, propyl gallate, alpha-tocopherol; and metal chelating agents, such as citric acid, ethylenediamine tetraacetic acid (EDTA), sorb
- non-aqueous solvents or vehicles examples include ethanol, propylene glycol, polyethylene glycol, vegetable oils, such as olive oil and corn oil, gelatin, and injectable organic esters such as ethyl oleate.
- the formulations may be freeze dried (lyophilized) or vacuum dried and redissolved/resuspended immediately before use.
- the formulation may be sterilized by, for example, filtration through a bacteria retaining filter, by incorporating sterilizing agents into the compositions, by irradiating the compositions, or by heating thecompositions.
- C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof, nucleic acids, and vectors disclosed herein can be applied topically.
- Topical administration does not work well for most peptide formulations, although it can be effective especially if applied to the lungs, nasal, oral (sublingual, buccal), vaginal, or rectal mucosa.
- Compositions can be delivered to the lungs while inhaling and traverse across the lung epithelial lining to the blood stream when delivered either as an aerosol or spray dried particles having an aerodynamic diameter of less than about 5 microns.
- nebulizers metered dose inhalers
- powder inhalers all of which are familiar to those skilled in the art.
- Some specific examples of commercially available devices are the Ultravent nebulizer (Mallinckrodt Inc., St. Louis, Mo.); the Acorn II nebulizer (Marquest Medical Products, Englewood, Colo.); the Ventolin metered dose inhaler (Glaxo Inc., Research Triangle Park, N.C.); and the Spinhaler powder inhaler (Fisons Corp., Bedford, Mass.). Nektar, Alkermes and Mannkind all have inhalable insulin powder preparations approved or in clinical trials where the technology could be applied to the formulations described herein.
- Formulations for administration to the mucosa will typically be spray dried drug particles, which may be incorporated into a tablet, gel, capsule, suspension or emulsion. Standard pharmaceutical excipients are available from any formulator. Oral formulations may be in the form of chewing gum, gel strips, tablets or lozenges.
- Transdermal formulations may also be prepared. These will typically be ointments, lotions, sprays, or patches, all of which can be prepared using standard technology. Transdermal formulations will require the inclusion of penetration enhancers.
- C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof, nucleic acids, and vectors disclosed herein may also be administered in controlled release formulations.
- Controlled release polymeric devices can be made for long term release systemically following implantation of a polymeric device (rod, cylinder, film, disk) or injection (microparticles).
- the matrix can be in the form of microparticles such as microspheres, where peptides are dispersed within a solid polymeric matrix or microcapsules, where the core is of a different material than the polymeric shell, and the peptide is dispersed or suspended in the core, which may be liquid or solid in nature.
- microparticles, microspheres, and microcapsules are used interchangeably.
- the polymer may be cast as a thin slab or film, ranging from nanometers to four centimeters, a powder produced by grinding or other standard techniques, or even a gel such as a hydrogel.
- Either non-biodegradable or biodegradable matrices can be used for delivery of polypeptides or nucleic acids encoding the polypeptides, although biodegradable matrices are preferred. These may be natural or synthetic polymers, although synthetic polymers are preferred due to the better characterization of degradation and release profiles.
- the polymer is selected based on the period over which release is desired. In some cases linear release may be most useful, although in others a pulse release or “bulk release” may provide more effective results.
- the polymer may be in the form of a hydrogel (typically in absorbing up to about 90% by weight of water), and can optionally be crosslinked with multivalent ions or polymers.
- the matrices can be formed by solvent evaporation, spray drying, solvent extraction and other methods known to those skilled in the art.
- Bioerodible microspheres can be prepared using any of the methods developed for making microspheres for drug delivery, for example, as described by Mathiowitz and Langer, J. Controlled Release, 5:13-22 (1987); Mathiowitz, et al., Reactive Polymers, 6:275-283 (1987); and Mathiowitz, et al., J. Appl Polymer ScL, 35:755-774 (1988).
- the devices can be formulated for local release to treat the area of implantation or injection—which will typically deliver a dosage that is much less than the dosage for treatment of an entire body—or systemic delivery. These can be implanted or injected subcutaneously, into the muscle, fat, or swallowed.
- Soluble polypeptides according to at least some embodiments of the present invention may also be modified with a label capable of providing a detectable signal, either directly or indirectly, including, but not limited to, radioisotopes and fluorescent compounds.
- a label capable of providing a detectable signal either directly or indirectly, including, but not limited to, radioisotopes and fluorescent compounds.
- Such labeled polypeptides can be used for various uses, including but not limited to, prognosis, prediction, screening, early diagnosis, determination of progression, therapy selection and treatment monitoring of disease and/or an indicative condition, as detailed above.
- the present invention provides a method for imaging an organ or tissue, the method comprising: (a) administering to a subject in need of such imaging, a labeled polypeptide; and (b) detecting the labeled polypeptide to determine where the labeled polypeptide is concentrated in the subject.
- the labeled polypeptides typically have an imaging agent covalently or noncovalently attached thereto.
- imaging agents include, but are not limited to, radionuclides, detectable tags, fluorophores, fluorescent proteins, enzymatic proteins, and the like.
- One of skill in the art will be familiar with other methods for attaching imaging agents to polypeptides.
- the imaging agent can be attached via site-specific conjugation, e.g., covalent attachment of the imaging agent to a peptide linker such as a polyarginine moiety having five to seven arginines present at the carboxyl-terminus of and Fc fusion molecule.
- the imaging agent can also be directly attached via non-site specific conjugation, e.g., covalent attachment of the imaging agent to primary amine groups present in the polypeptide.
- an imaging agent can also be bound to a protein via noncovalent interactions (e.g., ionic bonds, hydrophobic interactions, hydrogen bonds, Van der Waals forces, dipole-dipole bonds, etc.).
- the polypeptide is radiolabeled with a radionuclide by directly attaching the radionuclide to the polypeptide.
- the radionuclide is bound to a chelating agent or chelating agent-linker attached to the polypeptide.
- Suitable radionuclides for direct conjugation include, without limitation, 18 F, 124 I, 125 I, 131 I, and mixtures thereof.
- Suitable radionuclides for use with a chelating agent include, without limitation, 47 Sc, 64 Cu, 67 Cu, 89 Sr, 86 Y, 87 Y, 90 Y,105 Rh, 111 Ag, 111 In, 117m Sn, 149 Pm, 153 Sm, 166 Ho, 177 Lu, 186 Re, 188 Re, 211 At, 212 Bi, and mixtures thereof.
- the radionuclide bound to a chelating agent is 64 Cu, 90 Y, 111 In, or mixtures thereof.
- Suitable chelating agents include, but are not limited to, DOTA, BAD, TETA, DTPA, EDTA, NTA, HDTA, their phosphonate analogs, and mixtures thereof.
- attachment can be conveniently accomplished using, for example, commercially available bifunctional linking groups (generally heterobifunctional linking groups) that can be attached to a functional group present in a non-interfering position on the polypeptide and then further linked to a radionuclide, chelating agent, or chelating agent-linker.
- bifunctional linking groups generally heterobifunctional linking groups
- Non-limiting examples of fluorophores or fluorescent dyes suitable for use as imaging agents include Alexa Fluor® dyes (Invitrogen Corp.; Carlsbad, Calif.), fluorescein, fluorescein isothiocyanate (FITC), Oregon GreenTM; rhodamine, Texas red, tetrarhodamine isothiocynate (TRITC), CyDyeTM fluors (e.g., Cy2, Cy3, Cy5), and the like.
- fluorescent proteins suitable for use as imaging agents include, but are not limited to, green fluorescent protein, red fluorescent protein (e.g., DsRed), yellow fluorescent protein, cyan fluorescent protein, blue fluorescent protein, and variants thereof (see, e.g., U.S. Pat. Nos. 6,403,374, 6,800,733, and 7,157,566).
- GFP variants include, but are not limited to, enhanced GFP (EGFP), destabilized EGFP, the GFP variants described in Doan et al., Mol. Microbiol., 55:1767-1781 (2005), the GFP variant described in Crameri et al., Nat.
- DsRed variants are described in, e.g., Wang et al., Proc. Natl. Acad. Sci. U.S.A., 101:16745-16749 (2004) and include mRaspberry and mPlum. Further examples of DsRed variants include mRFPmars described in Fischer et al., FEBS Lett.,577:227-232 (2004) and mRFPruby described in Fischer et al., FEBS Lett., 580:2495-2502 (2006).
- the imaging agent that is bound to a polypeptide comprises a detectable tag such as, for example, biotin, avidin, streptavidin, or neutravidin.
- the imaging agent comprises an enzymatic protein including, but not limited to, luciferase, chloramphenicol acetyltransferase, ⁇ -galactosidase, ⁇ -glucuronidase, horseradish peroxidase, xylanase, alkaline phosphatase, and the like.
- any device or method known in the art for detecting the radioactive emissions of radionuclides in a subject is suitable for use in the present invention.
- methods such as Single Photon Emission Computerized Tomography (SPECT), which detects the radiation from a single photon gamma-emitting radionuclide using a rotating gamma camera, and radionuclide scintigraphy, which obtains an image or series of sequential images of the distribution of a radionuclide in tissues, organs, or body systems using a scintillation gamma camera, may be used for detecting the radiation emitted from a radiolabeled polypeptide of the present invention.
- SPECT Single Photon Emission Computerized Tomography
- radionuclide scintigraphy which obtains an image or series of sequential images of the distribution of a radionuclide in tissues, organs, or body systems using a scintillation gamma camera
- Positron emission tomography is another suitable technique for detecting radiation in a subject.
- Miniature and flexible radiation detectors intended for medical use are produced by Intra-Medical LLC (Santa Monica, Calif.).
- Magnetic Resonance Imaging (MRI) or any other imaging technique known to one of skill in the art is also suitable for detecting the radioactive emissions of radionuclides. Regardless of the method or device used, such detection is aimed at determining where the labeled polypeptide is concentrated in a subject, with such concentration being an indicator of disease activity.
- Non-invasive fluorescence imaging of animals and humans can also provide in vivo diagnostic information and be used in a wide variety of clinical specialties. For instance, techniques have been developed over the years for simple ocular observations following UV excitation to sophisticated spectroscopic imaging using advanced equipment (see, e.g., Andersson-Engels et al., Phys. Med. Biol., 42:815-824 (1997)). Specific devices or methods known in the art for the in vivo detection of fluorescence, e.g., from fluorophores or fluorescent proteins, include, but are not limited to, in vivo near-infrared fluorescence (see, e.g., Frangioni, Curr. Opin. Chem.
- Other methods or devices for detecting an optical response include, without limitation, visual inspection, CCD cameras, video cameras, photographic film, laser-scanning devices, fluorometers, photodiodes, quantum counters, epifluorescence microscopes, scanning microscopes, flow cytometers, fluorescence microplate readers, or signal amplification using photomultiplier tubes.
- This Example relates to production of ECD fragments.
- C1ORF32-P8-ECD-mFC To produce C1ORF32-P8-ECD-mFC in CHO cells, retrovector constructs containing cDNA that code for the protein were transduced into CHO cells, and 3-4 rounds of transductions were carried out.
- Cell pool of the last transduction was grown in shake flasks by fed-batch production. Medium was harvested at 12-14 days when cell viability dropped to ⁇ 50%.
- the harvested medium was clarified by depth filtration followed by 0.2 ⁇ m filter, and the clarified material was subjected to Protein A chromatography.
- the eluate, pH ⁇ 3.7 was incubated with mixing for 60 minutes at room temperature to facilitate viral inactivation, neutralized to pH ⁇ 7.2 and filtered through a 0.2 ⁇ m filter. Finally, the solution was buffer exchanged to PBS pH 7.2, concentrated to the desired protein concentration and filtered.
- N-terminal sequencing revealed a major cleavage site towards the C-terminus of the C1ORF32 ECD between amino acids F and A at positions 179 and 180 of H19011_1_P8_V1 or H19011_1_P8 (Seq ID NOs: 4 or 5).
- the amino acids F and A at positions 179 and 180 of H19011_1_P8_V1 or H19011_1_P8 (SEQ ID NOs: 4 or 5) were mutated as follows: FA ⁇ GA, FA ⁇ AA, and FA ⁇ GG.
- the resulted C1ORF32 ECD fragments are represented by, for example, SEQ ID NOs : 64, 96, and 45, respectively.
- Fc-fused C1ORF32 ECD proteins were produced as follows: Fc-fused C1ORF32 ECD (SEQ ID NO:108), corresponds to C1ORF32 ECD without signal peptide (SEQ ID NO: 64) fused to mouse mIgG2a Fc (SEQ ID NO: 31) via GS_TEV_linker_SG (SEQ ID NO:113).
- C1ORF32 ECD-Delta DLLPSFAVEIM corresponds to C1ORF32 ECD-Delta DLLPSFAVEIM fragment without signal peptide (SEQ ID NO:51) fused to mouse mIgG2a Fc (SEQ ID NO: 31) via GS_TEV_linker_SG (SEQ ID NO:113).
- C1ORF32 ECD-Delta RTGLLADLLPSFAVEIM (SEQ ID NO:112) corresponds to C1ORF32 ECD-Delta RTGLLADLLPSFAVEIM fragment without signal peptide (SEQ ID. NO:29) fused to mouse mIgG2a Fc (SEQ ID NO: 31) via GS_TEV_linker_SG (SEQ ID NO:113).
- Codon-optimized cDNA sequences encoding C1ORF32 ECD (SEQ ID NO:108), Fc-fused C1ORF32 ECD-Delta DLLPSFAVEIM (SEQ ID NO:110), and C1ORF32 ECD-Delta RTGLLADLLPSFAVEIM (SEQ ID NO:112) were produced at Catalent in CHO cells, in pIRESpuro3 vector.
- the cDNA sequence of the insert was verified by Catalent and was used to construct GPEx® retrovectors, followed by four rounds of retrovector transduction into Catalent's “in-house” CHO-S cell line. A pooled population was produced and expanded and gene copy index was 2.7. Cell culture supernatants were analyzed by Catalent's Fc ELISA assay and relative productivity of the 4 ⁇ transduced pool was 28 ⁇ g/ml.
- the protein was produced in 5 L wave bioreactor, and purified according to their in-house process. The level of purity was estimated at >95%, by SDS PAGE and Coomassie staining (data not shown). The concentration of purified protein was measured by absorbance at A280 nm, and estimated at 1.60 mg/ml (using an absorbance coefficient of 1.28 mg/ml). Endotoxin levels were tested, and estimated at 0.25-0.5 EU/ml. A total of ⁇ 400 mg were obtained from ⁇ 10L of cell pool.
- Viability was determined daily, and productivity was assessed at the end of the culture by Western Blot analysis. A second transient transfection was then performed, and the resultant cells were cultured in 1-2 L to obtain the required amount of protein. Culture supernatants were clarified and purified on Protein A columns. Purified proteins were analyzed by a standard SDS-PAGE gel under standard conditions, for which results are shown in FIG. 2 , and concentration was determined by A280. Proteins were tested for bioburden and endotoxin. In FIG. 2 , lane 12 relates to the protein having the sequence of SEQ ID NO:110, while lane 13 relates to the protein having the sequence of SEQ ID NO:112.
- Fc-fused C1ORF32 ECD SEQ ID NO:108
- Fc-fused C1ORF32 ECD-Delta DLLPSFAVEIM SEQ ID NO:110
- C1ORF32 ECD-Delta RTGLLADLLPSFAVEIM SEQ ID NO:112
- CD4+CD25 ⁇ T cells were isolated from pools of spleens and lymph nodes of BALB/C mice by one step negative selection using T cell isolation Kit (Miltenyi Cat#130-093-227) according to the manufacturer's instructions. The purity obtained was >95%.
- Anti-CD3 mAb (clone 145-2C11) alone or together with Fc-fused C1ORF32 ECD (SEQ ID NO:108), Fc-fused C1ORF32 ECD-Delta DLLPSFAVEIM (SEQ ID NO:110), and C1ORF32 ECD-Delta RTGLLADLLPSFAVEIM (SEQ ID NO:112) or with control mIgG2a (BioXCell Cat. #BE0085) were co-immobilized at the stated concentrations on 96-well flat bottom tissue culture plates (Sigma, Cat. #92096), overnight at 4° C. Wells were washed 3 times with PBS and plated with 1 ⁇ 10 5 CD4+ T cells per well at 37° C.
- Fc-fused C1ORF32 ECD SEQ ID NO:108
- Fc-fused C1ORF32 ECD-Delta DLLPSFAVEIM SEQ ID NO:110
- C1ORF32 ECD-Delta RTGLLADLLPSFAVEIM SEQ ID NO:112
- titrated amounts of the respective Fc-fusion C1ORF32 ECD protein or control mIgG2a were immobilized on 96-well plates together with anti-CD3 mAb, and IFNy secretion from CD4+ T cells was analyzed.
- Fc-fused C1ORF32 ECD SEQ ID NO:108
- Fc-fused C1ORF32 ECD-Delta DLLPSFAVEIM SEQ ID NO:110
- C1ORF32 ECD-Delta RTGLLADLLPSFAVEIM SEQ ID NO:112
- Immobilized Fc-fused C1ORF32 ECD (SEQ ID NO:108), Fc-fused C1ORF32 ECD-Delta DLLPSFAVEIM (SEQ ID NO:110), or C1ORF32 ECD-Delta RTGLLADLLPSFAVEIM (SEQ ID NO:112) inhibit CD4 T cell activation to a similar extent as manifested by reduced IFNy secretion and CD69 expression compare to control Ig upon TCR stimulation.
- Naive CD4+ T cells were isolated from spleens of D011.10 mice (Jackson) via automax sort: CD4-negative sort (Miltenyi Cat#130-095-248), including anti-CD25 (Miltenyi Cat#130-091-072) in the negative sort cocktail, followed by CD62L-positive sort (Miltenyi Cat #130-049-701). Balb/c total splenocytes were also collected from one mouse, and irradiated with 3000rads to serve as antigen presenting cells (APCs) for the D011.10 CD4+ T cells.
- APCs antigen presenting cells
- Naive CD4+ T cells were cultured at 2.5 ⁇ 10 5 cells per well in flat-bottom 96-well plates with irradiated APCs at a ratio of 1:1 (APCs to T cells) in 200u1 of HL-1 medium, and activated with 2 ug/ml OVA323-339 in the presence of one of Fc-fused C1ORF32 ECD (SEQ ID NO:108), (produced in CHO-S and in CHO-DG44 as detailed in Example 2) Fc-fused C1ORF32 ECD-Delta DLLPSFAVEIM (SEQ ID NO:110), (produced in CHO-DG44 as detailed in Example 2) and or C1ORF32 ECD-Delta RTGLLADLLPSFAVEIM (SEQ ID NO:112) (produced in CHO-S and in CHO-DG44 as detailed in Example 3) or Isotype control Ig (mIgG2a, BioXCell Cat. #BE0085) at the indicated concentrations (0.1-10 ug/
- the Fc-fused C1ORF32 ECD (SEQ ID NO:108), as well as Fc-fused C1ORF32 ECD-Delta DLLPSFAVEIM (SEQ ID NO:110), or C1ORF32 ECD-Delta RTGLLADLLPSFAVEIM (SEQ ID NO:112) inhibit T cell proliferation in response to OVA323-339 activation in a dose dependent manner
- a slightly reduced activity (approximately 3 fold) was achieved by the proteins produced in CHO-DG44 versus those produced in CHO-S. These differences reflect batch to batch variation of these proteins.
- a plurality of animals having a disease model appropriate for testing of the autoimmune disease, receives each of the above described Fc-fused ECD proteins in a plurality of doses. A dose dependent response is seen.
- a plurality of animals infected with an infectious disease in which T cell exhaustion is exhibited receives each of the above Fc-fused ECD proteins in a plurality of doses, in combination with an pharmaceutical agent in a pharmaceutically effective amount against the infectious agent.
- a dose dependent response is seen.
- Naive CD4+ T cells are isolated from 5 SJL (Harlan, Israel) mice via automax sort. Beads are coated with anti-CD3 (0.5 ug/m1; clone 2C11) and anti-CD28 (2 ug/ml; clone 37.51 eBioscience) following manufacturer's protocol (Dynabeads M-450 Epoxy Cat. 140.11, Invitrogen), and with increasing concentrations of any one of the C1ORF32 protein fragments and/or fusion proteins thereof (0.1-10 ug/ml). The total amount of protein used for beads coating with any one of the C1ORF32 protein fragments and/or fusion proteins thereof is completed to 10 ug/ml with Control Ig.
- Naive CD4+ T cells (0.5 ⁇ 10 6 /well) are activated with the coated beads at a ratio of 1:2 (beads to T cells).
- the cells are pulsed with luCi of tritiated-thymidine after 24 hours, and harvested after 72.
- Untouched CD4+CD25 ⁇ T cells are isolated from pools of spleen and lymph node cells of BALB/C mice by negative selection using CD4+CD62L+ T cell isolation Kit (Miltenyi Cat#130-093-227) according to the manufacturer's instructions. The desired purity obtained is >95%.
- Tissue culture 96-well plates are coated overnight at 4° C. with 2 ug/ml anti-CD3 mAb (clone 145-2C11) in the presence of any one of the C1ORF32 protein fragments and/or fusion proteins thereof at 1, 5 and 10 ⁇ g/ml.
- Control mIgG2a (Clone C1.18.4 from BioXCell; Cat#BE0085) is added to each well in order to complete a total protein concentration of 12 ⁇ g/ml per well.
- Wells are plated with 1 ⁇ 10 5 CD4+CD25 ⁇ T cells per well.
- culture supernatants are collected and analyzed using mouse IFN ⁇ ELISA kit, and cells are analyzed for expression of the activation marker CD69 by flow cytometry.
- na ⁇ ve CD4+ T cells are isolated from D011.10 mice, which are transgenic for a T cell receptor (TCR) that is specific for OVA323-339 peptide.
- TCR T cell receptor
- Using D011.10 T cells enables studying both polyclonal (anti-CD3/anti-CD28 mAbs) and peptide-specific responses on the same population of CD4+ T cells.
- Na ⁇ ve CD4+ T cells are isolated from D011.10 mice and activated in culture in the presence of anti-CD3/anti-CD28 coated beads or OVA323-339 peptide plus irradiated BALB/c splenocytes, in the presence of any one of the C1ORF32 protein fragments and/or fusion proteins thereof, control Ig, or B7-H4 Ig.
- the cells are activated in the presence of Th driving conditions as follows: Th0 cell-(IL-2), Th1 cell-(IL-2+ IL-12), Th2 cell-(IL-2+ IL-4), or Th17 cell-(TGF- ⁇ + IL-6+ IL-23+ anti-IL-2).
- Th-specific responses are assessed by measuring cell proliferation and subtype specific cytokine production:
- any one of the C1ORF32 protein fragments and/or fusion proteins thereof on human T cell response is tested by two different in vitro assays using purified human T cells.
- human T cells are activated by anti-CD3 and anti-CD28 coated beads, and in the other assay, activation is carried out using anti-CD3 and anti-CD28 antibodies in the presence of autologous, irradiated PBMCs.
- the regulatory activity of any one of the C1ORF32 protein fragments and/or fusion proteins thereof on human T cell activation is evaluated by measuring cell proliferation and cytokine release.
- Na ⁇ ve CD4+ T cells are isolated from 4 healthy human donors and activated with anti-CD3 mAb/anti-CD28 mAb coated beads in the presence of control mIgG2a, or any one of the C1ORF32 protein fragments and/or fusion proteins thereof.
- Two side-by-side culture sets are set up; one culture being pulsed at 24 hours with tritiated-thymidine and harvested at 72 hours while the second plate is harvested at 96 hours for cytokine production via LiquiChip.
- Total PBMCs are isolated from fresh blood of healthy human donors using ficoll gradient. 10 ⁇ 10 6 total PBMCs are resuspended in Ex-Vivo 20 medium, and irradiated at 3000rad. These cells are used to activate the isolated T cells in vitro, by presenting the anti-CD3, anti-CD28 and either of the test proteins. The rest of PBMCs are used for isolation of T cells using CD4+ T cell Isolation Kit II from Miltenyi.
- 5 ⁇ 10 5 isolated T cells are cultured in the presence of 5 ⁇ 10 5 autologous irradiate PBMCs.
- Anti-CD3 0.5 ⁇ g/ml
- anti-CD28 2 ug/ml
- either of any one of the C1ORF32 protein fragments and/or fusion proteins thereof or control Ig mIgG2a
- the cultures are pulsed with 1 uCi of triated thymidine at 24 hrs, and proliferation is measured at 72 hours.
- T cell stimulator a murine thymoma cell line, Bw5147, which are engineered to express membrane-bound anti-human CD3 antibody fragments, that can trigger the TCR-complex on human T cells, with or without co-expression of putative costimulatory or coinhibitory ligands.
- Codon-optimized cDNAs encoding any one of the C1ORF32 protein fragments are gene-synthesized and directionally cloned into a retroviral vector pCJK2 via Sfi-I sites. Monocistronic expression constructs are generated. The constructs are validated by agarose gel electrophoresis and were expressed in Bw5147 cells displaying high levels of membrane bound anti-CD3 antibody (Bw-3/2) (Leitner et al., 2010). As negative control Bw5147 cells transduced with “empty” vector (pCJK2) are used.
- Bw-3/2 cells expressing costimulatory molecules (ICOSL and CD70) and Bw-3/2-cells expressing coinhibitory molecules (B7-H3 and B7-H1/PD-L1) are also used as controls.
- Homogenously high expression of the stimulating membrane-bound anti-CD3 antibody is confirmed by FACS using a DyLight-649 anti-mouse IgG (H+L) antibody that reacts with the murine single chain antibody expressed on the stimulator cells. Presence and high level transcription of expression monocistronic constructs in the respective stimulator cells is confirmed by qPCR.
- T cells are purified from buffy coats or heparinised blood derived from healthy volunteer donors and the mononuclear fraction is obtained by standard density centrifugation using Ficoll-Paque (GE-Healthcare). Untouched bulk human T cells are obtained through MACS-depletion of CD11b, CD14, CD16, CD19, CD33 and MHC-class II-bearing cells with the respective biotinylated mAb in conjunction with paramagnetic streptavidin beads (Leitner et al., 2009).
- CD8 T cells and CD4 T cells are obtained by adding biotinylated CD4 and CD8 mAb to the pools.
- Na ⁇ ve CD4 T cells are isolated using the Na ⁇ ve CD4+T cell Isolation Kit II (Miltenyi Biotec). Following isolation, cells are analyzed for purity by FACS, and samples with sufficient purity (>90%) were used for the experiments.
- the stimulator cells are harvested, counted, irradiated (2 ⁇ 3000 rad) and seeded in flat-bottom 96-well plates (20000 cells/well). Liquid nitrogen stored MACS-purified T cells are thawed, counted and added to the wells at 100.000 cells per well; total volume was 200 ⁇ l/well. Triplicate wells are set up for each condition. Following 48 hours of co-culture, 3 H-thymidine (final concentration of 0.025 mCi; PerkinElmer/NewEngland Nuclear Corporation, Wellesley, MA) are added to the wells.
- Results show the effect of stimulator cells expressing any one of the C1ORF32 protein fragments on the proliferation of human bulk T cells, CD4+ T cells, CD8+ T cells, or na ⁇ ve CD4 CD45RA+ T cells, compared to cells expressing control costimulatory molecules (ICOSL and CD70), which results in a consistent and pronounced stimulation of proliferation of all cell subtypes, and compared to cells expressing control coinhibitory molecules (B7-H3 and B7-H1/PD-L1), which results in a mild inhibition of proliferation of different T cell subtypes.
- ICOSL and CD70 control costimulatory molecules
- B7-H3 and B7-H1/PD-L1 control coinhibitory molecules
- Resting B cells are isolated from unprimed C57BL/6 mice and activated in vitro in the presence of anti-CD40 plus (i) no exogenous cytokine, (ii) IL-4, or (iii) IFN- ⁇ .
- the cell cultures receive control Ig (mIgG2a), anti-CD86 mAb (as a positive control for increased Ig production), or any one of any one of the C1ORF32 protein fragments and/or fusion proteins thereof, at the time of culture set up, and are cultured for 5 days. Any one of the C1ORF32 protein fragments and/or fusion proteins thereof are tested at three concentrations each.
- mice 6 weeks old are purchased from Harlan and maintained in the CCM facility for 1 week prior to beginning the experiment. Mice are randomly assigned into groups of 10 animals and primed with 50 ⁇ g PLP139-151/CFA on day 0. Mice receive 6 i.p. injections of 100 ug/dose of any one of the C1ORF32 protein fragments and/or fusion proteins thereof, mIgG2a isotype control, or CTLA4-Ig (mouse ECD fused to mouse IgG2a Fc) as positive control. Treatments begin at the time of onset of disease remission and are given 3 times per week for 2 weeks. Mice are followed for disease symptoms.
- mice of each group are assayed for DTH (delayed type hypersensitivity) response to disease inducing epitope (PLP139-151) and to relapse-associated myelin epitope (PLP178-191) via injection of 10 ⁇ g of PLP139-151 in one ear and PLP178-191 into the opposite ear.
- DTH disease inducing epitope
- PLP178-191 relapse-associated myelin epitope
- C1ORF32 protein fragments and/or fusion proteins thereof to decrease the level of disease severity in a dose dependent manner, as well as the ability to inhibit DTH responses to spread epitopes PLP178-191 and MBP84-104, to inhibit proliferation as well as reduction in IFN ⁇ , IL-17, IL-4 and IL-10 release is tested.
- C1ORF32 protein fragments and/or fusion proteins thereof is tested in mouse model of collagen-induced arthritis (CIA) which is a model of rheumatoid arthritis.
- CIA collagen-induced arthritis
- Male DBA/1 mice are housed in groups of 8-10, and maintained at 21° C. ⁇ 2° C. on a 12 h light/dark cycle with food and water ad libitum.
- Arthritis is induced by immunisation with type II collagen emulsified in complete Freund's adjuvant. Mice are monitored on a daily basis for signs of arthritis.
- mIgG2a isotype control or CTLA4-Ig (mouse ECD fused to mouse IgG2a Fc) as positive control (100 ug/dose, each) is initiated and given 3 times per week for 10 days.
- Hind footpad swelling is measured (using microcalipers), as well as the number and degree of joint involvement in all four limbs. This yields two measurements, clinical score and footpad thickness that can be used for statistical assessment.
- mice are bled and sacrificed.
- mice are removed at post mortem, fixed in buffered formalin (10% v/v), then decalcified in EDTA in buffered formalin (5.5% w/v).
- the tissues are then embedded in paraffin, sectioned and stained with haematoxylin and eosin.
- the scoring system is as follows:
- spleen and LN cells from arthritic DBA/1 mice treated for 10 days with any one of the C1ORF32 protein fragments and/or fusion proteins thereof or control Ig2a are removed and injected i.p into T-cell deficient C.B-17 SCID recipients.
- the mice then receive an injection of 100 ⁇ g type II collagen (without CFA), necessary for successful transfer of arthritis.
- Arthritis is then monitored in the SCID mice. Histology is performed and anti-collagen antibody levels are measured to determine that the C1ORF32 protein fragments and/or fusion proteins thereof treatment confers long-term disease protection.
- TMEV Theiler's murine encephalomyelitis virus
- TMEV-IDD induced demyelinating disease
- SJL/J, H-2KS susceptible strains of mice
- MS induced demyelinating disease
- TMEV infection results in a life-long persistent virus infection of the CNS leading to development of a chronic T cell-mediated autoimmune demyelinating disease triggered via de novo activation of CD4 T cell responses to endogenous myelin epitopes in the inflamed CNS (i.e. epitope spreading) (Miller et al., Nat Med 1997; 3:1133-6; Katz-Levy et al., J Clin Invest 1999; 104:599-610).
- SJL mice clear the majority of the virus within 21 days post infection, however a latent viral infection is maintained and infect microglia, astrocytes, and neurons. Disease symptoms are manifested around day 25-30 post infection.
- mice Female SJL/J mice (5-6 weeks) are infected with TMEV by intracranial inoculation in the right cerebral hemisphere of 3 ⁇ 10 7 plaque forming units (PFU) of the BeAn strain 8386 of TMEV in 30 ul serum-free medium. From day 2 post infection mice are treated with Control Ig, or any one of C1ORF32 protein fragments and/or fusion proteins thereof, at 100 ug/dose each; 3 doses/week for 2 weeks.
- PFU plaque forming units
- mice are followed for clinical scoring. On day 7 and day 14 post infection (after 3 and 6 treatments respectively) brains and spinal cords are collected from 5 mice in each treatment group for plaque assays. The tissues are weighted so that the ratio of PFU/mg of CNS tissue could be calculated after the plaque assay is completed.
- mice treated with Control Ig mouse IgG2a
- C1ORF32 protein fragments and/or fusion proteins thereof are collected at days 7 and 14 post-infection from non-perfused anesthetized mice.
- the Brains and spinal cords are weighed, and homogenized.
- CNS homogenates are serially diluted in DMEM and added to tissue culture-treated plates of confluent BHK-21 cells for lh incubation at room temperature, with periodic gentle rocking.
- a media/agar solution is mixed 1:1 (volume:volume), added to cells and allowed to solidify at room temperature.
- the plates are then cultured at 34 deg C for 5 days.
- 1 ml of formalin is added and incubated at room temperature for 1 h to fix the BHK monolayer.
- the formalin is poured off into a waste container, and the agar is removed from the plates. Plaques are visualized by staining with crystal violet for 5 min, and plates are gently rinsed with diH2O.
- PFU/ml homogenate the number of plaques on each plate is multiplied by the dilution factor of the homogenate and divided by the amount of homogenate added per plate. The PFU/ml is divided by the weight of the tissue to calculate PFU/mg tissue.
- HA-memory mice first HA-specific memory CD4 T cells are generated, naive CD4 T cells are purified from spleens of HA-TCR mice [BALB/c-HA mice which express transgenic T cell receptor (TCR) specific for influenza hemagglutinin (HA) peptide (110-119)] and primed in vitro by culture with 5.0 microg/ml HA peptide and mitomycin C-treated, T-depleted BALB/c splenocytes as APCs for 3 days at 37° C.
- TCR transgenic T cell receptor
- the resultant activated HA-specific effector cells are transferred into congenic BALB/c (Thyl.1) hosts (5 ⁇ 10 6 cells/mouse) to yield “HA-memory mice” with a stable population of HA-specific memory CD4 T cells.
- polyclonal-memory mice first polyclonal influenza-specific memory CD4 T cells are generated, by infecting BALB/c mice intranasally with a sublethal dose of PR8 influenza, CD4 T cells are isolated 2-4 months postinfection, and the frequency of influenza-specific memory CD4 T cells is determined by ELISPOT. CD4 T cells from previously primed mice are transferred into BALB/c hosts to generate “polyclonal flu-memory” mice with a full complement of endogenous T cells.
- BALB/c or BALB/c-HA memory mice or BALB/c ‘polyclonal flu-memory mice’ are infected as above and administered with BrdU (1 mg/dose) on days 3, 4 and 5 post infection.
- BrdU 1 mg/dose
- spleen and lung are harvested and BrdU incorporation is estimated.
- Cytokine production by lung memory CD4 T cells during influenza challenge is also studied in HA-specific memory CD4 T cells stimulated in vitro with HA peptide in the presence of any one of C1ORF32 protein fragments and/or fusion proteins thereof or IgG2a for 18 hours.
- any one of C1ORF32 protein fragments and/or fusion proteins thereof on primary CD8 T cell responses to influenza virus is studied according to methods as described in the literature (Hendriks et al., J Immunol 2005; 175; 1665-1676; Bertram et al., J Immunol. 2004; 172:981-8) using C57BL/6 mice infected with influenza A HKx31 by intranasal or intraperitoneal administration. Any one of C1ORF32 protein fragments and/or fusion proteins thereof or mIgG2a control is administered during priming Animal weight loss and mortality is monitored daily.
- Virus-specific H-2D b /NP366-374+ CD8+ T cells in the lung, draining lymph nodes, and spleen are expected to reach a peak around day 8-10 post infection and decline thereafter to only 1.5% virus-specific CD8 T cells (Hendriks et al J Immunol 2005; 175; 1665-1676; Bertram et al., J Immunol. 2002; 168:3777-85; Bertram et a., J Immunol. 2004; 172:981-8).
- mice are sacrificed at days 8 and 21 post infection, and virus-specific CD8 T cell numbers is evaluated in the lung, draining lymph nodes and spleen. Viral clearance is assessed.
- CD8 T cell responses are evaluated in spleen cell suspensions, and include intracellular IFN- ⁇ staining and CTL activity, as previously described (Bertram et a., J Immunol. 2004; 172:981-8) and detailed below.
- Cells are surface-stained with FITC-conjugated anti-mouse CD62L, PE-conjugated anti-mouse CD8 to measure CD8+ activated T cells (or anti-mouse CD4 to follow CD4+ cells).
- allophycocyanin-labeled tetramers consisting of murine class I MHC molecule H-2D b , ⁇ 2 -microglobulin, and influenza NP peptide, NP 366-374 are used to measure influenza-specific CD8 T cells.
- IFN- ⁇ staining cell suspensions are restimulated in culture medium for 6 h at 37° C.
- splenocytes from influenza-infected mice are incubated for 2 h at 37° C. to remove adherent cells.
- Serial 3-fold dilutions of effectors are assayed for anti-influenza NP 366-374 -specific CTL activity against 51 Cr-labeled EL4 cells pulsed with 50 ⁇ M NP366-374 peptide for 6 h as described by Bertram et al 2002 and Bertram et al 2004.
- mice are rechallenged with the serologically distinct influenza A/PR8/34 (PR8), which shares the NP gene with influenza A HKx31, but differs in hemagglutinin and neuraminidase, so that neutralizing Abs do not limit the secondary CTL response.
- PR8/34 which shares the NP gene with influenza A HKx31, but differs in hemagglutinin and neuraminidase, so that neutralizing Abs do not limit the secondary CTL response.
- Mice are sacrificed at days 5 & 7 following virus rechallenge, and virus-specific CD8 T cell numbers is evaluated in the lung, draining lymph nodes and spleen as described by Hendriks et al and Bertram et al (Hendriks et al., J Immunol 2005; 175; 1665-1676; Bertram et al., J Immunol. 2004; 172:981-8) and detailed above.
- Secondary CD8 T cell responses including intracellular IFN- ⁇
- mice are immunized with influenza influenza A HKx31. Twenty-one days later, T cells are purified from spleens on mouse T cell enrichment immunocolumns (Cedarlane Laboratories, Hornsby, Ontario, Canada) and labeled with CFSE (alternatively Thy1.1 congenic mice are used as recipients). Equal numbers of tetramer-positive T cells are injected through the tail vein of recipient mice. Mice are rechallenged with influenza virus as described above, and 7 days later splenocytes are evaluated for donor virus-specific CD8 T cells, as detailed above.
- Memory CD8 T-cell differentiation proceeds along distinct pathways after an acute versus a chronic viral infection (Klenerman and HillNat Immunol 6, 873-879, 2005).
- Memory CD8 T cells generated after an acute viral infection are highly functional and constitute an important component of protective immunity.
- chronic infections are often characterized by varying degrees of functional impairment of virus-specific T-cell responses, and this defect is a principal reason for the inability of the host to eliminate the persisting pathogen.
- functional effector T cells are initially generated during the early stages of infection, they gradually lose function during the course of the chronic infection leading to exhausted phenotype characterized by impaired T cell functionality.
- C1ORF32 protein fragments and/or fusion proteins thereof The effect of any one of C1ORF32 protein fragments and/or fusion proteins thereof on acute and chronic viral infection is evaluated in a mouse model of infection with LCMV (lymphocytic chroriomeningitis virus) according to methodology described by Wherry et al J. Virol. 77: 4911-4927, 2003 and Barber et al Nature, 2006, and detailed below.
- LCMV lymphocytic chroriomeningitis virus
- LCMV-specific CD8 T cells become exhausted during a persistent clone 13 infection (Wherry et al J. Virol. 77: 4911-4927, 2003; Barber et al., Nature. 2006; 439:682-7).
- mice are infected with 2 ⁇ 10 5 PFU of Armstrong strain of LCMV intraperitoneally to initiate acute infection or 2 ⁇ 10 6 PFU of C1-13 intravenously to initiate chronic infection. Mice are treated i.p. with any one of C1ORF32 protein fragments and/or fusion proteins thereof or with mIgG2a control, and with specific anti-C1ORF32 protein—antibody, or an isotype control.
- mice are monitored for numbers of virus specific CD8 T cells in the spleen, using virus-specific MHC tetramer epitopes, such as D b NP 396-404 and D b GP 33-41 which differ in acute or chronic infections.
- CD8 T cell functional assays such as intracellular cytokines levels and CTL activity, are carried out as described by Wherry et al J. Virol. 77: 4911-4927, 2003, and similarly to those described in Example 40. Additional assays include production by splenocytes after stimulation with virus specific epitopes; and assessment of viral titers in the serum and in the spleen, liver, lung and kidney (Wherry et al J. Virol. 77: 4911-4927, 2003; Barber et al., Nature. 2006; 439:682-7).
- T cells are isolated from mice with chronic LCMV infection induced with C1-13 strain.
- the cells are co-stained with fluorescently labeled anti-PD-1 Ab as positive control (PD-1 is highly expressed by exhausted T cells) and biotinylated C1ORF32 protein fragments and/or fusion proteins thereof or biotinylated anti-C1ORF32 protein antibodies, and respective isotype control. Binding is detected by FACS analysis using fluorescently labeled streptavidin.
- Tfh cells are a subset of CD4+ T cells specialized in B cell help (reviewed by Crotty, Annu. Rev. Immunol. 29: 621-663, 2011). Tfh cells migrate into B cell follicles within lymph nodes, and interact with cognate B cells at the T cell-B cell border and subsequently induce germinal center B cell differentiation and germinal center formation within the follicle (Reviewed by Crotty, Annu. Rev. Immunol. 29: 621-663, 2011). The requirement of Tfh cells for B cell help and T cell-dependent antibody responses, indicates that this cell type is of great importance for protective immunity against various types of infectious agents, as well as for rational vaccine design.
- Tfh cells are readily identifiable at the peak of the CD4+ T cell response to an acute lymphocytic choriomeningitis virus (LCMV) infection as CXCR5 hi ′SLAM lo BTLA hi PD1 hi PD1 hi Bcl6 + virus-specific CD4+ T cells (Choi et al 2011, Immunity 34: 932-946).
- T cells are isolated from mice with acute LCMV infection induced with 2 ⁇ 10 5 PFU of Armstrong strain of LCMV administered intraperitoneally.
- the cells are co-stained with fluorescently labeled antibodies for markers of Tfh (CXCRS, PD1, BTLA, Bc16) which are highly expressed by Tfh cells, and biotinylated C1ORF32 protein fragments and/or fusion proteins thereof or biotinylated antibodies specific for C1ORF32 proteins, and respective isotype controls. Binding of Fc fused protein or antibody is detected by FACS analysis using fluorescently labeled streptavidin. An appropriate response is seen.
- C57BL/6 are treated with any one of C1ORF32 protein fragments and/or fusion proteins thereof and an isotype control throughout the course of an acute viral infection with Armstrong strain of LCMV (lymphocytic choriomeningitis virus).
- Tfh differentiation and Bc16 protein expression is assessed by FACS analysis as described by Eto et al 2011 (PLoS One 6: e17739). Splenocytes are analyzed 8 days following LCMV infection, Tfh generation (CD44 hi CXCR5 hi SLAM lo ) and Bcl6 expression is evaluated by FACS analysis.
- C1ORF32 protein fragments and/or fusion proteins thereof on antigen-specific B cell responses is evaluated as described by Eto et al 2011 (PLoS One 6: e17739), including titers of anti-LCMV IgG in the serum at 8 days following LCMV infection, and quantitation by FACS analysis of plasma cell (CD138 + IgD ⁇ ) development at 8 days post-infection, gated on CD19+ splenocytes.
- NOD nonobese diabetic mice which develop spontaneous
- Peri-insulitis is first observed at 3-4 wk of age, invading insulitis at 8-10 wk, and destructive insulitis appears just before the onset of clinical diabetes, with the earliest cases at 10-12 wk.
- 70-80% of female NOD mice become diabetic (Ansari et al 2003 J. Exp. Med. 198: 63-69).
- Two KO mice CD-28-KO NOD mice and B7-1/B7-2 double KO NOD mice, —which develop accelerated diabetes (Lenschow et al 1996 Immunity 5: 285-293; Salomon et al 2000 Immunity 12: 431-440), are also used.
- pancreas, pancreatic LNs and spleen will be harvested to obtain Tregs, Th subtypes and CD8 T cells, DCs and B cells. Effect on cytokines secretion from cells isolated from pancreas, pancreatic LN and spleen is analysed, focused on IFNg, IL-17, IL-4, IL-10 and TGFb. Upon effect of the tested compounds, the mechanism of disease modification is studied by examination of individual immune cell types (including Tregs, Th subtypes and CD8 T cells, DCs and B cells); cytokines (IFNg, IL-17, IL-4, IL-10 and TGFb) and histology. Histologycal analysis of the pancreas is carried out to compare the onset of insulitis, and the lymphocyte infiltration.
- cytokines secretion from cells isolated from pancreas, pancreatic LN and spleen is analysed, focused on IFNg, IL-17, IL-4, IL-10 and TGFb
- T cells from diabetic or prediabetic NOD donors are transfered to NOD SCID recipient mice. These mice are monitored for development of diabetes.
- the urine glucose and blood glucose, and assess histology of the pancreas, and T cell responses are monitored as described in the previous example.
- mice is also induced by the transfer of activated CD4+CD62L+CD25-BDC2.5 T cells (transgenic for TCR recognizing islet specific peptide 1040-p31 activated by incubation with 1040-p31) to NOD recipients.
- Mice are treated with any one of C1ORF32 protein fragments and/or fusion proteins thereof, control mIgG2a or positive control. Treatments begin 1 day following transfer. Mice are followed for glucose levels 10-28 days post transfer (Bour-Jordan et al., J Clin Invest. 2004; 114(7):979-87).
- pancreas, spleen, pancreatic LN and peripheral lymph node cells are extracted and examined for different immune cell populations.
- recall responses are measured by testing ex-vivo proliferation and cytokine secretion in response to p31 peptide.
- C1ORF32 protein fragments and/or fusion proteins thereof prevent or reduce disease onset or the severity thereof in the above studies.
- Blood samples are collected 3 days before the protein treatment and then every other week during and after treatments for plasma anti-dsDNA autoantibody analysis by ELISA. Glomerulonephritis is evaluated by histological analysis of kidneys. Proteinuria is measured by testing fresh urine samples using urinalysis dipsticks.
- C1ORF32 protein fragments and/or fusion proteins thereof have a beneficial effect in at least ameliorating lupus nephtiris.
- NZM2410-derived B6.Slel.S1e2.S1e3 mouse model of SLE is used.
- NZM2410 is a recombinant inbred strain produced from NZB and NZW that develops a highly penetrant lupus-like disease with an earlier onset of disease (Blenman et al 2006 Lab. Invest. 86: 1136-1148).
- the effect of any one of C1ORF32 protein fragments and/or fusion proteins thereof is studied in this model by assessment of proteinuria and autoantibodies as described above.
- Study III An induced lupus model is used. This model is based on chronic graft-vs-host (cGVH) disease induced by the transfer of Ia-incompatible spleen cells from one normal mouse strain (such as B6.C-H2(bm12)/KhEg (bm12)) to another (such as C57BL/6), which causes an autoimmune syndrome resembling systemic lupus erythematosus (SLE), including anti-double-stranded DNA (anti-dsDNA) autoantibodies and immune complex-type proliferative glomerulonephritis (Appleby et al Clin. Exp. Immunol. 1989 78: 449-453); Eisenberg and Choudhury 2004 Methods Mol. Med. 102:273-284).
- cGVH chronic graft-vs-host
- Lupus is induced in this model following injection of spleen cells from bm12 mice into C57BL/6 recipients.
- the effect any one of C1ORF32 protein fragments and/or fusion proteins thereof is studied in this model by assessment of proteinuria and autoantibodies as described above. T cell and responses B cell responses will also be evaluated.
- Study IV The MRL/lpr lupus prone mouse model is used. The effect of any one of C1ORF32 protein fragments and/or fusion proteins thereof is studied in this model by assessment of proteinuria and autoantibodies as described above.
- mice An adoptive transfer mouse model of colitis in mice is used, whereby Transfer of CD45RB high ⁇ CD4+ na ⁇ ve T cells from BALB/c mice to syngeneic SCID mice leads to the development of an IBD-like syndrome by 6-10 wks after T cell reconstitution, similar to human Crohn's disease.
- SCID mice are reconstituted by i.p. injection of syngeneic CD45RB high -CD4+ T cells either alone or cotransferred with syngeneic CD45RB low -CD4+ or CD25 + CD4+ cells (4 ⁇ 10 5 /mouse of each cell population) (Liu et al., J Immunol. 2001; 167(3): 1830-8).
- Colitic SCID mice reconstituted with syngeneic CD45RB high CD4+ T cells from spleen of normal mice, are treated i.p. with any one of C1ORF32 protein fragments and/or fusion proteins thereof or Ig isotype control, twice a week starting at the beginning of T cell transfer up to 8 wk.
- mice All mice are monitored weekly for weight, soft stool or diarrhea, and rectal prolapse. All mice are sacrificed 8 wk after T cell transfer or when they exhibit a loss of.20% of original body weight. Colonic tissues are collected for histologic and cytologic examinations. C1ORF32 protein fragments and/or fusion proteins thereof have a beneficial effect in at least ameliorating inflammatory bowel disease.
- a graft bed of approximately 1 cm2 is created on the shaved area of the back of a 7- to 8-week-old CB17 SCID mouse by removing a full-thickness skin sample, keeping the vessel plexus intact on the fascia covering the underlying back muscles.
- the partial thickness human skin obtained by shave biopsy is then orthotopically transferred onto the graft bed.
- Nexaband a liquid veterinary bandage (Veterinary Products Laboratories, Phoenix, Ariz.) is used to attach the human skin to the mouse skin and an antibiotic ointment (bacitracin) is applied.
- Mice are treated intraperitoneally three times per week for 4 weeks with any one of C1ORF32 protein fragments and/or fusion proteins thereof, isotype control or CTLA4-Ig (positive control).
- Biopsies are snap frozen and cryosections for histopathological and immunohistochemical studies.
- Therapeutic efficacy is determined by comparing pre- and post treatment data: (i) rete peg lengths to determine the effect on epidermal thickness and (ii) the level of lymphomononuclear cell infiltrates to determine the effect on inflammatory cellular infiltrates. (Raychaudhuri et al. 2008, J Invest Dermatol.;128(8):1969-76; Boehncke et al., 1999 Arch Dermatol Res 291:104-6).
- C1ORF32 protein fragments and/or fusion proteins thereof have a beneficial effect in at least ameliorating psoriasis.
- mice are injected intraveneously (i.v.) with 0.3_10 6 CD4+ CD45RBhi cells.
- mice are injected intraperitoneally (i.p.) with 10 microg of staphylococcal enterotoxin B (Davenport et al., Int Immunopharmacol. 2002 Apr.; 2(5):653-72).
- Recipient mice are treated with any one of C1ORF32 protein fragments and/or fusion proteins thereof, isotype control or CTLA4-Ig (positive control). Mice are evaluated once a week for 8 weeks for weight loss and presence of skin lesions.
- ECDI-fixed donor splenocytes is used as the positive control for successful modulation islet graft rejection.
- Recipient mice are monitored for blood glucose levels as a measure of graft acceptance/rejection (Luo et al., PNAS, Sep. 23, 2008_vol. 105_no. 38_14527-14532).
- the Hya model system is used, in which female C57BL/6 mice receive tail skin grafts from male C57BL/6 donors.
- mice are engrafted with orthotopic split-thickness tail skin from age matched male C57BL/6 mice.
- the mice are treated with any one of C1ORF32 protein fragments and/or fusion proteins thereof, isotype control mIgG2a Immunodominant Hya-encoded CD4 epitope (Dby) attached to female splenic leukocytes (Dby-SP) serve as positive control for successful modulation of graft rejection (Martin et al., J Immunol. 2010 Sep. 15; 185(6): 3326-3336).
- Skin grafts are scored daily for edema, pigment loss and hair loss. Rejection is defined as complete hair loss and more than 80% pigment loss.
- T cell recall responses of cells isolated from spleens and draining lymph nodes at different time points are studied in response to CD4 specific epitope (Dby), CD8 epitopes (Uty and Smcy) or irrelevant peptide (OVA 323-339) while anti CD3 stimulation is used as positive control for prolifereation and cytokine secretion.
- CD4 specific epitope Dby
- CD8 epitopes Uty and Smcy
- OVA 323-339 irrelevant peptide
- Study III The effect of any one of C1ORF32 protein fragments and/or fusion proteins thereof on graft rejection is studied in a murine model of syngeneic bone marrow cells transplantation using the Hya model system described above. Male hematopoietic cells expressing the CD45.1 marker are transplanted to female host mice which express the CD45.2 congenic marker. Female hosts are treated with any one of C1ORF32 protein fragments and/or fusion proteins thereof or with isotype control mIgG2a. The female hosts are followed over time and the presence of CD45.1+ cells is monitored.
- alopecia areata To induce alopecia areata (AA), lesional skin from C3H/HeJ mice that had developed spontaneous AA lesions is grafted onto the back of non-affected C3H/HeJ mice, as described previously (McElwee et al., 1998). Breifly, up to six grafts ⁇ 1-1.5cm in diameter are aseptically removed from each donor by pinch cutting. The grafts are placed in sterile PBS while the recipient mice are prepared for transplantation. Recipient mice are anestized and a circular pice of skin ⁇ 1.5 cm in diameter is aseptically removed from the dorsal anto-posterior midline and replaced with a donor skin graft.
- the graft is oriented 180° from normal in order to have the hair growing in opposite direction to the reciepient hair for easy identification.
- Recipient mice are treated with any one of C1ORF32 protein fragments and/or fusion proteins thereof, isotype control or CTLA4-Ig (positive control). Morphological changes are examined and documented daily. Photographs are taken before treatment, and once per week during and after treatment. After completion of treatment, all mice are anesthesized , their dorsal skin is shaved and animals are sacrificed by cervical dislocation. Skin samples are taken for histopathological examination and immunohistochemistry.
Abstract
This invention relates to C10RF32 protein and its variants and fragments and fusion proteins thereof, pharmaceutical composition comprising same and methods of use therof for treatment of immune related disorders and infections.
Description
- The present invention relates to C1ORF32 protein, and its variants, fragments and fusion proteins thereof, pharmaceutical compositions comprising same and methods of use therof for treatment of immune related disorders and infections.
- The balance between proinflammatory mechanisms and the dampening of excessive immune activation is important for treatment of infectious disease and also for treatment of autoimmune disease. The former benefits from an activated immune system while the latter requires reduce immune system activity. Thus, the immune system has the reciprocal tasks to protect the host against invading pathogens, but simultaneously to prevent damage resulting from unwanted reactions to self antigens.
- The latter part is known as immune tolerance and performed by a complex set of interactive and complementary pathways, which regulate immune responses. T cells have the ability to react to a variety of antigens, both self and nonself. Therefore, there are many mechanisms that exist naturally to eliminate potentially self-reactive responses—this is known as natural tolerance. The main mechanism for eliminating potential auto-reactive T cells occurs in the thymus and is known as central tolerance. Some potentially autoreactive T cells escape central tolerance and, therefore, peripheral tolerance mechanisms also exist. Despite these mechanisms, some self-reactive T cells may ‘escape’ and be present in the repertoire; it is believed that their activation may lead to autoimmune disease.
- Studies on therapeutic tolerance have attempted to induce and amplify potent physiological mechanisms of tolerance in order to eliminate or neutralize self-reactive T cells and prevent or treat autoimmune diseases. One way to induce tolerance is by manipulation of the interaction between costimulatory ligands and receptors on antigen presenting cells (APCs) and lymphocytes.
- CTLA-4 is the most extensively studied costimulatory molecule which down-regulates immune responses. The attributes of immunosuppressive qualities and capacity to induce tolerance have made its recognition as a potential immuno-therapeutic agent for autoimmune mediated inflammatory disorders. Abatacept (commercial name: Orencia) is a fusion protein composed of the ECD (extracellular domain) of CTLA-4 fused to the Fc fragment of hIgG1. Abatacept is believed to induce costimulation blockade, which has been approved for treating patients with rheumatoid arthritis, by effectively interfering with the inflammatory cascade.
- Induction of disease control with the current therapies, followed by progressive withdrawal in parallel with re-establishing immune tolerance, may be an attractive approach in the future of autoimmune therapies. Furthermore, due to their immune specificity, in the absence of global immunosuppression, such therapies should be safer.
- T helper type 1 (Th1) cells are induced by IL-12 and produce IFN-γ, while T helper type 2 (Th2) cells secrete IL-4, IL-5 and IL-13. Th1 cells can mediate proinflammatory or cell-mediated immune responses, whereas Th2 cells mainly promote certain types of humoral immunity. Some immune related diseases, such as autoimmune reactions, inflammation, and infection, are characterized by a dysregulation of the pro-versus anti-inflammatory tendencies of the immune system, as well as an imbalance in the Th1 versus Th2 cytokine balance. During inflammation, induction of a shift in the balance from Th1 to Th2 protects the organism from systemic ‘overshooting’ with Th1/pro-inflammatory cytokines, by reducing the inflammatory tendencies of the immune system Immunomodulatory therapies that are associated with a Th1 to Th2 immune shift have protective effects in Th1-mediated autoimmune diseases, such as multiple sclerosis and rheumatoid arthritis. For example, Laquinimod, which has demonstrated efficacy in animal models of several autoimmune diseases including MS, shows immunomodulatory effects through Th1/Th2 shift, and does not lead to immunosuppression. Glatiramer acetate (Copaxone) also induces Th1/Th2 shift with decreased secretion of proinflammatory cytokines, and increased secretion of antiinflammatory cytokines. Furtheremore, GA-specific Th2 cells are able to migrate across the blood-brain barrier and cause in situ bystander suppression of autoaggressive Th1 T cells.
- The balance between proinflammatory mechanisms and the dampening of excessive immune activation is also critical for successful clearance of a pathogen without harm to the host. Excessive immune activation may lead to autoimmune attacks, while too little immune activation will not result in clearance of the pathogen from the host. Chronic pathogens exploit co-inhibitory pathways to attenuate Ag-specific T cell immunity. Emerging data from a wide range of studies on acute and chronic infections support an important role for negative costimulatory receptors in controlling infection. Most notably, exhausted T cells, functionally impaired T cells which are present during chronic infection and are characterized by reduced proliferative and cytotoxic abilities, express high levels of multiple co-inhibitory receptors such as CTLA-4, PD-1, and LAG3 (Crawford et al., Curr Opin Immunol. 2009; 21:179-186; Kaufmann et al., J Immunol 2009; 182:5891-5897, Sharpe et al., Nat Immunol 2007; 8:239-245). Furthermore, the exhausted phenotype can be reversed by blocking co-inhibitory pathways (Rivas et al., J Immunol. 2009 ; 183:4284-91; Golden-Mason et al., J Virol. 2009; 83:9122-30), thus allowing restoration of anti viral immune function, supporting therapeutic application of co-inhibitory blockade in viral infection.
- One potentially promising strategy to control chronic infections such as human immunodeficiency virus, hepatitis B virus, and hepatitis C virus is therapeutic vaccination, which aims to reduce persisting virus by stimulating a patient's own antiviral immune responses. However, this approach has fallen short of expectations, because antiviral T cells generated during chronic infections often become functionally exhausted, as explained above, and thus do not respond properly to therapeutic vaccination. Therefore, it is necessary to restore T cell effector functions and effectively boost endogenous T-cell responses in order to develop therapeutic vaccines against chronic viral infections. Blocking the negative signaling pathways, PD-1 and CTLA-4, could restore the host immune system, enabling it to respond to further stimulation. Blockade of the PD-1/PD-L1 pathway, for example, is able to restore functional capabilities to exhausted CTLs (Hofmeyer et al, J. Biomed. & Biotech. Vol. 2011, Art. ID 451694). Combining therapeutic vaccination along with the blockade of inhibitory signals could synergistically enhance functional CD8(+) T-cell responses and improve viral control in chronically infected individuals, providing a promising strategy for the treatment of chronic viral infections. (Ha et al, Immunol Rev. 2008 June; 223:317-33). Antibodies to PD-1 and CTLA-4 are currently in clinical trials in chronic hepatitis C, as promising candidates for combination with both prophylactic and therapeutic vaccines (Diepolder and Obst, Expert Rev Vaccines. 2010 Mar.; 9(3):243-7).
- The therapeutic potential of co-inhibition blockade for treating viral infection was extensively studied by blocking the PD-1/PD-L1. Blocking this pathway was shown to be efficacious in several animal models of infection including acute and chronic Simian immunodeficiency virus (SIV) infection in rhesus macaques (Valu et al., Nature 2009; 458:206-210) and in mouse model of chronic viral infection with lymphocytic choriomeningitis virus (LCMV) (Barber et al., Nature. 2006; 439:682-7). Modulation of costimulatory pathway has also been proven effective in optimizing antiviral immunity by limiting the memory T cell response to its protective capacities (Teij aro et al., J Immunol. 2009: 182; 5430-5438). This has been demonstrated in models of influenza infection in which inhibiting CD28 costimulation with CTLA4-Ig suppressed primary responses in naive mice infected with influenza, but was remarkably curative for memory CD4 T cell-mediated secondary responses to influenza leading to improved clinical outcome and increased survival to influenza challenge. The curative effect of CTLA4-Ig on secondary responses was accompanied by inhibition of proliferation and egress of lymphoid naive and memory T cells, while leaving lung resident memory CD4 T cell responses intact thus maintaining enhanced and rapid lung viral clearance mediated by memory CD4 T cells, yet reducing lung immunopathology.
- These data demonstrate an active and reversible role for molecules of the B7:CD28 family, PD-1, CTLA-4, and their ligands, in virus-specific T cell exhaustion associated with chronic viral infection and point to promising potential for immunotherapeutic interventions based on manipulation of these inhibitory networks.
- Regulating costimulation using agonists and antagonists to various costimulatory proteins has been extensively studied as a strategy for treating autoimmune diseases, graft rejection, allergy and cancer. This field has been clinically pioneered by CTLA4-Ig (Abatacept, Orencia®) that is approved for treatment of RA, and by the anti-CTLA4 antibody (Ipilimumab, Yervoy®), recently approved for the treatment of melanoma. Other costimulation regulators are currently in advanced stages of clinical development including anti PD-1 antibody (MDX-1106) which is in development for treatment of advanced/metastatic clear-cell renal cell carcinoma (RCC) and anti-CD40L Antibody (BG9588, Antova®) for treatment of renal allograft transplantation. In addition, such agents are in clinical development for viral infections, for example the anti PD-1 Ab, MDX-1106, is being tested for treatment of hepatitis C. Another example is CP-675,206 (tremelimumab) and anti-CTLA4 Ab which is in a clinical trial in hepatitis C virus-infected patients with hepatocellular carcinoma.
- B cells play a critical role in recognition of foreign antigens and subsequent production of antibodies in the specific humoral adaptive immune responses that provide protection against various types of infectious agents. B cells play a critical role in recognition of foreign antigens and they produce the antibodies necessary to provide protection against various type of infectious agents. T cell help to B cells is a pivotal process of adaptive immune responses. Follicular helper T (Tfh) cells are a subset of CD4+ T cells specialized in B cell help (reviewed by Crotty, Annu. Rev. Immunol. 29: 621-663, 2011). Tfh cells express the B cell homing chemokine receptor, CXCRS, which drives Tfh cell migration into B cell follicles within lymph nodes in a CXCL13-dependent manner. The requirement of Tfh cells for B cell help and T cell-dependent antibody responses, indicates that this cell type is of great importance for protective immunity against various types of infectious agents, as well as for rational vaccine design.
- Tfh cells selectively express a wealth of surface proteins, which are involved in their selective localization (such as CXCRS) and in direct physical interactions with B cells to provide B cell help. Among the latter group are several members of the costimulatory proteins family which are highly expressed in Tfh cells, including the inducible co-stimulatory receptor ICOS, and the negative costimulators (inhibitory receptors) PD-1 and BTLA (Crotty, Annu. Rev. Immunol. 29: 621-663, 2011).
- The background art fails to provide therapies that target multiple cells and pathways involved in autoimmunity and inflammation, such as Th1, Th17, Th22, Th2, Tregs, or other cells that secrete, or influence other cells that secrete, inflammatory molecules such as cytokines, metalloproteases, chemokines and other molecules. The background art also does not teach such therapies that are targeted with regard to providing a balance between excessive immune activation and desirable pro-inflammatory immune activation, for the treatment of autoimmune diseases and infectious disease.
- The present invention is of C1ORF32 protein, and its variants, fragments and fusion proteins thereof, pharmaceutical compositions comprising same and methods of use therof for treatment of immune related disorders and infections.
- With regard to treatment for immune related diseases, it should be noted that such diseases may optionally relate to any disease in which it is desirable to induce immune tolerance. With regard to treatment of infections, it should be noted that such diseases may optionally relate to any disease in which T cell exhaustion to a foreign pathogenic antigen plays a role.
- According to at least some embodiments of the present invention, there are provided C1ORF32 polypeptides, as an isolated polypeptide, comprising an amino acid sequence of C1ORF32 IgV domain fragment, set forth in any one of SEQ ID NOs: 29, 30, 41-105, with the proviso that the amino acid sequence does not include the complete, exact sequence of SEQ ID NO: 35. Optionally, the isolated polypeptide has less than 90% identity with SEQ ID NO:35, optionally has less than 85% identity with SEQ ID NO:35 and optionally has less than 80% identity with SEQ ID NO:35. Also optionally and preferably, the isolated polypeptide consists essentially of the amino acid sequence as set forth in any one of SEQ ID NOs: 29, 30, 41-105, or optionally up to 95% identical thereof. It is further contemplated that optionally the C1ORF32 IgV domain fragment may be extended beyond the border delimited by the end of SEQ ID NO:35, as long as one or more of the above conditions regarding sequence identity are met. A further description of such fragments is provided with regard to Table 1 below.
- Briefly, a sequence alignment and comparison is provided between SEQ ID NO:35 and SEQ ID NO:29, as an example of the above described inventive sequences:
-
Query: 1 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAWQWKFKSYCQDRMGESLGMSSTRAQSL 60 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAWQWKFKSYCQDRMGESLGMSSTRAQSL Sbjct: 1 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAWQWKFKSYCQDRMGESLGMSSTRAQSL 60 Query: 61 SKRNLEWDPYLDCLDSRRTVRWASKQGSTVTLGDFYRGREITIVHDADLQIGKLMWGDS 120 SKRNLEWDPYLDCLDSRRTVRWASKQGSTVTLGDFYRGREITIVHDADLQIGKLMWGDS Sbjct: 61 SKRNLEWDPYLDCLDSRRTVRWASKQGSTVTLGDFYRGREITIVHDADLQIGKLMWGDS 120 Query: 121 GLYYCIITTPDDLEGKNEGSLGLLVLGRTGLLADLLPSFAVEIMPE 166 GLYYCIITTPDDLEGKNEDSVELLVLG Sbjct: 121 GLYYCIITTPDDLEGKNEDSVELLVLG................... 147 - For this non-limiting example, SEQ ID NO:29 is shorter than SEQ ID NO:35 but as noted above, for some inventive sequences, the inventive amino acid sequence is longer than SEQ ID NO:35, but still fulfills one or more of the above conditions regarding sequence identity. An equivalent difference exists between the inventive sequences and SEQ ID NO:36, such that the inventive sequences are as described above and herein, the proviso that the amino acid sequence does not include the complete, exact sequence of SEQ ID NO: 36. Optionally, the isolated polypeptide has less than 90% identity with SEQ ID NO:36, optionally has less than 85% identity with SEQ ID NO:36 and optionally has less than 80% identity with SEQ ID NO:36. It is further contemplated that optionally the C1ORF32 IgV domain fragment may be extended beyond the border delimited by the end of SEQ ID NO:36, as long as one or more of the above conditions regarding sequence identity are met.
- According to at least some embodiments, there is provided an isolated polypeptide comprising a soluble C1ORF32 polypeptide or fragment or variant thereof, having an amino acid substitution preventing a cleavage of the C1ORF32 ECD (SEQ ID NO:14) between amino acids F and A at positions 179 and 180 of any of H19011_1_P8_V1 or H19011_1_P8 (Seq ID NOs: 4 or 5). Optionally, the amino acid substitution in the cleavage site of C1ORF32 ECD (SEQ ID NO:14) at positions 179 and 180 of any of H19011_1_P8_V1 or H19011_1_P8 (Seq ID NOs: 4 or 5) is selected from FA→GA; FA→AA; and FA→GG. Optionally and preferably, the polypeptide has an amino acid sequence as set forth in any one of SEQ ID NOs:45, 64, and 96.
- According to at least some embodiments of the present invention, there are provided C1ORF32 polypeptides, optionally provided as fusion proteins containing a C1ORF32 polypeptide. C1ORF32 fusion polypeptides optionally have a first fusion partner comprising part of a C1ORF32 soluble polypeptide, or a sequence homologous thereto, and a second fusion partner composed of a heterologous sequence (respectively non-C1ORF32), fused together directly or indirectly via a peptide linker sequence or a chemical linker.
- Optionally, the fusion protein comprises the polypeptide as described herein, fused to a heterologous sequence, directly or indirectly via a linker peptide, a polypeptide sequence or a chemical linker.
- Optionally the heterologous sequence comprises at least a portion of an immunoglobulin constant domain. Also optionally, the constant domain comprises an immunoglobulin heavy chain constant region corresponding to an antibody isotype selected from the group consisting of an IgG1, IgG2, IgG3, IgG4, IgM, IgE, IgA and IgD.
- Optionally the immunoglobulin constant domain comprises the hinge, CH2 and CH3 regions of a human IgG immunoglobulin, selected from the group consisting of Cγ1, Cγ2, Cγ3 and Cγ4 chain.
- Optionally, the fusion protein further comprises a domain that mediates dimerization or multimerization of the fusion protein to form homodimers, heterodimers, homomultimers, or heteromultimers. Optionally, the domain that mediates dimerization or multimerization is selected from the group consisting of one or more cysteines that are capable of forming an intermolecular disulfide bond with a cysteine on the partner fusion protein, a coiled-coil domain, an acid patch, a zinc finger domain, a calcium hand domain,a CHI region, a CL region, a leucine zipper domain, an SH2 (src homology 2) domain, an SH3 (src Homology 3) domain, a PTB (phosphotyrosine binding) domain, a WW domain, a PDZ domain, a 14-3-3 domain, a WD40 domain, an EH domain, a Lim domain, an isoleucine zipper domain, and a dimerization domain of a receptor dimer pair.
- According to at least some embodiments of the present invention, there is provided a dimeric protein comprising a first and a second fusion protein, wherein the first and the second fusion proteins comprise the fusion protein as described herein and wherein the first and the second fusion proteins are bound to one another by covalent or noncovalent bonds to form a dimer.
- According to at least some embodiments, the isolated polypeptide is at least 80, 90, 95, 96, 97, 98 or 99% homologous to a polypeptide set forth in any one of SEQ ID NOs: 29, 30, 41-105. The C1ORF32 polypeptide may be of any species of origin. In further embodiments, the C1ORF32 polypeptide is of murine, non-human primate or human origin.
- Without wishing to be limited by a single hypothesis, according to at least some embodiments the C1ORF32 protein, which may optionally comprise a fusion protein, inhibits the inflammatory activity of Th1, Th17, Th22, or other cells that secrete, or cause other cells to secrete, inflammatory molecules, including, but not limited to, IL-1beta, TNF-alpha, TGF-beta, IFN-gamma, IL-17, IL-6, IL-23, IL-22, IL-21, and MMPs. Again without wishing to be limited by a single hypothesis, according to at least some embodiments the C1ORF32 protein can also increase the suppressive capacity of Tregs or the immunomodulatory activity of Th2 cells. The C1ORF32 fusion protein can also increase the production of anti-inflammatory molecules such as the cytokine IL-10.
- Optionally, the fragment is of at least about 20 amino acids of the extracellular domain of C1ORF32, but no more than 169 amino acids of the extracellular domain, in order to fulfill the conditions regarding sequence identity as described with regard to SEQ ID NO:35 as described above. Optionally, the fragment is of at least about 21, 22, 23, 24, 25 and so forth amino acids of the extracellular domain of C1ORF32, but no more than 100, 101, 102 and so forth, up to 168 amino acids of the extracellular domain, as described above, optionally including any integral value between 20 and 169 amino acids in length, although as noted above, the inventive sequence may optionally have more amino acids than the ECD of SEQ ID NO:35. Optionally the polypeptide is attached to a detectable or therapeutic moiety.
- According to at least some embodiments of the present invention, there is provided a method for prevention of damage to the myelin coat of neural cells in the central nervous system in MS (multiple sclerosis) patients comprising administering to a subject in need thereof a pharmaceutical composition comprising: a soluble molecule having the C1ORF32 polypeptide, selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof; optionally provided as a pharmaceutical composition. Optionally, the fragment is as described above.
- Multiple sclerosis (MS) is a chronic, inflammatory, demyelinating disorder of the central nervous system (CNS), which involves autoimmune responses to myelin antigens. It is characterized by lesions within the CNS and demyelination is a key feature of these lesions. Autoreactive T cells are thought to initiate an autoimmune response directed against components of CNS myelin. The main targets of the autoimmune reactions are thought to be myelin basic protein (MBP), proteolipid protein (PLP) and myelin oligodendrocyte glycoprotein (MOG). Experimental autoimmune encephalomyelitis (EAE), an animal model of MS induced by immunization with myelin components in adjuvant, shows comparable neuronal pathology. Without wishing to be limited by a single hypothesis, studies in EAE have provided convincing evidence that T cells specific for self-antigens mediate pathology in these diseases.
- According to at least some embodiments of the present invention, there is provided an isolated soluble C1ORF32 polypeptide, selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, fragment, variant, or homolog thereof; optionally as a fusion protein or conjugate, wherein said polypeptide or said fusion protein or conjugate is used for anti-immune related condition immunotherapy for an immune related disorder and/or infection as described herein, optionally provided as a pharmaceutical composition.
- Optionally treating comprises one or more of preventing, curing, managing, reversing, attenuating, alleviating, minimizing, suppressing, managing, or halting the deleterious effects of the above-described diseases.
- Optionally, managing comprises reducing the severity of the disease, reducing the frequency of episodes of the disease, reducing the duration of such episodes, or reducing the severity of such episodes or a combination thereof.
- In another embodiment, the C1ORF32 polypeptides, fragments or variants or homologs thereof, fusion proteins or conjugates comprising same, or pharmaceutical composition comprising same, can be used to treat patients who do not respond to TNF blockers.
- According to at least some embodiments, the present invention provides a method for combining therapeutic vaccination with an antigen along with administration of the foregoing pharmaceutical composition for treatment of infection. According to at least some embodiments of the present invention, the antigen is a viral antigen, a bacterial antigen, fungal antigen and/or other parasite antigen.
- According to at least some embodiments, the present invention further provides a method for combining the foregoing pharmaceutical composition, used as adjuvant, along with an antigen in a vaccine, in order to increase the immune response. According to at least some embodiments of the present invention, the antigen is a viral antigen, a bacterial antigen, fungal antigen, parasite antigen, and/or other pathogen's antigen.
-
FIG. 1 shows a schematic drawing of a full length soluble C1ORF32 protein. Signal Peptide is shown in italic face font; two potential start points of IgV are shown in underlined italic and bold shape; IgV domain is in bold face font; amino acid region deleted in H19011_1_P9 (SEQ ID NO:6) as compared to the H19011_1_P8 (SEQ ID NO:4) is shown in dashed underline; the locations of the three SNPs (DSVE→GSLG) is shown in double underlined italic and bold shape; the location of point mutations (FA→GA, FA→AA, FA->GG) is shown in bold and dashed underline. Transmembrane domain (TM) of H19011_1_P8 (SEQ ID NO:4) is shown in light font with dotted underline; in H19011_1_P9 (SEQ ID NO:6) the TM starts at amino acid residues “FVG . . . ”, 2 amino acids downstream to the start point of the H19011_1_P8 (SEQ ID NO:4) transmembrane domain. Vertical bars represent five possible C-terminal end points of the soluble C1ORF32 proteins fromposition 1 on the left (end of IgV) toposition 5 on the right (end of predicted ECD). -
FIG. 2 shows SDS-PAGE results for produced proteins. -
FIG. 3 shows inhibitory effect of Fc-fused C1ORF32 ECD (SEQ ID NO:108), Fc-fused C1ORF32 ECD-Delta DLLPSFAVEIM (SEQ ID NO:110), and C1ORF32 ECD-Delta RTGLLADLLPSFAVEIM (SEQ ID NO:112) on mouse CD4+ T cell IFNγ secretion. Purified CD4+CD25− T cells, 1×105 per well, were stimulated with anti-CD3 mAb (2 ug/mL) in the presence of test proteins or control mouse IgG2a at 0, 3 and 10 μg/ml. Culture supernatants were collected 48 hrs post stimulation and analyzed using mouse IFNy ELISA kit. Results are shown as Mean±SD of four wells per point (Student's t-test , ***P<0.001, compared with control mouse IgG2a). -
FIG. 4 shows inhibitory effect of Fc-fused C1ORF32 ECD (SEQ ID NO:108), Fc-fused C1ORF32 ECD-Delta DLLPSFAVEIM (SEQ ID NO:110), and C1ORF32 ECD-Delta RTGLLADLLPSFAVEIM (SEQ ID NO:112) on expression of the early TCR activation marker, CD69. 1×105 CD4+CD25− T cells were stimulated with plate bound anti-CD3 (2 μg/ml) together with test proteins or control mIgG2a (10 μg/ml). Cells were analyzed at 48 hrs for the expression CD69 by flow cytometry (**; P value<0.001 compare to control mIgG2A, student's T test). -
FIG. 5 shows inhibitory effect of Fc-fused C1ORF32 ECD (SEQ ID NO:108), (two different batches produced in CHO-S And in CHO-DG44), Fc-fused C1ORF32 ECD-Delta DLLPSFAVEIM (SEQ ID NO:110), and C1ORF32 ECD-Delta RTGLLADLLPSFAVEIM (SEQ ID NO:112) (two different batches produced in CHO-S And in CHO-DG44) on naive T cell proliferation. No inhibition was observed with the IgG2a isotype control. - The present invention, in at least some embodiments, relates to any one of the C1ORF32 proteins, selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, fragments, variants and homologs thereof and fusion proteins and conjugates containing same, and pharmaceutical compositions comprising same, and nucleic acid sequences encoding same, and the use thereof as a therapeutic agent for treatment of immune related disorder and/or infection, and/or optionally the corresponding DNAs or vectors or cells expressing same for use in immunotherapy.
- In order that the present invention may be more readily understood, certain terms are first defined. Additional definitions are set forth throughout the detailed description.
- As used herein the term “isolated” refers to a compound of interest (for example a polynucleotide or a polypeptide) that is in an environment different from that in which the compound naturally occurs e.g. separated from its natural milieu such as by concentrating a peptide to a concentration at which it is not found in nature. “Isolated” includes compounds that are within samples that are substantially enriched for the compound of interest and/or in which the compound of interest is partially or substantially purified.
- An “immune cell” refers to any cell from the hemopoietic origin including but not limited to T cells, B cells, monocytes, dendritic cells, and macrophages.
- As used herein, the term “polypeptide” refers to a chain of amino acids of any length, regardless of modification (e.g., phosphorylation or glycosylation).
- The term “immune related disease (or disorder or condition)” as used herein should be understood to encompass any disease disorder or condition selected from the group including but not limited to autoimmune diseases, inflammatory disorders and immune disorders associated with graft transplantation rejection, such as acute and chronic rejection of organ transplantation, allogenic stem cell transplantation, autologous stem cell transplantation, bone marrow tranplantation, and graft versus host disease.
- As used herein the term “inflammatory disorders” and/or “inflammation”, used interchangeably, includes inflammatory abnormalities characterized by disregulated immune response to harmful stimuli, such as pathogens, damaged cells, or irritants. Inflammatory disorders underlie a vast variety of human diseases. Non-immune diseases with etiological origins in inflammatory processes include atherosclerosis, and ischaemic heart disease. Examples of disorders associated with inflammation include: Chronic prostatitis, Glomerulonephritis, Hypersensitivities, Pelvic inflammatory disease, Reperfusion injury, Sarcoidosis, Vasculitis, Interstitial cystitis, normocomplementemic urticarial vasculitis, pericarditis, myositis, anti-synthetase syndrome, scleritis, macrophage activation syndrome, Bechet's Syndrome, PAPA Syndrome, Blau's Syndrome, gout, adult and juvenile Still's disease, cryropyrinopathy, Muckle-Wells syndrome, familial cold-induced auto-inflammatory syndrome, neonatal onset multisystemic inflammatory disease, familial Mediterranean fever, chronic infantile neurologic, cutaneous and articular syndrome, systemic juvenile idiopathic arthritis, Hyper IgD syndrome, Schnitzler' s syndrome, TNF receptor-associated periodic syndrome (TRAPSP), gingivitis, periodontitis, hepatitis, cirrhosis, pancreatitis, myocarditis, vasculitis, gastritis, gout, gouty arthritis, and inflammatory skin disorders, selected from the group consisting of psoriasis, atopic dermatitis, eczema, rosacea, urticaria, and acne.
- The term “autoimmune disease” as used herein should be understood to encompass any disease in which recognition of a “self” antigen (self-reactivity) is at least a part of the disease process. According to at least some embodiments of the invention, the autoimmune diseases should be understood to encompass any disease disorder or condition including one or more of, but not limited to, multiple sclerosis, rheumatoid arthritis; psoriatic arthritis, discoid lupus erythematosus, systemic lupus erythematosus (SLE); ulcerative colitis; Crohn's disease; benign lymphocytic angiitis, autoimmune lymphoproliferative syndrome, sarcoidosis, autoimmune thrombocytopenic purpura, idiopathic thrombocytopenic purpura, pure red cell aplasia, Sjogren's syndrome, rheumatic disease, polymyalgia rheumatica, mixed connective tissue disease, inflammatory rheumatism, degenerative rheumatism, extra-articular rheumatism, juvenile arthritis, juvenile rheumatoid arthritis, systemic juvenile idiopathic arthritis, arthritis uratica, muscular rheumatism, chronic polyarthritis, reactive arthritis, Reiter's syndrome, rheumatic fever, relapsing polychondritis, Raynaud's phenomenon, vasculitis, cryoglobulinemic vasculitis, ANCA-associated vasculitis, temporal arteritis, giant cell arteritis, Takayasu arteritis, Behcet's disease, antiphospholipid syndrome, myasthenia gravis, autoimmune haemolytic anaemia, Guillain-Barre syndrome, chronic immune polyneuropathy, chronic inflammatory demyelinating polyneuropathy, autoimmune thyroiditis, insulin dependent diabetes mellitus, type I diabetes, Addison's disease, membranous glomerulonephropathy, polyglandular autoimmune syndromes, Goodpasture' s disease, autoimmune gastritis, autoimmune atrophic gastritis, pernicious anaemia, pemphigus, pemphigus vulgaris, cirrhosis, primary biliary cirrhosis, idiopathic pulmonary fibrosis, myositis, dermatomyositis, juvenile dermatomyositis, polymyositis, fibromyositis, myogelosis, celiac disease, celiac sprue dermatitis, immunoglobulin A nephropathy, Henoch-Schonlein purpura, Evans syndrome, atopic dermatitis, psoriasis, psoriasis vulgaris, psoriasis arthropathica, Graves' disease, Graves' ophthalmopathy, scleroderma, systemic scleroderma, progressive systemic scleroderma, diffuse scleroderma, localized scleroderma, Crest syndrome, asthma, allergic asthma, allergy, primary biliary cirrhosis, Hashimoto's thyroiditis, fibromyalgia, chronic fatigue and immune dysfunction syndrome (CFIDS), primary myxedema, sympathetic ophthalmia, autoimmune inner ear disease, autoimmune uveitis, autoimmune chronic active hepatitis, collagen diseases, ankylosing spondylitis, periarthritis humeroscapularis, panarteritis nodosa, polyarteritis nodosa, chondrocalcinosis, Wegener's granulomatosis, microscopic polyangiitis, chronic urticaria, bullous skin disorders, pemphigoid, bullous pemphigoid, cicatricial pemphigoid, vitiligo, atopic eczema, eczema, chronic urticaria, autoimmune urticaria, normocomplementemic urticarial vasculitis, hypocomplementemic urticarial vasculitis, alopecia areata, alopecia universalis, alopecia totalis, Devic's disease, pernicious anemia, childhood autoimmune hemolytic anemia, idiopathic autoimmune hemolytic anemia, refractory or chronic Autoimmune Cytopenias, Prevention of development of Autoimmune Anti-Factor VIII Antibodies in Acquired Hemophilia A, Cold agglutinin disease, Neuromyelitis Optica, Stiff Person Syndrome, gingivitis, periodontitis, pancreatitis, myocarditis, gastritis, gout, gouty arthritis, idiopathic pericarditis, anti-synthetase syndrome, scleritis, macrophage activation syndrome, PAPA Syndrome, Blau's Syndrome, adult and juvenile Still's disease, cryopyrin associated periodic syndrome, Muckle-Wells syndrome, familial cold auto-inflammatory syndrome, neonatal onset multisystem inflammatory disease, chronic infantile neurologic cutaneous and articular syndrome, familial Mediterranean fever, Hyper IgD syndrome, Schnitzler' s syndrome, autoimmune retinopathy, age-related macular degeneration, or TNF receptor-associated periodic syndrome (TRAPS).
- As used herein, “multiple sclerosis” comprises multiple sclerosis or a related disease, and optionally refers to all types and stages of multiple sclerosis, including, but not limited to: benign multiple sclerosis, relapsing remitting multiple sclerosis, secondary progressive multiple sclerosis, primary progressive multiple sclerosis, progressive relapsing multiple sclerosis, chronic progressive multiple sclerosis, transitional/progressive multiple sclerosis, rapidly worsening multiple sclerosis, clinically-definite multiple sclerosis, malignant multiple sclerosis, also known as Marburg's Variant, and acute multiple sclerosis. Optionally, “conditions relating to multiple sclerosis” include, e.g., Devic's disease, also known as Neuromyelitis Optica; acute disseminated encephalomyelitis, acute demyelinating optic neuritis, demyelinative transverse myelitis, Miller-Fisher syndrome, encephalomyelradiculoneuropathy, acute demyelinative polyneuropathy, tumefactive multiple sclerosis and Balo's concentric sclerosis.
- As used herein, “rheumatoid arthritis” comprises rheumatoid arthritis or a related disease and refers to all types and stages of rheumatoid arthritis, including, but not limited to: rheumatoid arthritis, gout and pseudo-gout, juvenile idiopathic arthritis, juvenile rheumatoid arthritis, Still's disease, ankylosing spondylitis, rheumatoid vasculitis. Optionally, conditions relating to rheumatoid arthritis include, e.g., osteoarthritis, sarcoidosis, Henoch-Schönlein purpura, Psoriatic arthritis, Reactive arthritis, Spondyloarthropathy, septic arthritis, Haemochromatosis, Hepatitis, vasculitis, Wegener's granulomatosis, Lyme disease, Familial Mediterranean fever, Hyperimmunoglobulinemia D with recurrent fever, TNF receptor associated periodic syndrome, and Enteropathic arthritis associated with inflammatory bowel disease.
- As used herein, “Uveitis” refers to all types and stages of Uveitis, including, but not limited to: anterior uveitis (or iridocyclitis), intermediate uveitis (pars planitis), posterior uveitis (or chorioretinitis) and the panuveitic form.
- As used herein, “inflammatory bowel disease” also refers to a related disease and refers to all types and stages of inflammatory bowel disease (IBD), including, but not limited to: Crohn's disease and ulcerative colitis (UC). Optionally, conditions relating to IBD include, e.g., Collagenous colitis, Lymphocytic colitis, Ischaemic colitis, Diversion colitis, Behget's disease, Indeterminate colitis.
- As used herein, “psoriasis” also refers to a related disease and refers to all types and stages of psoriasis, including, but not limited to: Nonpustular Psoriasis including Psoriasis vulgaris and Psoriatic erythroderma (erythrodermic psoriasis), Pustular psoriasis including Generalized pustular psoriasis (pustular psoriasis of von Zumbusch), Pustulosis palmaris et plantaris (persistent palmoplantar pustulosis, pustular psoriasis of the Barber type, pustular psoriasis of the extremities), Annular pustular psoriasis, Acrodermatitis continua, Impetigo herpetiformis. Optionally, conditions relating to psoriasis include, e.g., drug-induced psoriasis, Inverse psoriasis, Napkin psoriasis, Seborrheic-like psoriasis, Guttate psoriasis, Nail psoriasis, Psoriatic arthritis.
- As used herein, “
type 1 diabetes” refers to all types and stages oftype 1 diabetes, including, but not limited to: insulin-dependent diabetes mellitus, idiopathic diabetes, juvenile type ldiabetes, maturity onset diabetes of the young, latent autoimmune diabetes in adults, gestational diabetes. Conditions relating to type 1 diabetes include, neuropathy including polyneuropathy, mononeuropathy, peripheral neuropathy and autonomicneuropathy; eye complications: glaucoma, cataracts, retinopathy. - As used herein, “Sjogren's syndrome” refers to all types and stages of Sjogren's syndrome, including, but not limited to: Primary Sjogren's syndrome and Secondary Sjogren's syndrome. Conditions relating to Sjogren's syndrome include connective tissue disease, such as rheumatoid arthritis, systemic lupus erythematosus, or scleroderma. Other complications include pneumonia, polmunary fibrosis, interstitial nephritis, inflammation of the tissue around the kidney's filters, glomerulonephritis, renal tubular acidosis, carpal tunnel syndrome, peripheral neuropathy, cranial neuropathy, primary biliary cirrhosis (PBC), cirrhosis, Inflammation in the esophagus, stomach, pancreas, and liver (including hepatitis), Polymyositis, Raynaud's phenomenon, Vasculitis, Autoimmune thyroid problems, lymphoma.
- As used herein, “systemic lupus erythematosus”, refers to all types and stages of systemic lupus erythematosus, including, but not limited to discoid lupus, lupus arthritis, lupus pneumonitis, lupus nephritis. Conditions relating to systemic lupus erythematosus include osteoarticular tuberculosis, antiphospholipid antibody syndrome, inflammation of various parts of the heart, such as pericarditis, myocarditis, and endocarditis, Lung and pleura inflammation, pleuritis, pleural effusion, chronic diffuse interstitial lung disease, pulmonary hypertension, pulmonary emboli, pulmonary hemorrhage, and shrinking lung syndrome, lupus headache, Guillain-Barré syndrome, aseptic meningitis, demyelinating syndrome, mononeuropathy, mononeuritis multiplex, myasthenia gravis, myelopathy, cranial neuropathy, polyneuropathy, vasculitis.
- As used herein the term “infectious disorder and/or disease” and/or “infection”, used interchangeably, includes any disorder, disease and/or condition caused by presence and/or growth of pathogenic biological agent in an individual host organism. As used herein the term “infection” comprises the disorder, disease and/or condition as above, exhibiting clinically evident illness (i.e., characteristic medical signs and/or symptoms of disease) and/or which is asymtomatic for much or all of it course. As used herein the term “infection” also comprises disorder, disease and/or condition caused by persistence of foreign antigen that lead to exhaustion T cell phenotype characterized by impaired functionality which is manifested as reduced proliferation and cytokine production. As used herein the term “infectious disorder and/or disease” and/or “infection”, further includes any of the below listed infectious disorders, diseases and/or conditions, caused by a bacterial infection, viral infection, fungal infection and /or parasite infection.
- As used herein the term “viral infection” comprises any infection caused by a virus, optionally including but not limited to Retroviridae (e.g., human immunodeficiency viruses, such as HIV-1 or HIV-2, acquired immune deficiency (AIDS) also referred to as HTLV-III, LAV or HTLV-III/LAV, or HIV-III; and other isolates, such as HIV-LP; Picornaviridae (e.g., polio viruses, hepatitis A virus; enteroviruses, human coxsackie viruses, rhinoviruses, echoviruses);
- Calciviridae (e.g., strains that cause gastroenteritis); Togaviridae (e.g., equine encephalitis viruses, rubella viruses); Flaviridae (e.g., dengue viruses, encephalitis viruses, yellow fever viruses); Coronaviridae (e.g., coronaviruses); Rhabdoviridae (e.g., vesicular stomatitis viruses, rabies viruses); Filoviridae (e.g., ebola viruses); Paramyxoviridae (e.g., parainfluenza viruses, mumps virus, measles virus, respiratory syncytial virus); Orthomyxoviridae (e.g., influenza viruses); Bungaviridae (e.g., Hantaan viruses, bunga viruses, phleboviruses and Nairo viruses); Arena viridae (hemorrhagic fever virus); Reoviridae (e.g., reoviruses, orbiviruses and rotaviruses); Birnaviridae; Hepadnaviridae (Hepatitis B virus); Parvoviridae (parvoviruses); Papovaviridae (papilloma viruses, polyoma viruses); Adenoviridae (most adenoviruses); Herperviridae (herpes simplex virus (HSV) 1 and 2, varicella zoster virus, cytomegalovirus (CMV), herpes viruses); Poxviridae (variola virsues, vaccinia viruses, pox viruses); and Iridoviridae (e.g., African swine fever virus); and unclassified viruses (e.g., the etiological agents of Spongiform encephalopathies, the agent of delta hepatitides (thought to be a defective satellite of hepatitis B virus), the agents of non-A, non-B hepatitis (class 1-internally transmitted; class 2-parenterally transmitted (i.e., Hepatitis C); Norwalk and related viruses, and astroviruses) as well as Severe acute respiratory syndrome virus and respiratory syncytial virus (RSV).
- As used herein the term “fungal infection” comprises any infection caused by a fungi, optionally including but not limited to Cryptococcus neoformans, Histoplasma capsulatum, Coccidioides immitis, Blastomyces dermatitidis, Chlamydia trachomatis, Candida albicans. As used herein the term “parasite infection” comprises any infection caused by a parasite, optionally including but not limited to protozoa, such as Amebae, Flagellates, Plasmodium falciparum, Toxoplasma gondii, Ciliates, Coccidia, Microsporidia, Sporozoa; helminthes, Nematodes (Roundworms), Cestodes (Tapeworms), Trematodes (Flukes), Arthropods, and aberrant proteins known as prions.
- An infectious disorder and/or disease caused by bacteria may optionally comprise one or more of Sepsis, septic shock, sinusitis, skin infections, pneumonia, bronchitis, meningitis, Bacterial vaginosis, Urinary tract infection (UCI), Bacterial gastroenteritis, Impetigo and erysipelas, Erysipelas, Cellulitis, anthrax, whooping cough, lyme disease, Brucellosis, enteritis, acute enteritis, Tetanus, diphtheria, Pseudomembranous colitis, Gas gangrene, Acute food poisoning, Anaerobic cellulitis, Nosocomial infections, Diarrhea, Meningitis in infants, Traveller's diarrhea, Hemorrhagic colitis, Hemolytic-uremic syndrome, Tularemia, Peptic ulcer, Gastric and Duodenal ulcers, Legionnaire's Disease, Pontiac fever, Leptospirosis, Listeriosis, Leprosy (Hansen's disease), Tuberculosis, Gonorrhea, Ophthalmia neonatorum, Septic arthritis, Meningococcal disease including meningitis, Waterhouse-Friderichsen syndrome, Pseudomonas infection, Rocky mountain spotted fever, Typhoid fever type salmonellosis, Salmonellosis with gastroenteritis and enterocolitis, Bacillary dysentery/Shigellosis, Coagulase-positive staphylococcal infections: Localized skin infections including Diffuse skin infection (Impetigo), Deep localized infections, Acute infective endocarditis, Septicemia, Necrotizing pneumonia, Toxinoses such as Toxic shock syndrome and Staphylococcal food poisoning, Cystitis, Endometritis, Otitis media, Streptococcal pharyngitis, Scarlet fever, Rheumatic fever, Puerperal fever, Necrotizing fasciitis, Cholera, Plague (including Bubonic plague and Pneumonic plague), as well as any infection caused by a bacteria selected from but not limited to Helicobacter pyloris, Boreliai burgdorferi, Legionella pneumophilia, Mycobacteria sps (e.g., M. tuberculosis, M. avium, M. Intracellulare, M. kansaii, M gordonae), Staphylococcus aureus, Neisseria gonorrhoeae, Neisseria meningitidis, Listeria monocytogenes, Streptococcus pyogenes (Group A Streptococcus), Streptococcus agalactiae (Group B Streptococcus), Streptococcus (viridans group), Streptococcus faecalis, Streptococcus bovis, Streptococcus (anaerobic sps.), Streptococcus pneumoniae, pathogenic Campylobacter sp., Enterococcus sp Haemophilus influenzae, Bacillus antracis, corynebacterium diphtheriae, corynebacterium sp., Erysipelothrix rhusiopathiae, Clostridium perfringers, Clostridium tetani, Enterobacter erogenes, Klebsiella pneuomiae, Pasturella multicoda, Bacteroides sp., Fusobacterium nucleatum, Sreptobacillus moniliformis, Treponema pallidium, Treponema pertenue, Leptospira, and Actinomeyces israelli.
- Non limiting examples of infectious disorder and/or disease caused by virus is selected from the group consisting of but not limited to acquired immune deficiency (AIDS), West Nile encephalitis, coronavirus infection, rhinovirus infection, influenza, dengue, hemorrhagic fever; an otological infection; severe acute respiratory syndrome (SARS), acute febrile pharyngitis, pharyngoconjunctival fever, epidemic keratoconjunctivitis, infantile gastroenteritis, infectious mononucleosis, Burkitt lymphoma, acute hepatitis, chronic hepatitis, hepatic cirrhosis, hepatocellular carcinoma, primary HSV-1 infection, (gingivostomatitis in children, tonsillitis & pharyngitis in adults, keratoconjunctivitis), latent HSV-1 infection (herpes labialis, cold sores), aseptic meningitis, Cytomegalovirus infection, Cytomegalic inclusion disease, Kaposi sarcoma, Castleman disease, primary effusion lymphoma, influenza, measles, encephalitis, postinfectious encephalomyelitis, Mumps, hyperplastic epithelial lesions (common, flat, plantar and anogenital warts, laryngeal papillomas, epidermodysplasia verruciformis), croup, pneumonia, bronchiolitis, Poliomyelitis, Rabies, bronchiolitis, pneumonia, German measles, congenital rubella, Hemorrhagic Fever, Chickenpox, Dengue, Ebola infection, Echovirus infection, EBV infection, Fifth Disease, Filovirus, Flavivirus, Hand, foot & mouth disease, Herpes Zoster Virus (Shingles), Human Papilloma Virus Associated Epidermal Lesions, Lassa Fever, Lymphocytic choriomeningitis, Parainfluenza Virus Infection, Paramyxovirus, Parvovirus B19 Infection, Picornavirus , Poxviruses infection, Rotavirus diarrhea, Rubella, Rubeola, Varicella, Variola infection. An infectious disorder and/or disease caused by fungi optionally includes but is not limited to Allergic bronchopulmonary aspergillosis, Aspergilloma, Aspergillosis, Basidiobolomycosis, Blastomycosis, Candidiasis, Chronic pulmonary aspergillosis, Chytridiomycosis, Coccidioidomycosis, Conidiobolomycosis, Covered smut (barley), Cryptococcosis, Dermatophyte, Dermatophytid, Dermatophytosis, Endothrix, Entomopathogenic fungus, Epizootic lymphangitis, Epizootic ulcerative syndrome, Esophageal candidiasis, Exothrix, Fungemia, Histoplasmosis, Lobomycosis, Massospora cicadina, Mycosis, Mycosphaerella fragariae, Myringomycosis, Paracoccidioidomycosis, Pathogenic fungi, Penicilliosis, Thousand cankers disease, Tinea, Zeaspora, Zygomycosis.Non limiting examples of infectious disorder and/or disease caused by parasites is selected from the group consisting of but not limited to Acanthamoeba, Amoebiasis, Ascariasis, Ancylostomiasis, Anisakiasis, Babesiosis, Balantidiasis, Baylisascariasis, Blastocystosis, Candiru, Chagas disease, Clonorchiasis, Cochliomyia, Coccidia, Chinese Liver Fluke Cryptosporidiosis, Dientamoebiasis, Diphyllobothriasis, Dioctophyme renalis infection, Dracunculiasis, Echinococcosis, Elephantiasis, Enterobiasis, Fascioliasis, Fasciolopsiasis, Filariasis, Giardiasis, Gnathostomiasis, Hymenolepiasis, Halzoun Syndrome, Isosporiasis, Katayama fever, Leishmaniasis, lymphatic filariasis, Malaria, Metagonimiasis, Myiasis, Onchocerciasis, Pediculosis, Primary amoebic meningoencephalitis, Parasitic pneumonia, Paragonimiasis, Scabies, Schistosomiasis, Sleeping sickness, Strongyloidiasis, Sparganosis, Rhinosporidiosis, River blindness, Taeniasis (cause of Cysticercosis), Toxocariasis, Toxoplasmosis, Trichinosis, Trichomoniasis, Trichuriasis, Trypanosomiasis, Tapeworm infection.
- A preferred example of infectious disease is a disease caused by any of hepatitis B, hepatitis C, infectious mononucleosis, EBV, cytomegalovirus, AIDS, HIV-1, HIV-2, tuberculosis, malaria and schistosomiasis.
- As used herein, the term “vaccine” refers to a biological preparation that improves immunity to a particular disease, wherein the vaccine includes an antigen, such as weakened or killed forms of pathogen, its toxins or one of its surface proteins, against which immune responses are elicited. A vaccine typically includes an adjuvant as immune potentiator to stimulate the immune system. As used herein, the term “therapeutic vaccine” and/or “therapeutic vaccination” refers to a vaccine used to treat ongoing disease, such as infectious disease.
- As used herein, the term “adjuvant” refers to an agent used to stimulate the immune system and increase the response to a vaccine, without having any specific antigenic effect in itself.
- As used herein, a “costimulatory polypeptide” or “costimulatory molecule” is a polypeptide that, upon interaction with a cell-surface molecule on T cells, modulates T cell responses.
- As used herein, a “costimulatory signaling” is the signaling activity resulting from the interaction between costimulatory polypeptides on antigen presenting cells and their receptors on T cells during antigen-specific T cell responses. Without wishing to be limited by a single hypothesis, the antigen-specific T cell response is believed to be mediated by two signals: 1) engagement of the T cell Receptor (TCR) with antigenic peptide presented in the context of MHC (signal 1), and 2) a second antigen-independent signal delivered by contact between different costimulatory receptor/ligand pairs (signal 2). Without wishing to be limited by a single hypothesis, this “second signal” is critical in determining the type of T cell response (activation vs inhibition) as well as the strength and duration of that response, and is regulated by both positive and negative signals from costimulatory molecules, such as the B7 family of proteins.
- As used herein, the term “B7” polypeptide means a member of the B7 family of proteins that costimulate T cells including, but not limited to B7-1, B7-2, B7-DC, B7-H5, B7-H1, B7-H2, B7-H3, B7-H4, B7-H6, B7-S3 and biologically active fragments and/or variants thereof. Representative biologically active fragments include the extracellular domain or fragments of the extracellular domain that costimulate T cells.
- As used herein, “inflammatory molecules” refers to molecules that induce inflammatory responses (directly or indirectly) including, but not limited to, cytokines and metalloproteases such as including, but not limited to, IL-1beta, TNF-alpha, TGF-beta, IFN-gamma, IL-17, IL-6, IL-23, IL-22, IL-21, and MMPs.
- As used herein, the term “vaccine” refers to a biological preparation that improves immunity to a particular disease, wherein the vaccine includes an antigen, such as weakened or killed forms of pathogen, its toxins or one of its surface proteins, against which immune responses are elicited. A vaccine typically includes an adjuvant as immune potentiator to stimulate the immune system. As used herein, the term “therapeutic vaccine” and/or “therapeutic vaccination” refers to a vaccine used to treat ongoing disease, such as infectious disease.
- As used herein, the term “adjuvant” refers to an agent used to stimulate the immune system and increase the response to a vaccine, without having any specific antigenic effect in itself.
- As used herein, a “vector” is a replicon, such as a plasmid, phage, or cosmid, into which another DNA segment may be inserted so as to bring about the replication of the inserted segment. The vectors described herein can be expression vectors. As used herein, an “expression vector” is a vector that includes one or more expression control sequences
- As used herein, an “expression control sequence” is a DNA sequence that controls and regulates the transcription and/or translation of another DNA sequence.
- “Operably linked” refers to an arrangement of elements wherein the components so described are configured so as to perform their usual or intended function. Thus, two different polypeptides operably linked together retain their respective biological functions while physically linked together.
- As used herein, “valency” refers to the number of binding sites available per molecule.
- As used herein, a “variant” polypeptide contains at least one amino acid sequence alteration as compared to the amino acid sequence of the corresponding wild-type polypeptide.
- As used herein, “conservative” amino acid substitutions are substitutions wherein the substituted amino acid has similar structural or chemical properties. As used herein, the term “host cell” refers to prokaryotic and eukaryotic cells into which a recombinant vector can be introduced.
- As used herein, “transformed” and “transfected” encompass the introduction of a nucleic acid (e.g. a vector) into a cell by a number of techniques known in the art.
- As used herein, the terms “immunologic”, “immunological” or “immune” response is the development of a beneficial humoral (antibody mediated) and/or a cellular (mediated by antigen-specific T cells or their secretion products) response directed against a peptide in a recipient patient. Such a response can be an active response induced by administration of immunogen or a passive response induced by administration of antibody or primed T-cells. Without wishing to be limited by a single hypothesis, a cellular immune response is elicited by the presentation of polypeptide epitopes in association with Class I or Class II MHC molecules to activate antigen-specific CD4+ T helper cells and/or CD8+ cytotoxic T cells. The response may also involve activation of monocytes, macrophages, NK cells, basophils, dendritic cells, astrocytes, microglia cells, eosinophils, activation or recruitment of neutrophils or other components of innate immunity. The presence of a cell-mediated immunological response can be determined by proliferation assays (CD4+ T cells) or CTL (cytotoxic T lymphocyte) assays. The relative contributions of humoral and cellular responses to the protective or therapeutic effect of an immunogen can be distinguished by separately isolating antibodies and T-cells from an immunized syngeneic animal and measuring protective or therapeutic effect in a second subject.
- An “immunogenic agent” or “immunogen” is capable of inducing an immunological response against itself on administration to a mammal, optionally in conjunction with an adjuvant.
- As used herein, the term “C1ORF32” refers to the protein encoded by any one of the H19011_1_T8 (SEQ ID NO:1), H19011_1_T9 (SEQ ID NO:2) transcripts reported herein, particularly to proteins as set forth in any one of H19011_1_P8 (SEQ ID NO:4), H19011_1_P8_V1 (SEQ ID NO:5), H19011_1_P9 (SEQ ID NO:6) or H19011_1_P9_V1 (SEQ ID NO:34), variants and fragments thereof, which can have therapeutic effect on immune related disorder and/or infection.
- Fragments of C1ORF32 polypeptides
- As used herein the term “soluble C1ORF32” or “soluble C1ORF32 proteins/molecules” refers to fragments of C1ORF32 that include some or all of the IgV domain of the C1ORF32 polypeptide, and lack some or all of the intracellular and/or transmembrane domains, wherein said fragments retain a biological activity of inhibition of T cell activation.
- The soluble C1ORF32 molecules used in the methods of the invention may or may not include a signal (leader) peptide sequence.
- Various fragments are given in Table 1 below. “N-term” refers to the N-terminus, so “first N-term” refers to the N-terminus. Particular sequences of interest, according to at least some embodiments of the present invention, include but are not limited to SEQ ID NOs: 29, 30, 41-105, and/or 45, 64, or 96. It should be noted that one or more activities and/or functions ascribed herein to any of SEQ ID NOs: 29, 30, 41-105 are also applicable to any of SEQ ID NOs: 45, 64 or 96.
- The below table describes a number of sequences with abbreviations, which are defined as follows. The terms “first N-term” and “second N-term” refer to the two potential start points of the IgV domain, as shown in
FIG. 1 . The terms “#1 option cut point” (and “#2 option cut point”) refer to different possible C-terminal end points of the soluble protein—also as shown inFIG. 1 .FIG. 1 shows five different possible C-terminal end points, which are as follows: the end of the IgV domain, #1 option cut point, #2 option cut point, the end of the produced protein, and the position before the start of the predicted TM (transmembrane region, which occurs two amino acids after the end of the produced protein). Reference to “+1” or “−1” from a reference point indicate one amino acid after or before that point, respectively, with larger numbers indicating a greater number of amino acids after or before that point as stated below. - The right-most column relates to the SEQ ID NO of the amino acid sequence fused to an
- Fc sequence (hIgG1 C220S-SEQ ID NO 115) to form a fusion protein; for example, the amino acid sequence having SEQ ID NO:14, given as fused the above Fc sequence, has SEQ ID NO:116 as a fusion protein.
-
TABLE 1 amino acid sequences discussed in the present application SEQ ID NO with Fc (hIgG1 C220S- SEQ SEQ ID ID 115) NO: Amino acid sequence Description fusion 14 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV residues 21-184 116 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE of WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG H19011_1_P8 REITIVHDADLQIGKLMWGDSGLYYCIITTPDD LEGKNEGSLGLLVLGRTGLLADLLPSFAVEIM 15 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV residues 21-169 117 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE of WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG H19011_1_P9 REITIVHDADLQIGKLMWGDSGLYYCIITTPDD LEGKNEGSLGLLVLEWV 19 MDRVLLRWISLFWLTAMVEGLQVTVPDKKKVAM residues 1-184 118 LFQPTVLRCHFSTSSHQPAVVQWKFKSYCQDRM f the sequence GESLGMSSTRAQSLSKRNLEWDPYLDCLDSRRT H19011_1_P8_V1 VRVVASKQGSTVTLGDFYRGREITIVHDADLQI GKLMWGDSGLYYCIITTPDDLEGKNEDSVELLV LGRTGLLADLLPSFAVEIM 28 MDRVLLRWISLFWLTAMVEGLQVTVPDKKKVAM residues 119 LFQPTVLRCHFSTSSHQPAVVQWKFKSYCQDRM 1-169 of GESLGMSSTRAQSLSKRNLEWDPYLDCLDSRRT H19011_1_P9 VRVVASKQGSTVTLGDFYRGREITIVHDADLQI GKLMWGDSGLYYCIITTPDDLEGKNEGSLGLLV LEW 29 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV residues 120 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE 21-167 of WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG HI9011_1_P8_V1 REITIVHDADLQIGKLMWGDSGLYYCIITTPDD LEGKNEDSVELLVLG 30 CHFSTSSHQPAVVQWKFKSYCQDRMGESLGMSS residues 121 TRAQSLSKRNLEWDPYLDCLDSRRTVRVVASKQ 42-145 of GSTVTLGDFYRGREITIVHDADLQIGKLMWGDS (H19011_1_P8 GLYYC from first C residue to last C residue) 35 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV H19011_1_P 8_V1_ 122 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE from_21_to_184 WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG (first N- REITIVHDADLQIGKLMWGDSGLYYCIITTPDD term to LEGKNEDSVELLVLGRTGLLADLLPSFAVEIM end of produced ECD −2 from end of predicted ECD) 36 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV residues 123 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE 21-169 of WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG H19011_1_P9_V1 REITIVHDADLQIGKLMWGDSGLYYCIITTPDD LEGKNEDSVELLVLEWV 37 MDRVLLRWISLFWLTAMVEGLQVTVPDKKKVAM residues 1-184 of 124 LFQPTVLRCHFSTSSHQPAVVQWKFKSYCQDRM H19011_1_P8 GESLGMSSTRAQSLSKRNLEWDPYLDCLDSRRT VRVVASKQGSTVTLGDFYRGREITIVHDADLQI GKLMWGDSGLYYCIITTPDDLEGKNEGSLGLLV LGRTGLLADLLPSFAVSIM 40 MDRVLLRWISLFWLTAMVEGLQVTVPDKKKVAM residues 1-169 of 125 LFQPTVLRCHFSTSSHQPAVVQWKFKSYCQDRM H19011_1_P9_V1 GESLGMSSTRAQSLSKRNLEWDPYLDCLDSRRT VRVVASKQGSTVTLGDFYRGREITIVHDADLQI GKLMWGDSGLYYCIITTPDDLEGKNEDSVELLV LEWV 41 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV residues 126 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE 21-167 of WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG H19011_1_P8 REITIVHDADLQIGKLMWGDSGLYYCIITTPDD (first N- LEGKNEGSLGLLVLG term to end of IgV) 42 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV HI 9011_1_P8_ 127 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE V1_from_21_ WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG to_164 (first N- REITIVHDADLQIGKLMWGDSGLYYCIITTPDD term to −3 LEGKNEDSVELL from end of IgV) 43 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV H19011_1_P8_V1_ 128 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE from_21_to_165 WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG (first N-term REITIVHDADLQIGKLMWGDSGLYYCIITTPDD to −2 from LEGKNEDSVELLV end of IgV) 44 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV H19011_1_P8_V1_ 129 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE from_21_to_166 WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG (first N- REITIVHDADLQIGKLMWGDSGLYYCIITTPDD term to −1 LEGKNEDSVELLVL from end of IgV) 45 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV H19011_1_P8_V1_ 130 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE from_21_to_184 WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG (first N- REITIVHDADLQIGKLMWGDSGLYYCIITTPDD term to end of LEGKNEDSVELLVLGRTGLLADLLPSGGVEIM produced ECD with FA- >GG mutation) 46 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV H19011_1_P8_V1_ 131 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE from_21_to_168 WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG (first N- REITIVHDADLQIGKLMWGDSGLYYCIITTPDD term to +1 LEGKNEDSVELLVLGR after end of IgV) 47 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV H19011_1_P8_V1_ 132 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE from_21_to_169 WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG (first N- REITIVHDADLQIGKLMWGDSGLYYCIITTPDD term to +2 LEGKNEDSVELLVLGRT after end of IgV) 48 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV H19011_1_P8_V1_ 133 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE from_21_to_170 WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG (first N- REITIVHDADLQIGKLMWGDSGLYYCIITTPDD term to +3 LEGKNEDSVELLVLGRTG after end of IgV − 3 before #1 option cut point) 49 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV H19011_1_p8_V1_ 134 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE from_21_to_171 WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG (first N- REITIVHDADLQIGKLMWGDSGLYYCIITTPDD term to −2 LEGKNEDSVELLVLGRTGL before #1 option cut point) 50 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV H19011_1_P8_V1_ 135 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE from_21_to_172 WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG (first N- REITIVHDADLQIGKLMWGDSGLYYCIITTPDD term to −1 LEGKNEDSVELLVLGRTGLL before #1 option cut point) 51 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV H19011_1_P8_V1_ 136 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE from_21_to_173 WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG (first N- REITIVHDADLQIGKLMWGDSGLYYCIITTPDD term to #1 LEGKNEDSVELLVLGRTGLLA option cut point) 52 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV H19011_1_p8_V1_ 137 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE from_21_to_174 WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG (first N- REITIVHDADLQIGKLMWGDSGLYYCIITTPDD term to +1 LEGKNEDSVELLVLGRTGLLAD after #1 option cut point) 53 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV H19011_1_P8_V1_ 138 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE from_21_to_175 WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG (first N- REITIVHDADLQIGKLMWGDSGLYYCIITTPDD term to +2 LEGKNEDSVELLVLGRTGLLADL after #1 option cut point −3 before #2 option cut point) 54 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV HI9011_1_P8_V1_ 139 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE from_21_to_176 WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG (first N- REITIVHDADLQIGKLMWGDSGLYYCIITTPDD term to +3 LEGKNEDSVELLVLGRTGLLADLL after #1 option cut point −2 before #2 option cut point) 55 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV HI 9011_1_P8_V1_ 140 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE from_21_to_177 WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG (first N- REITIVHDADLQIGKLMWGDSGLYYCIITTPDD term to −1 LEGKNEDSVELLVLGRTGLLADLLP before #2 option cut point) 56 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV HI9011_1_P8_V1_ 141 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE from_21_to_178 WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG (first N- REITIVHDADLQIGKLMWGDSGLYYCIITTPDD term to #2 LEGKNEDSVELLVLGRTGLLADLLPS option cut point 57 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV H19011_1_P8_V1_ 142 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE from_21_to_179 WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG (first N- REITIVHDADLQIGKLMWGDSGLYYCIITTPDD term to +1 LEGKNEDSVELLVLGRTGLLADLLPSF after #2 option cut point) 58 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV H19011_1_P8_V1_ 143 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE from_21_to_180 WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG (first N- REITIVHDADLQIGKLMWGDSGLYYCIITTPDD term to +2 LEGKNEDSVELLVLGRTGLLADLLPSFA after #2 option cut point) 59 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV H19011_1_P8_V1_ 144 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE from_21_to_181 WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG (first M- REITIVHDADLQIGKLMWGDSGLYYCIITTPDD term to +3 LEGKNEDSVELLVLGRTGLLADLLPSFAV after #2 option cut point −3 from end of produced ECD) 60 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV H19011_1_P8_V1_ 145 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE from_21_to_182 WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG (first N-term REITIVHDADLQIGKLMWGDSGLYYCIITTPDD to −2 from LEGKNEDSVELLVLGRTGLLADLLPSFAVE end of produced ECD) 61 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV H19011_1_P8_V1_ 146 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE from_21_to_183 WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG (first N- REITIVHDADLQIGKLMWGDSGLYYCIITTPDD term to −1 LEGKNEDSVELLVLGRTGLLADLLPSFAVEI from end of produced ECD −3 from end of predicted ECD) 62 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV H19011_1_P8_V1 147 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE from 21 to 186 WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG (first N- REITIVHDADLQIGKLMWGDSGLYYCIITTPDD term to end of LEGKNEDSVELLVLGRTGLLADLLPSFAVEIMP predicted ECD) E 63 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV H19011_1_P8_V1_ 148 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE from_21_to_185 WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG (first N- REITIVHDADLQIGKLMWGDSGLYYCIITTPDD term to +1 LEGKNEDSVELLVLGRTGLLADLLPSFAVEIMP after produced ECD −1 from end of predicted ECD) 64 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV HI9011_1_P8_V1_ 149 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE from_21_to_184 WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG (first N- REITIVHDADLQIGKLMWGDSGLYYCIITTPDD term to end of LEGKNEDSVELLVLGRTGLLADLLPSGAVEIM produced ECD with FA- >GA mutation) 65 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV HI9011_1_P8_V1_ 150 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE from_21_to_187 WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG (first N-term REITIVHDADLQIGKLMWGDSGLYYCIITTPDD to +3 after LEGKNEDSVELLVLGRTGLLADLLPSFAVEIMP produced EW ECD +1 in predicted TM) 66 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV H19011_1_P8_V1_ 151 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE from_21_to_188 WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG (first N- REITIVHDADLQIGKLMWGDSGLYYCIITTPDD term to +2 in LEGKNEDSVELLVLGRTGLLADLLPSFAVEIMP predicted TM) EWV 67 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV H19011_1_P8_V1_ 152 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE from_2 WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG 1_to_189 REITIVHDADLQIGKLMWGDSGLYYCIITTPDD (first N- LSGKNEDSVELLVLGRTGLLADLLPSFAVEIMP term to +3 in EWVF predicted TM) 68 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK H19011_1_P8_V1_ 153 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD from_2 CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV 7_to_164 HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE (second N- DSVELL term to −3 from end of IgV) 69 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK H19011_1_P8_V1_ 154 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD from_27_to_165 CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV (second N- HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE term to −2 DSVELLV from end of IgV) 70 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK H19011_1_P8_V1_ 155 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD from_27_to_166 CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV (second N- HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE term to −1 DSVELLVL from end of IgV) 71 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK H19011_1_P8_V1_ 156 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD from_27_to_167 CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV (second N- HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE term to end DSVELLVLG of IgV) 72 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK H19011_1_P8_V1_ 157 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD from_27_to_168 CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV (second N- HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE term to +1 DSVELLVLGR after end of IgV) 73 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK H19011_1_P8_V1_ 158 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD from_27_to_169 CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV (second N- HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE term to +2 DSVELLVLGRT after end of IgV) 74 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK H19011_1_P8_V1_ 159 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD from_27_to_170 CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV (second N- HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE term to +3 DSVELLVLGRTG after end of IgV −3 before +190 1 option cut point) 75 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK H19011_1_P8_V1_ 160 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD from_27_to_171 CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV (second N- HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE term to −2 DSVELLVLGRTGL before +190 1 option cut point) 76 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK H1 9011_1_P8_V1_ 161 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD from_27_to_172 CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV (second N- HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE term to −1 DSVELLVLGRTGLL before +190 1 option cut point) 77 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK H1 9011_1_P8_V1_ 162 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD from_27_to_173 CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV (second N- HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE term to +190 1 DSVELLVLGRTGLLA option cut point) 78 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK H19011_1_P8_V1_ 163 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD from_27_to_174 CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV (second N- HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE term to +1 DSVELLVLGRTGLLAD after +190 1 option cut point) 79 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK H19011_1_P8_V1_ 164 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD from_27_to_175 CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV (second N- HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE term to +2 after DSVELLVLGRTGLLADL #190 1 option cut point −3before #190 2 option cut point) 80 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK HI9011_1_P8_V1_ 165 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD from_27_to_176 CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV (second N- HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE term to +3 DSVELLVLGRTGLLADLL after #190 1 option cut point −2 before #190 2 option cut point) 81 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK H19011_1_P8_V1_ 166 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD from_27_to_177 CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV (second N- HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE term to −1 DSVELLVLGRTGLLADLLP before #190 2 option cut point) 82 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK HI9011_1_P8_V1_ 167 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD from_27_to_178 CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV (second N- HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE term to #190 2 DSVELLVLGKTGLLADLLPS option cut point) 83 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK HI9011_1_P8_V1_ 168 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD from_27_to_179 CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV (second N- HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE term to +1 DSVELLVLGRTGLLADLLPSF after #190 2 option cut point) 84 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK H19011_1_P8_V1_ 169 SYCQDRMGSSLGMSSTRAQSLSKRNLEWDPYLD from_27_to_180 CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV (second N- HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE term to +2 DSVELLVLGRTGLLADLLPSFA after #190 2 option cut point) 85 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK H19011_1_P8_V1_ 170 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD from_27_to_181 CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV (second N- HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE term to +3 DSVELLVLGRTGLLADLLPSFAV after #190 2 option cut point −3 from end of produced ECD) 86 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK H19011_1_P8_V1_ 171 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD from_27_to_182 CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV (second N- HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE term to −2 DSVELLVLGRTGLLADLLPSFAVE from end of produced ECD) 87 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK H19011_1_P8_V1_ 172 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD from_27_to_183 CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV (second N- HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE term to −1 DSVELLVLGRTGLLADLLPSFAVEI from end of produced ECD −3 from end of predicted ECD) 88 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK H1901 1_1_P8_V1_ 173 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD from_27_to_184 CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV (second N- HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE term to end of DSVELLVLGRTGLLADLLPSFAVEIM produced ECD −2 from end of predicted ECD) 89 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK HI9011_1_P8_V1_ 174 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD from_27_to_185 CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV (second N- HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE term to +1 DSVELLVLGRTGLLADLLPSFAVEIMP after end of produced ECD −1 from end of predicted ECD) 90 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK H19011_1_P8_V1_ 175 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD from_27_to_186 CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV (second N- HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE term to +2 DSVELLVLGRTGLLADLLPSFAVEIMPE after end of produced ECD end of predicted ECD) 91 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK HI9011_1_P8_V1_ 176 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD from_27_to_187 CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV (second N- HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE term to +2 DSVELLVLGRTGLLADLLPSFAVEIMPEW after end of produced ECD +1 in predicted TM) 92 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK H19011_1_P8_V1_ 177 SYCQDRMGSSLGMSSTRAQSLSKRNLEWDPYLD from_27_to_188 CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV (second N- HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE term to +2 in DSVELLVLGRTGLLADLLPSFAVEIMPEWV predicted TM) 93 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK H19011_1_P8_V1_ 178 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD from_2 CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV 7_to_189 HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE (second N- DSVELLVLGRTGLLADLLPSFAVEIMPEWVF term to +3 in predicted TM) 94 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV H19011_1_P9_V1_ 179 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE from_21_to_167 WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG (first N- REITIVHDADLQIGKLMWGDSGLYYCIITTPDD term to −2 LEGKNEDSVELLVLE from end of predicted ECD) 95 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV H19011_1_P9_V1_ 180 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE from_21_to_168 WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG (first N- REITIVHDADLQIGKLMWGDSGLYYCIITTPDD term to −1 LEGKNEDSVELLVLEW from end of predicted ECD) 96 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV H19011_1_P8_V1_ 181 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE from_21_to_184 WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG (first N- REITIVHDADLQIGKLMWGDSGLYYCIITTPDD term to end of LEGKNEDSVELLVLGRTGLLADLLPSAAVEIM produced ECD with FA- >AA mutation) 97 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV H19011_1_P9_V1_ 182 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE from_21_to_170 WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG (first N- REITIVHDADLQIGKLMWGDSGLYYCIITTPDD term to +1 LEGKNEDSVELLVLEWVF predicted TM) 98 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV H19011_1_P9_V1_ 183 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE from_21_to_171 WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG (first N- REITIVHDADLQIGKLMWGDSGLYYCIITTPDD term to +2 LEGKNEDSVELLVLEWVFV predicted TM) 99 LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAV H19011_1_P9_V1_ 184 VQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLE from_21_to_172 WDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRG (first N- REITIVHDADLQIGKLMWGDSGLYYCIITTPDD term to +3 LEGKNEDSVELLVLEWVFVG predicted TM) 100 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK H19011_1_P9_V1_ 185 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD from_27_to_167 CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV (second N- HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE term to −2 DSVELLVLE from end of predicted ECD) 101 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK H19011_1_P9_V1_ 186 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD from_27_to_168 CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV (second N- HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE term to −1 DSVELLVLEW from end of predicted ECD) 102 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK H19011_1_P9_V1_ 187 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD from_27_to_169 CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV (second N- HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE term to end of DSVELLVLEWV predicted ECD) 103 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK H19011_1_P9_V1_ 188 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD from_27_to_170 CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV (second N- HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE term to +1 DSVELLVLEWVF predicted TM) 104 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK H19011_1_P9_V1_ 189 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD from_27_to_171 CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV (second N- HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE term to +2 DSVELLVLEWVFV predicted TM) 105 DKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFK H19011_1_P9_V1_ 190 SYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLD from_27_to_172 CLDSRRTVRVVASKQGSTVTLGDFYRGREITIV (second N- HDADLQIGKLMWGDSGLYYCIITTPDDLEGKNE term to +3 DSVELLVLEWVFVG predicted TM) - In particular, the fragments of the extracellular domain of C1ORF32 can include any sequence corresponding to any portion of or comprising the IgV domain of the extracellular domain of C1ORF32, having any sequence corresponding to residues of H19011_1_P8 (SEQ ID NO:4) starting from any position between 18 and 31 and ending at any position between 157 and 175 or corresponding to residues of H19011_1_P8_V1 (SEQ ID NO:5) starting from any position between 18 and 31 and ending at any position between 157 and 175, or corresponding to residues of H19011_1_P9 (SEQ ID NO:6) starting from any position between 18 and 31 and ending at any position between 159 and 172, or corresponding to residues of H19011_1_P9_V1 (SEQ ID NO:34) starting from any position between 18 and 31 and ending at any position between 159 and 172. The base sequences as given above are without a signal peptide.
- The C1ORF32 proteins contain an immunoglobulin domain within the extracellular domain, the IgV domain (or V domain), which is related to the variable domain of antibodies. The IgV domain may be responsible for receptor binding, by analogy to the other B7 family members. The Ig domain of the extracellular domain includes one disulfide bond formed between intradomain cystein residues, as is typical for this fold and may be important for structure-function. In SEQ ID NO: 4 these cysteines are located at residues 42 and 145.
- In one embodiment, the first fusion partner is a soluble fragment of C1ORF32. Without wishing to be limited by a single hypothesis, it is believed that useful fragments are those that retain the ability to bind to their natural receptor or receptors and/or retain the ability to inhibit T cell activation. A C1ORF32 polypeptide that is a fragment of full-length C1ORF32 typically has at least 20 percent, 30 percent, 40 percent, 50 percent, 60 percent, 70 percent, 80 percent, 90 percent, 95 percent, 98 percent, 99 percent, 100 percent, or even more than 100 percent of the ability to bind its natural receptor(s) and/or of the ability to inhibit T cell activation as compared to full-length C1ORF32. Soluble C1ORF32 polypeptide fragments are fragments of C1ORF32 polypeptides that may be shed, secreted or otherwise extracted from the producing cells. In other embodiments, the soluble fragments of C1ORF32 polypeptides include fragments of the C1ORF32 extracellular domain that retain C1ORF32 biological activity, such as fragments that retain the ability to bind to their natural receptor or receptors and/or retain the ability to inhibit T cell activation. The extracellular domain can include 1, 2, 3, 4, or 5 contiguous amino acids from the transmembrane domain, and/or 1, 2, 3, 4, or 5 contiguous amino acids from the signal sequence. Alternatively, the extracellular domain can have 1, 2, 3, 4, 5 or more amino acids removed from the C-terminus, N-terminus, or both.
- In some embodiments the extracellular domain is only the IgV domain as set forth in SEQ ID NO: 29, or fragments or variants thereof, or the region between the conserved cysteines of the IgV domain which are located at residues 42 and 145 of the full-length protein SEQ ID NO:4, corresponding to the sequence set forth in SEQ ID NO: 30: CHFSTSSHQPAVVQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLDCLDSRR TVRVVASKQGSTVTLGDFYRGREITIVHDADLQIGKLMWGDSGLYYC. In particular, the fragments of the IgV domain can include any sequence corresponding to residues of H19011_1_P8 (SEQ ID NO:4) starting from any position between 18 and 31 and ending at any position between 157 and 175 or corresponding to residues of H19011_1_P8_V1 (SEQ ID NO:5) starting from any position between 18 and 31 and ending at any position between 157 and 175, or corresponding to residues of H19011_1_P9 (SEQ ID NO:6) starting from any position between 18 and 31 and ending at any position between 159 and 172 , or corresponding to residues of H19011_1_P9_V1 (SEQ ID NO:34) starting from any position between 18 and 31 and ending at any position between 159 and 172.
- Generally, the C1ORF32 polypeptide fragments are expressed from nucleic acids that include sequences that encode a signal sequence. The signal sequence is generally cleaved from the immature polypeptide to produce the mature polypeptide lacking the signal sequence. The signal sequence of C1ORF32 can be replaced by the signal sequence of another polypeptide using standard molecule biology techniques to affect the expression levels, secretion, solubility, or other property of the polypeptide. The signal sequence that is used to replace the C1ORF32 signal sequence can be any known in the art.
- In a further embodiment, the fusion protein includes the extracellular domain of C1ORF32, or a fragment thereof fused to an Ig Fc region. Recombinant IgC1ORF32 polypeptides, fragments or fusion proteins thereof fusion proteins can be prepared by fusing the coding region of the extracellular domain of C1ORF32 or a fragment thereof to the Fc region of human IgG1 or mouse IgG2a, as described previously (Chapoval, et al., Methods MoI. Med, 45:247-255 (2000)).
- Variants of C1ORF32 polypeptides
- Useful variants of such C1ORF32 polypeptides include those that increase biological activity, as indicated by any of the assays described herein, or that increase half life or stability of the protein. Soluble C1ORF32 polypeptides and C1ORF32 fragments, or fusions thereof having C1ORF32 activity, can be engineered to increase biological activity. In a further embodiment, the C1ORF32 polypeptide or fusion protein has been modified with at least one amino acid substitution, deletion, or insertion that increases the binding of the molecule to an immune cell, for example a T cell, and transmits an inhibitory signal into the T cell.
- Other optional variants are those C1ORF32 polypetpides that are engineered to selectively bind to one type of T cell versus other immune cells. For example, the C1ORF32 polypeptide can be engineered to bind optionally to Tregs, Th0, Th1, Th17, Th2 or Th22 cells. Preferential binding refers to binding that is at least 10%, 20%, 30%, 40%, 50%, 60%f 70%, 80%, 90%, 95%, or greater for one type of cell over another type of cell.
- Still other variants of C1ORF32 can be engineered to have reduced binding to immune cells relative to wildtype C1ORF32. These variants can be used in combination with variants having stronger binding properties to modulate the immune response with a moderate impact. Also optionally, soluble C1ORF32 polypeptides and C1ORF32 fragments, or fusions thereof having C1ORF32 activity, can be engineered to have an increased half-life relative to wildtype. These variants typically are modified to resist enzymatic degradation. Exemplary modifications include modified amino acid residues and modified peptide bonds that resist enzymatic degradation. Various modifications to achieve this are known in the art.
- Also optionally, variant C1ORF32 polypeptides can be engineered to prevent a cleavage of the full C1ORF32 ECD (SEQ ID NO:14) between amino acids F and A at positions 179 and 180 of H19011_1_P8_V1 or H19011_1_P8 (Seq ID NOs: 4 or 5). According to at least some embodiments of the present invention there is provided one or more amino acid insertions, deletions or substitutions that prevent the cleavage of the C1ORF32 polypeptides, fusion proteins, or fragments thereof. Suitable amino acid substitutions include conservative and non-conservative substitutions, as described above. According to at least some embodiments of the present invention the amino acid substitution in the cleavage site of C1ORF32 ECD at positions 179 and 180 of H19011_1_P8_V1 or H19011_1_P8 (Seq ID NOs: 4 or 5) is selected from but not limited to: FA→GA (as for example disclosed in SEQ ID NO:64); FA→AA (as for example disclosed in SEQ ID NO:96); and FA→GG (as for example disclosed in SEQ ID NO:45).
- The terms “individual”, “host”, “subject”, and “patient” are used interchangeably herein, and refer any human or nonhuman animal. The term “nonhuman animal” includes all vertebrates, e.g., mammals and non-mammals, such as nonhuman primates, sheep, dogs, cats, horses, cows chickens, amphibians, reptiles, etc.
- Various aspects of the invention are described in further detail in the following subsections.
- Nucleic Acids
- A “nucleic acid fragment” or an “oligonucleotide” or a “polynucleotide” are used herein interchangeably to refer to a polymer of nucleic acid residues. A polynucleotide sequence of the present invention refers to a single or double stranded nucleic acid sequences which is isolated and provided in the form of an RNA sequence, a complementary polynucleotide sequence (cDNA), a genomic polynucleotide sequence and/or a composite polynucleotide sequences (e.g., a combination of the above).
- Thus, the present invention encompasses nucleic acid sequences described hereinabove; fragments thereof, sequences hybridizable therewith, sequences homologous thereto e.g., at least 90%, at least 95, 96, 97, 98 or 99% or more identical to the nucleic acid sequences set forth herein, sequences encoding similar polypeptides with different codon usage, altered sequences characterized by mutations, such as deletion, insertion or substitution of one or more nucleotides, either naturally occurring or man induced, either randomly or in a targeted fashion. The present invention also encompasses homologous nucleic acid sequences (i.e., which form a part of a polynucleotide sequence of the present invention), which include sequence regions unique to the polynucleotides of the present invention.
- In cases where the polynucleotide sequences of the present invention encode previously unidentified polypeptides, the present invention also encompasses novel polypeptides or portions thereof, which are encoded by the isolated polynucleotide and respective nucleic acid fragments thereof described hereinabove and/or degenerative variants thereof.
- Thus, the present invention also encompasses polypeptides encoded by the polynucleotide sequences of the present invention. The present invention also encompasses homologues of these polypeptides, such homologues can be at least 90%, at least 95, 96, 97, 98 or 99% or more homologous to the amino acid sequences set forth below, as can be determined using BlastP software of the National Center of Biotechnology Information (NCBI) using default parameters. Finally, the present invention also encompasses fragments of the above described polypeptides and polypeptides having mutations, such as deletions, insertions or substitutions of one or more amino acids, either naturally occurring or man induced, either randomly or in a targeted fashion.
- As mentioned hereinabove, biomolecular sequences of the present invention can be efficiently utilized as tissue or pathological markers and as putative drugs or drug targets for treating or preventing a disease.
- Oligonucleotides designed for carrying out the methods of the present invention for any of the sequences provided herein (designed as described above) can be generated according to any oligonucleotide synthesis method known in the art such as enzymatic synthesis or solid phase synthesis. Equipment and reagents for executing solid-phase synthesis are commercially available from, for example, Applied Biosystems. Any other means for such synthesis may also be employed; the actual synthesis of the oligonucleotides is well within the capabilities of one skilled in the art.
- Oligonucleotides used according to this aspect of the present invention are those having a length selected from a range of about 10 to about 200 bases preferably about 15 to about 150 bases, more preferably about 20 to about 100 bases, most preferably about 20 to about 50 bases.
- The oligonucleotides of the present invention may comprise heterocyclic nucleosides consisting of purines and the pyrimidines bases, bonded in a 3′ to 5′ phosphodiester linkage.
- Preferable oligonucleotides are those modified in either backbone, internucleoside linkages or bases, as is broadly described hereinunder. Such modifications can oftentimes facilitate oligonucleotide uptake and resistivity to intracellular conditions.
- Specific examples of preferred oligonucleotides useful according to this aspect of the present invention include oligonucleotides containing modified backbones or non-natural internucleoside linkages. Oligonucleotides having modified backbones include those that retain a phosphorus atom in the backbone, as disclosed in U.S. Pat. Nos: 4,469,863; 4,476,301; 5,023,243; 5,177,196; 5,188,897; 5,264,423; 5,276,019; 5,278,302; 5,286,717; 5,321,131; 5,399,676; 5,405,939; 5,453,496; 5,455,233; 5,466, 677; 5,476,925; 5,519,126; 5,536,821; 5,541,306; 5,550,111; 5,563,253; 5,571,799; 5,587,361; and 5,625,050.
- Preferred modified oligonucleotide backbones include, for example, phosphorothioates, chiral phosphorothioates, phosphorodithioates, phosphotriesters, aminoalkyl phosphotriesters, methyl and other alkyl phosphonates including 3′-alkylene phosphonates and chiral phosphonates, phosphinates, phosphoramidates including 3′-amino phosphoramidate and aminoalkylphosphoramidates, thionophosphoramidates, thionoalkylphosphonates, thionoalkylphosphotriesters, and boranophosphates having normal 3′-5′ linkages, 2′-5′ linked analogs of these, and those having inverted polarity wherein the adjacent pairs of nucleoside units are linked 3′-5′ to 5′-3′ or 2′-5′ to 5′-2′. Various salts, mixed salts and free acid forms can also be used.
- Alternatively, modified oligonucleotide backbones that do not include a phosphorus atom therein have backbones that are formed by short chain alkyl or cycloalkyl internucleoside linkages, mixed heteroatom and alkyl or cycloalkyl internucleoside linkages, or one or more short chain heteroatomic or heterocyclic internucleoside linkages. These include those having morpholino linkages (formed in part from the sugar portion of a nucleoside); siloxane backbones; sulfide, sulfoxide and sulfone backbones; formacetyl and thioformacetyl backbones; methylene formacetyl and thioformacetyl backbones; alkene containing backbones; sulfamate backbones; methyleneimino and methylenehydrazino backbones; sulfonate and sulfonamide backbones; amide backbones; and others having mixed N, O, S and CH2 component parts, as disclosed in U.S. Pat. Nos. 5,034,506; 5,166,315; 5,185,444; 5,214,134; 5,216,141; 5,235,033; 5,264,562;
- 5,264,564; 5,405,938; 5,434,257; 5,466,677; 5,470,967; 5,489,677; 5,541,307; 5,561,225; 5,596,086; 5,602,240; 5,610,289; 5,602,240; 5,608,046; 5,610,289; 5,618,704; 5,623,070; 5,663,312; 5,633,360; 5,677,437; and 5,677,439.
- Other oligonucleotides which can be used according to the present invention, are those modified in both sugar and the internucleoside linkage, i.e., the backbone, of the nucleotide units are replaced with novel groups. The base units are maintained for complementation with the appropriate polynucleotide target. An example for such an oligonucleotide mimetic, includes peptide nucleic acid (PNA). A PNA oligonucleotide refers to an oligonucleotide where the sugar-backbone is replaced with an amide containing backbone, in particular an aminoethylglycine backbone. The bases are retained and are bound directly or indirectly to aza nitrogen atoms of the amide portion of the backbone. United States patents that teach the preparation of PNA compounds include, but are not limited to, U.S. Pat. Nos. 5,539,082; 5,714,331; and 5,719,262, each of which is herein incorporated by reference. Other backbone modifications, which can be used in the present invention are disclosed in U.S. Pat. No: 6,303,374.
- Oligonucleotides of the present invention may also include base modifications or substitutions. As used herein, “unmodified” or “natural” bases include the purine bases adenine (A) and guanine (G), and the pyrimidine bases thymine (T), cytosine (C) and uracil (U). Modified bases include but are not limited to other synthetic and natural bases such as 5-methylcytosine (5-me-C), 5-hydroxymethyl cytosine, xanthine, hypoxanthine, 2-aminoadenine, 6-methyl and other alkyl derivatives of adenine and guanine, 2-propyl and other alkyl derivatives of adenine and guanine, 2-thiouracil, 2-thiothymine and 2-thiocytosine, 5-halouracil and cytosine, 5-propynyl uracil and cytosine, 6-azouracil, cytosine and thymine, 5-uracil (pseudouracil), 4-thiouracil, 8-halo, 8-amino, 8-thiol, 8-thioalkyl, 8-hydroxyl and other 8-substituted adenines and guanines, 5-halo particularly 5-bromo, 5-trifluoromethyl and other 5-substituted uracils and cytosines, 7-methylguanine and 7-methyladenine, 8-azaguanine and 8-azaadenine, 7-deazaguanine and 7-deazaadenine and 3-deazaguanine and 3-deazaadenine. Further bases include those disclosed in U.S. Pat. No: 3,687,808, those disclosed in The Concise Encyclopedia Of Polymer Science and Engineering, pages 858-859, Kroschwitz, J. I., ed. John Wiley & Sons, 1990, those disclosed by Englisch et al., Angewandte Chemie, International Edition, 1991, 30, 613, and those disclosed by Sanghvi, Y. S., Chapter 15, Antisense Research and Applications, pages 289-302, Crooke, S. T. and Lebleu, B., ed., CRC Press, 1993. Such bases are particularly useful for increasing the binding affinity of the oligomeric compounds of the invention. These include 5-substituted pyrimidines, 6-azapyrimidines and N-2, N-6 and 0-6 substituted purines, including 2-aminopropyladenine, 5-propynyluracil and 5-propynylcytosine. 5-methylcytosine substitutions have been shown to increase nucleic acid duplex stability by 0.6-1.2° C. [Sanghvi YS et al. (1993) Antisense Research and Applications, CRC Press, Boca Raton 276-278] and are presently preferred base substitutions, even more particularly when combined with 2′-O-methoxyethyl sugar modifications.
- Another modification of the oligonucleotides of the invention involves chemically linking to the oligonucleotide one or more moieties or conjugates, which enhance the activity, cellular distribution or cellular uptake of the oligonucleotide. Such moieties include but are not limited to lipid moieties such as a cholesterol moiety, cholic acid, a thioether, e.g., hexyl-S-tritylthiol, a thiocholesterol, an aliphatic chain, e.g., dodecandiol or undecyl residues, a phospholipid, e.g., di-hexadecyl-rac-glycerol or
triethylammonium 1,2-di-O-hexadecyl-rac-glycero-3-H-phosphonate, a polyamine or a polyethylene glycol chain, or adamantane acetic acid, a palmityl moiety, or an octadecylamine or hexylamino-carbonyl-oxycholesterol moiety, as disclosed in U.S. Pat. No: 6,303,374. - It is not necessary for all positions in a given oligonucleotide molecule to be uniformly modified, and in fact more than one of the aforementioned modifications may be incorporated in a single compound or even at a single nucleoside within an oligonucleotide.
- Peptides
- The terms “polypeptide,” “peptide” and “protein” are used interchangeably herein to refer to a polymer of amino acid residues. The terms apply to amino acid polymers in which one or more amino acid residue is an analog or mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers. Polypeptides can be modified, e.g., by the addition of carbohydrate residues to form glycoproteins. The terms “polypeptide,” “peptide” and “protein” include glycoproteins, as well as non-glycoproteins.
- Polypeptide products can be biochemically synthesized such as by employing standard solid phase techniques. Such methods include exclusive solid phase synthesis, partial solid phase synthesis methods, fragment condensation, classical solution synthesis. These methods are preferably used when the peptide is relatively short (i.e., 10 kDa) and/or when it cannot be produced by recombinant techniques (i.e., not encoded by a nucleic acid sequence) and therefore involves different chemistry.
- Solid phase polypeptide synthesis procedures are well known in the art and further described by John Morrow Stewart and Janis Dillaha Young, Solid Phase Peptide Syntheses (2nd Ed., Pierce Chemical Company, 1984).
- Synthetic polypeptides can be purified by preparative high performance liquid chromatography [Creighton T. (1983) Proteins, structures and molecular principles. WH Freeman and Co. N.Y.] and the composition of which can be confirmed via amino acid sequencing.
- In cases where large amounts of a polypeptide are desired, it can be generated using recombinant techniques such as described by Bitter et al., (1987) Methods in Enzymol. 153:516-544, Studier et al. (1990) Methods in Enzymol. 185:60-89, Brisson et al. (1984) Nature 310:511-514, Takamatsu et al. (1987) EMBO J. 6:307-311, Coruzzi et al. (1984) EMBO J. 3:1671-1680 and Brogli et al., (1984) Science 224:838-843, Gurley et al. (1986) Mol. Cell. Biol. 6:559-565 and Weissbach & Weissbach, 1988, Methods for Plant Molecular Biology, Academic Press, NY, Section VIII, pp 421-463.
- It will be appreciated that peptides identified according to the teachings of the present invention may be degradation products, synthetic peptides or recombinant peptides as well as peptidomimetics, typically, synthetic peptides and peptoids and semipeptoids which are peptide analogs, which may have, for example, modifications rendering the peptides more stable while in a body or more capable of penetrating into cells. Such modifications include, but are not limited to N terminus modification, C terminus modification, peptide bond modification, including, but not limited to, CH2—NH, CH2—S, CH2—S=O, O═C—NH, CH2—O, CH2—CH2, S═C—NH, CH═CH or CF═CH, backbone modifications, and residue modification. Methods for preparing peptidomimetic compounds are well known in the art and are specified, for example, in Quantitative Drug Design, C. A. Ramsden Gd., Chapter 17.2, F. Choplin Pergamon Press (1992), which is incorporated by reference as if fully set forth herein. Further details in this respect are provided hereinunder.
- Peptide bonds (—CO—NH—) within the peptide may be substituted, for example, by N-methylated bonds (—N(CH3)—CO—), ester bonds (—C(R)H—C—O—O—C(R)—N—), ketomethylen bonds (—CO—CH2—), α-aza bonds (—NH—N(R)—CO—), wherein R is any alkyl, e.g., methyl, carba bonds (—CH2—NH—), hydroxyethylene bonds (—CH(OH)—CH2—), thioamide bonds (—CS—NH—), olefinic double bonds (—CH═CH—), retro amide bonds (—NH—CO—), peptide derivatives (—N(R)—CH2—CO—), wherein R is the “normal” side chain, naturally presented on the carbon atom.
- These modifications can occur at any of the bonds along the peptide chain and even at several (2-3) at the same time.
- Natural aromatic amino acids, Trp, Tyr and Phe, may be substituted by synthetic non-natural acid such as Phenylglycine, TIC, naphthylelanine (Nol), ring-methylated derivatives of Phe, halogenated derivatives of Phe or o-methyl-Tyr.
- In addition to the above, the peptides of the present invention may also include one or more modified amino acids or one or more non-amino acid monomers (e.g. fatty acids, complex carbohydrates etc).
- As used herein in the specification and in the claims section below the term “amino acid” or “amino acids” is understood to include the 20 naturally occurring amino acids; those amino acids often modified post-translationally in vivo, including, for example, hydroxyproline, phosphoserine and phosphothreonine; and other unusual amino acids including, but not limited to, 2-aminoadipic acid, hydroxylysine, isodesmosine, nor-valine, nor-leucine and ornithine. Furthermore, the term “amino acid” includes both D- and L-amino acids.
- Since the peptides of the present invention are preferably utilized in therapeutics which require the peptides to be in soluble form, the peptides of the present invention preferably include one or more non-natural or natural polar amino acids, including but not limited to serine and threonine which are capable of increasing peptide solubility due to their hydroxyl-containing side chain.
- In cases where large amounts of the peptides of the present invention are desired, the peptides of the present invention can be generated using recombinant techniques such as described by Bitter et al., (1987) Methods in Enzymol. 153:516-544, Studier et al. (1990) Methods in Enzymol. 185:60-89, Brisson et al. (1984) Nature 310:511-514, Takamatsu et al. (1987) EMBO J. 6:307-311, Coruzzi et al. (1984) EMBO J. 3:1671-1680 and Brogli et al., (1984) Science 224:838-843, Gurley et al. (1986) Mol. Cell. Biol. 6:559-565 and Weissbach & Weissbach, 1988, Methods for Plant Molecular Biology, Academic Press, NY, Section VIII, pp 421-463.
- Expression Systems
- To enable cellular expression of the polynucleotides of the present invention, a nucleic acid construct according to the present invention may be used, which includes at least a coding region of one of the above nucleic acid sequences, and further includes at least one cis acting regulatory element. As used herein, the phrase “cis acting regulatory element” refers to a polynucleotide sequence, preferably a promoter, which binds a trans acting regulator and regulates the transcription of a coding sequence located downstream thereto.
- Any suitable promoter sequence can be used by the nucleic acid construct of the present invention.
- Preferably, the promoter utilized by the nucleic acid construct of the present invention is active in the specific cell population transformed. Examples of cell type-specific and/or tissue-specific promoters include promoters such as albumin that is liver specific [Pinkert et al., (1987) Genes Dev. 1:268-277], lymphoid specific promoters [Calame et al., (1988) Adv. Immunol. 43:235-275]; in particular promoters of T-cell receptors [Winoto et al., (1989) EMBO J. 8:729-733] and immunoglobulins; [Banerji et al. (1983) Cell 33729-740], neuron-specific promoters such as the neurofilament promoter [Byrne et al. (1989) Proc. Natl. Acad. Sci. USA 86:5473-5477], pancreas-specific promoters [Edlunch et al. (1985) Science 230:912-916] or mammary gland-specific promoters such as the milk whey promoter (U.S. Pat. No. 4,873,316 and European
- Application Publication No. 264,166). The nucleic acid construct of the present invention can further include an enhancer, which can be adjacent or distant to the promoter sequence and can function in up regulating the transcription therefrom.
- The nucleic acid construct of the present invention preferably further includes an appropriate selectable marker and/or an origin of replication. Preferably, the nucleic acid construct utilized is a shuttle vector, which can propagate both in E. coli (wherein the construct comprises an appropriate selectable marker and origin of replication) and be compatible for propagation in cells, or integration in a gene and a tissue of choice. The construct according to the present invention can be, for example, a plasmid, a bacmid, a phagemid, a cosmid, a phage, a virus or an artificial chromosome.
- Examples of suitable constructs include, but are not limited to, pcDNA3, pcDNA3.1 (+/−), pGL3, PzeoSV2 (+/−), pDisplay, pEF/myc/cyto, pCMV/myc/cyto each of which is commercially available from Invitrogen Co. (www.invitrogen.com). Examples of retroviral vector and packaging systems are those sold by Clontech, San Diego, Calif., including Retro-X vectors pLNCX and pLXSN, which permit cloning into multiple cloning sites and the transgene is transcribed from CMV promoter. Vectors derived from Mo-MuLV are also included such as pBabe, where the transgene will be transcribed from the 5′LTR promoter.
- Currently preferred in vivo nucleic acid transfer techniques include transfection with viral or non-viral constructs, such as adenovirus, lentivirus, Herpes simplex I virus, or adeno-associated virus (AAV) and lipid-based systems. Useful lipids for lipid-mediated transfer of the gene are, for example, DOTMA, DOPE, and DC-Chol [Tonkinson et al., Cancer Investigation, 14(1): 54-65 (1996)]. The most preferred constructs for use in gene therapy are viruses, most preferably adenoviruses, AAV, lentiviruses, or retroviruses. A viral construct such as a retroviral construct includes at least one transcriptional promoter/enhancer or locus-defining elements, or other elements that control gene expression by other means such as alternate splicing, nuclear RNA export, or post-translational modification of messenger. Such vector constructs also include a packaging signal, long terminal repeats (LTRs) or portions thereof, and positive and negative strand primer binding sites appropriate to the virus used, unless it is already present in the viral construct. In addition, such a construct typically includes a signal sequence for secretion of the peptide from a host cell in which it is placed. Preferably the signal sequence for this purpose is a mammalian signal sequence or the signal sequence of the polypeptides of the present invention. Optionally, the construct may also include a signal that directs polyadenylation, as well as one or more restriction sites and a translation termination sequence. By way of example, such constructs will typically include a 5′ LTR, a tRNA binding site, a packaging signal, an origin of second-strand DNA synthesis, and a 3′ LTR or a portion thereof. Other vectors can be used that are non-viral, such as cationic lipids, polylysine, and dendrimers.
- Recombinant Expression Vectors and Host Cells
- Another aspect of the invention pertains to vectors, preferably expression vectors, containing a nucleic acid encoding a protein of the invention, or derivatives, fragments, analogs or homologs thereof. As used herein, the term “vector” refers to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked. One type of vector is a “plasmid”, which refers to a circular double stranded DNA loop into which additional DNA segments can be ligated. Another type of vector is a viral vector, wherein additional DNA segments can be ligated into the viral genome. Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors). Other vectors (e.g., non-episomal mammalian vectors) are integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome. Moreover, certain vectors are capable of directing the expression of genes to which they are operatively-linked. Such vectors are referred to herein as “expression vectors”. In general, expression vectors of utility in recombinant DNA techniques are often in the form of plasmids. In the present specification, “plasmid” and “vector” can be used interchangeably as the plasmid is the most commonly used form of vector. However, the invention is intended to include such other forms of expression vectors, such as viral vectors (e.g., replication defective retroviruses, adenoviruses and adeno-associated viruses), which serve equivalent functions.
- The recombinant expression vectors of the invention comprise a nucleic acid of the invention in a form suitable for expression of the nucleic acid in a host cell, which means that the recombinant expression vectors include one or more regulatory sequences, selected on the basis of the host cells to be used for expression, that is operatively-linked to the nucleic acid sequence to be expressed. Within a recombinant expression vector, “operably-linked” is intended to mean that the nucleotide sequence of interest is linked to the regulatory sequences in a manner that allows for expression of the nucleotide sequence (e.g., in an in vitro transcription/translation system or in a host cell when the vector is introduced into the host cell).
- The term “regulatory sequence” is intended to include promoters, enhancers and other expression control elements (e.g., polyadenylation signals). Such regulatory sequences are described, for example, in Goeddel, Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, Calif. (1990). Regulatory sequences include those that direct constitutive expression of a nucleotide sequence in many types of host cell and those that direct expression of the nucleotide sequence only in certain host cells (e.g., tissue-specific regulatory sequences). It will be appreciated by those skilled in the art that the design of the expression vector can depend on such factors as the choice of the host cell to be transformed, the level of expression of protein desired, etc. The expression vectors of the invention can be introduced into host cells to thereby produce proteins or peptides, including fusion proteins or peptides, encoded by nucleic acids as described herein.
- The recombinant expression vectors of the invention can be designed for production of variant proteins in prokaryotic or eukaryotic cells. For example, proteins of the invention can be expressed in bacterial cells such as Escherichia coli, insect cells (using baculovirus expression vectors) yeast cells or mammalian cells. Suitable host cells are discussed further in Goeddel, Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, Calif. (1990). Alternatively, the recombinant expression vector can be transcribed and translated in vitro, for example using T7 promoter regulatory sequences and T7 polymerase.
- Expression of proteins in prokaryotes is most often carried out in Escherichia coli with vectors containing constitutive or inducible promoters directing the expression of either fusion or non-fusion proteins. Fusion vectors add a number of amino acids to a protein encoded therein, to the amino or C terminus of the recombinant protein. Such fusion vectors typically serve three purposes: (i) to increase expression of recombinant protein; (ii) to increase the solubility of the recombinant protein; and (iii) to aid in the purification of the recombinant protein by acting as a ligand in affinity purification. Often, in fusion expression vectors, a proteolytic cleavage site is introduced at the junction of the fusion moiety and the recombinant protein to enable separation of the recombinant protein from the fusion moiety subsequent to purification of the fusion protein. Such enzymes, and their cognate recognition sequences, include Factor Xa, thrombin, PreScission, TEV and enterokinase. Typical fusion expression vectors include pGEX (Pharmacia Biotech Inc; Smith and Johnson, 1988. Gene 67: 31-40), pMAL (New England Biolabs, Beverly, Mass.) and pRITS (Pharmacia, Piscataway, N.J.) that fuse glutathione S-transferase (GST), maltose E binding protein, or protein A, respectively, to the target recombinant protein.
- Examples of suitable inducible non-fusion E. coli expression vectors include pTrc (Amrann et al., (1988) Gene 69:301-315) and pET 11d (Studier et al., Gene Expression Technology:
- Methods in Enzymology 185, Academic Press, San Diego, Calif. (1990) 60-89)-not accurate, pET11a-d have N terminal T7 tag.
- One strategy to maximize recombinant protein expression in E. coli is to express the protein in a host bacterium with an impaired capacity to proteolytically cleave the recombinant protein. See, e.g., Gottesman, Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, Calif. (1990) 119-128. Another strategy is to alter the nucleic acid sequence of the nucleic acid to be inserted into an expression vector so that the individual codons for each amino acid are those preferentially utilized in E. coli (see, e.g., Wada, et al., 1992. Nucl. Acids Res. 20: 2111-2118). Such alteration of nucleic acid sequences of the invention can be carried out by standard DNA synthesis techniques. Another strategy to solve codon bias is by using BL21-codon plus bacterial strains (Invitrogen) or Rosetta bacterial strain (Novagen), these strains contain extra copies of rare E.coli tRNA genes.
- In another embodiment, the expression vector encoding for the protein of the invention is a yeast expression vector. Examples of vectors for expression in yeast Saccharomyces cerevisiae include pYepSec1 (Baldari, et al., 1987. EMBO J. 6: 229-234), pMFa (Kurjan and Herskowitz, 1982. Cell 30: 933-943), pJRY88 (Schultz et al., 1987. Gene 54: 113-123), pYES2 (Invitrogen Corporation, San Diego, Calif.), and picZ (InVitrogen Corp, San Diego, Calif.).
- Alternatively, polypeptides of the present invention can be produced in insect cells using baculovirus expression vectors. Baculovirus vectors available for expression of proteins in cultured insect cells (e.g., SF9 cells) include the pAc series (Smith, et al., 1983. Mol. Cell. Biol. 3: 2156-2165) and the pVL series (Lucklow and Summers, 1989. Virology 170: 31-39).
- In yet another embodiment, a nucleic acid of the invention is expressed in mammalian cells using a mammalian expression vector. Examples of mammalian expression vectors include pCDM8 (Seed, 1987. Nature 329: 840) and pMT2PC (Kaufman, et al., 1987. EMBO J. 6: 187-195), pIRESpuro (Clontech), pUB6 (Invitrogen), pCEP4 (Invitrogen) pREP4 (Invitrogen), pcDNA3 (Invitrogen). When used in mammalian cells, the expression vector's control functions are often provided by viral regulatory elements. For example, commonly used promoters are derived from polyoma,
adenovirus 2, cytomegalovirus, Rous Sarcoma Virus, and simian virus 40. For other suitable expression systems for both prokaryotic and eukaryotic cells see, e.g., Chapters 16 and 17 of Sambrook, et al., Molecular Cloning: A Laboratory Manual. 2nd ed., Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1989. - In another embodiment, the recombinant mammalian expression vector is capable of directing expression of the nucleic acid preferentially in a particular cell type (e.g., tissue-specific regulatory elements are used to express the nucleic acid). Tissue-specific regulatory elements are known in the art. Non-limiting examples of suitable tissue-specific promoters include the albumin promoter (liver-specific; Pinkert, et al., 1987. Genes Dev. 1: 268-277), lymphoid-specific promoters (Calame and Eaton, 1988. Adv. Immunol. 43: 235-275), in particular promoters of T cell receptors (Winoto and Baltimore, 1989. EMBO J. 8: 729-733) and immunoglobulins (Banerji, et al., 1983. Cell 33: 729-740; Queen and Baltimore, 1983. Cell 33: 741-748), neuron-specific promoters (e.g., the neurofilament promoter; Byrne and Ruddle, 1989. Proc. Natl. Acad. Sci. USA 86: 5473-5477), pancreas-specific promoters (Edlund, et al., 1985. Science 230: 912-916), and mammary gland-specific promoters (e.g., milk whey promoter; U.S. Pat. No. 4,873,316 and European Application Publication No. 264,166). Developmentally-regulated promoters are also encompassed, e.g., the murine hox promoters (Kessel and Gruss, 1990. Science 249: 374-379) and the alpha-fetoprotein promoter (Campes and Tilghman, 1989. Genes Dev. 3: 537-546).
- The present invention in at least some embodiments further provides a recombinant expression vector comprising a DNA molecule of the invention cloned into the expression vector in an antisense orientation. That is, the DNA molecule is operatively-linked to a regulatory sequence in a manner that allows for expression (by transcription of the DNA molecule) of an RNA molecule that is antisense to mRNA encoding for protein of the invention. Regulatory sequences operatively linked to a nucleic acid cloned in the antisense orientation can be chosen that direct the continuous expression of the antisense RNA molecule in a variety of cell types, for instance viral promoters and/or enhancers, or regulatory sequences can be chosen that direct constitutive, tissue specific or cell type specific expression of antisense RNA. The antisense expression vector can be in the form of a recombinant plasmid, phagemid or attenuated virus in which antisense nucleic acids are produced under the control of a high efficiency regulatory region, the activity of which can be determined by the cell type into which the vector is introduced. For a discussion of the regulation of gene expression using antisense genes see, e.g., Weintraub, et al., “Antisense RNA as a molecular tool for genetic analysis,” Reviews-Trends in Genetics, Vol. 1(1) 1986.
- Another aspect of the invention pertains to host cells into which a recombinant expression vector of the invention has been introduced. The terms “host cell” and “recombinant host cell” are used interchangeably herein. It is understood that such terms refer not only to the particular subject cell but also to the progeny or potential progeny of such a cell. Because certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope of the term as used herein.
- A host cell can be any prokaryotic or eukaryotic cell. For example, protein of the invention can be produced in bacterial cells such as E. coli, insect cells, yeast, plant or mammalian cells (such as Chinese hamster ovary cells (CHO) or COS or 293 cells). Other suitable host cells are known to those skilled in the art.
- Vector DNA can be introduced into prokaryotic or eukaryotic cells via conventional transformation or transfection techniques. As used herein, the terms “transformation” and “transfection” are intended to refer to a variety of art-recognized techniques for introducing foreign nucleic acid (e.g., DNA) into a host cell, including calcium phosphate or calcium chloride co-precipitation, DEAE-dextran-mediated transfection, lipofection, or electroporation. Suitable methods for transforming or transfecting host cells can be found in Sambrook, et al. (Molecular Cloning: A Laboratory Manual. 2nd ed., Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1989), and other laboratory manuals.
- For stable transfection of mammalian cells, it is known that, depending upon the expression vector and transfection technique used, only a small fraction of cells may integrate the foreign DNA into their genome. In order to identify and select these integrants, a gene that encodes a selectable marker (e.g., resistance to antibiotics) is generally introduced into the host cells along with the gene of interest. Various selectable markers include those that confer resistance to drugs, such as G418, hygromycin, puromycin, blasticidin and methotrexate. Nucleic acids encoding a selectable marker can be introduced into a host cell on the same vector as that encoding protein of the invention or can be introduced on a separate vector. Cells stably transfected with the introduced nucleic acid can be identified by drug selection (e.g., cells that have incorporated the selectable marker gene will survive, while the other cells die).
- A host cell of the invention, such as a prokaryotic or eukaryotic host cell in culture, can be used to produce (i.e., express) protein of the invention. Accordingly, the present invention in at least some embodiments further provides methods for producing proteins of the invention using the host cells of the invention. In one embodiment, the method comprises culturing the host cell of the present invention (into which a recombinant expression vector encoding protein of the invention has been introduced) in a suitable medium such that the protein of the invention is produced. In another embodiment, the method further comprises isolating protein of the invention from the medium or the host cell.
- For efficient production of the protein, it is preferable to place the nucleotide sequences encoding the protein of the invention under the control of expression control sequences optimized for expression in a desired host. For example, the sequences may include optimized transcriptional and/or translational regulatory sequences (such as altered Kozak sequences).
- It should be noted, that according to at least some embodiments of the present invention the C1ORF32 polypeptides as described herein may optionally be isolated as naturally-occurring polypeptides, or from any source whether natural, synthetic, semi-synthetic or recombinant Accordingly, the C1ORF32 proteins may be isolated as naturally-occurring proteins from any species, particularly mammalian, including bovine, ovine, porcine, murine, equine, and preferably human. Alternatively, the C1ORF32 proteins may be isolated as recombinant polypeptides that are expressed in prokaryote or eukaryote host cells, or isolated as a chemically synthesized polypeptide.
- A skilled artisan can readily employ standard isolation methods to obtain isolated C1ORF32 proteins. The nature and degree of isolation will depend on the source and the intended use of the isolated molecules.
- Fusion Proteins
- According to at least some embodiments, C1ORF32 fusion polypeptides have a first fusion partner comprising all or a part of a C1ORF32 protein fused to a second polypeptide directly or via a linker peptide sequence or a chemical linker useful to connect the two proteins. The C1ORF32 polypeptide may or may not contain the native signal peptide. The C1ORF32 polypeptide may optionally be fused to a second polypeptide to form a fusion protein as described herein. The presence of the second polypeptide can alter the solubility, stability, affinity and/or valency of the C1ORF32 fusion polypeptide. As used herein, “valency” refers to the number of binding sites available per molecule. In one embodiment the second polypeptide is a polypeptide from a different source or different protein.
- According to at least some embodiments, the C1ORF32 protein or fragment is selected for its activity for the treatment of immune related disorder and/or infection and/or according to one or more in vitro biological activities as described herein.
- In one embodiment, the second polypeptide contains one or more domains of an immunoglobulin heavy chain constant region, preferably having an amino acid sequence corresponding to the hinge, CH2 and CH3 regions of a human immunoglobulin Cγ1, Cγ2, Cγ3 or Cγ4, chains or to the hinge, CH2 and CH3 regions of a murine immunoglobulin Cy2a chain. SEQ ID NO: 20 provides exemplary sequence for the hinge, CH2 and CH3 regions of a human immunoglobulin Cy1.
- According to at least some embodiments, the fusion protein is a dimeric fusion protein. In an optional dimeric fusion protein, the dimer results from the covalent bonding of Cys residue in the hinge region of two of the Ig heavy chains that are the same Cys residues that are disulfide linked in dimerized normal Ig heavy chains. Such proteins are referred to as IgC1ORF32 polypeptides, fragments or fusion proteins thereof.
- In one embodiment, the immunoglobulin constant domain may contain one or more amino acid insertions, deletions or substitutions that enhance binding to specific cell types, increase the bioavailablity, or increase the stability of the C1ORF32 polypeptides, fusion proteins, or fragments thereof. Suitable amino acid substitutions include conservative and non-conservative substitutions, as described above.
- The fusion proteins optionally contain a domain that functions to dimerize or multimerize two or more fusion proteins. The peptide/polypeptide linker domain can either be a separate domain, or alternatively can be contained within one of the other domains (C1ORF32 polypeptide or second polypeptide) of the fusion protein. Similarly, the domain that functions to dimerize or multimerize the fusion proteins can either be a separate domain, or alternatively can be contained within one of the other domains (C1ORF32 polypeptide, second polypeptide or peptide/polypeptide linker domain) of the fusion protein. In one embodiment, the dimerization/multimerization domain and the peptide/polypeptide linker domain are the same. Further specific, illustrative and non-limiting examples of dimerization/multimerization domains and linkers are given below.
- Fusion proteins disclosed herein according to at least some embodiments of the present invention are of formula I: N-R1-R2-R3-C wherein “N” represents the N-terminus of the fusion protein, “C” represents the C-terminus of the fusion protein. In the further embodiment, “R1” is a C1ORF32 polypeptide, “R2” is an optional peptide/polypeptide or chemical linker domain, and “R3” is a second polypeptide. Alternatively, R3 may be a C1ORF32 polypeptide and R1 may be a second polypeptide. Various non-limiting examples of linkers are described in greater detail below.
- Optionally, the fusion protein comprises the C1ORF32 polypeptide fragments selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, fused, optionally by a linker peptide of one or more amino acids (e.g. GS) to one or more “half-life extending moieties”. A “half-life extending moiety” is any moiety, for example, a polypeptide, small molecule or polymer, that, when appended to protein, extends the in vivo half-life of that protein in the body of a subject (e.g., in the plasma of the subject). For example, a half-life extending moiety is, in an embodiment of the invention, polyethylene glycol (PEG), monomethoxy PEG (mPEG) or an immunoglobulin (Ig). In an embodiment of the invention, PEG is a 5, 10, 12, 20, 30, 40 or 50 kDa moiety or larger or comprises about 12000 ethylene glycol units (PEG12000).
- The fusion protein may also optionally be prepared by chemical synthetic methods and the “join” effected chemically, either during synthesis or post-synthesis. Cross-linking and other such methods may optionally be used (optionally also with the above described genetic level fusion methods), as described for example in U.S. Pat. No. 5,547,853 to Wallner et al, which is hereby incorporated by reference as if fully set forth herein as a non-limiting example only.
- According to the present invention, a fusion protein may be prepared from a protein of the invention by fusion with a portion of an immunoglobulin comprising a constant region of an immunoglobulin. More preferably, the portion of the immunoglobulin comprises a heavy chain constant region which is optionally and more preferably a human heavy chain constant region. The heavy chain constant region is most preferably an IgG heavy chain constant region, and optionally and most preferably is an Fc chain, most preferably an IgG Fc fragment that comprises the hinge, CH2 and CH3 domains. The Fc chain may optionally be a known or “wild type” Fc chain, or alternatively may be mutated or truncated. The Fc portion of the fusion protein may optionally be varied by isotype or subclass, may be a chimeric or hybrid, and/or may be modified, for example to improve effector functions, control of half-life, tissue accessibility, augment biophysical characteristics such as stability, and improve efficiency of production (and less costly). Many modifications useful in construction of disclosed fusion proteins and methods for making them are known in the art, see for example Mueller, et al, MoI. Immun , 34(6):441-452 (1997), Swann, et al., Cur. Opin. Immun , 20:493-499 (2008), and Presta, Cur. Opin. Immun 20:460-470 (2008). In some embodiments the Fc region is the native IgG1, IgG2, or IgG4 Fc region. In some embodiments the Fc region is a hybrid, for example a chimeric consisting of IgG2/IgG4 Fc constant regions.
- Modications to the Fc region include, but are not limited to, IgG4 modified to prevent binding to Fc gamma receptors and complement, IgG1 modified to improve binding to one or more Fc gamma receptors, IgG1 modified to minimize effector function (amino acid changes), IgG1 with altered/no glycan (typically by changing expression host or substuting the Asn at position 297), and IgG1 with altered pH-dependent binding to FcRn. The Fc region may include the entire hinge region, or less than the entire hinge region.
- In another embodiment, the Fc domain may contain one or more amino acid insertions, deletions or substitutions that reduce binding to the low affinity inhibitory Fc receptor CD32B (FcγRIIB) and retain wild-type levels of binding to or enhance binding to the low affinity activating Fc receptor CD16A (FcγRIIIA)
- Another embodiment includes IgG2-4 hybrids and IgG4 mutants that have reduced binding to FcR (Fc receptor) which increase their half life. Representative IgG2-4 hybrids and IgG4 mutants are described in Angal, S. et al., Molecular Immunology, 30(1):105-108 (1993); Mueller, J. et al., Molecular Immunology, 34(6): 441-452 (1997); and U.S. Pat. No. 6,982,323 to Wang et al. In some embodiments the IgG1 and/or IgG2 domain is deleted; for example, Angal et al. describe IgG1 and IgG2 having serine 241 replaced with a proline.
- In a further embodiment, the Fc domain contains amino acid insertions, deletions or substitutions that enhance binding to CD16A. A large number of substitutions in the Fc domain of human IgG1 that increase binding to CD16A and reduce binding to CD32B are known in the art and are described in Stavenhagen, et al., Cancer Res., 57(18):8882-90 (2007). Exemplary variants of human IgG1 Fc domains with reduced binding to CD32B and/or increased binding to CD16A contain F243L, R929P, Y300L, V3051 or P296L substitutions. These amino acid substitutions may be present in a human IgG1 Fc domain in any combination.
- In one embodiment, the human IgG1 Fc domain variant contains a F243L, R929P and Y300L substitution. In another embodiment, the human IgG1 Fc domain variant contains a F243L, R929P, Y300L, V3051 and P296L substitution. In another embodiment, the human IgG1 Fc domain variant contains an N297A/Q substitution, as these mutations abolishFcyR binding. Non-limiting, illustrative, exemplary types of mutations are described in US Patent Application No. 20060034852, published on Feb. 16, 2006, hereby incorporated by reference as if fully set forth herein. The term “Fc chain” also optionally comprises any type of Fc fragment.
- Several of the specific amino acid residues that are important for antibody constant region-mediated activity in the IgG subclass have been identified. Inclusion, substitution or exclusion of these specific amino acids therefore allows for inclusion or exclusion of specific immunoglobulin constant region-mediated activity. Furthermore, specific changes may result in aglycosylation for example and/or other desired changes to the Fc chain. At least some changes may optionally be made to block a function of Fc which is considered to be undesirable, such as an undesirable immune system effect, as described in greater detail below.
- Non-limiting, illustrative examples of mutations to Fc which may be made to modulate the activity of the fusion protein include the following changes (given with regard to the Fc sequence nomenclature as given by Kabat, from Kabat EA et al: Sequences of Proteins of Immunological Interest. US Department of Health and Human Services, NIH, 1991): 220C→S; 233-238 ELLGGP→EAEGAP; 265D→A, preferably in combination with 434N→A; 297N→A (for example to block N-glycosylation); 318-322 EYKCK→AYACA; 330-331AP→SS; or a combination thereof (see for example M. Clark, “Chemical Immunol and Antibody Engineering”, pp 1-31 for a description of these mutations and their effect). The construct for the Fc chain which features the above changes optionally and preferably comprises a combination of the hinge region with the CH2 and CH3 domains.
- The above mutations may optionally be implemented to enhance desired properties or alternatively to block non-desired properties. For example, aglycosylation of antibodies was shown to maintain the desired binding functionality while blocking depletion of T-cells or triggering cytokine release, which may optionally be undesired functions (see M. Clark, “Chemical Immunol and Antibody Engineering”, pp 1-31). Substitution of 331proline for serine may block the ability to activate complement, which may optionally be considered an undesired function (see M. Clark, “Chemical Immunol and Antibody Engineering”, pp 1-31). Changing 330 alanine to serine in combination with this change may also enhance the desired effect of blocking the ability to activate complement.
- Residues 235 and 237 were shown to be involved in antibody-dependent cell-mediated cytotoxicity (ADCC), such that changing the block of residues from 233-238 as described may also block such activity if ADCC is considered to be an undesirable function.
- Residue 220 is normally a cysteine for Fc from IgG1, which is the site at which the heavy chain forms a covalent linkage with the light chain. Optionally, this residue may be changed to another amino acid residue (e.g., serine), to avoid any type of covalent linkage (see M. Clark, “Chemical Immunol and Antibody Engineering”, pp 1-31) or by deletion or truncation.
- The above changes to residues 265 and 434 may optionally be implemented to reduce or block binding to the Fc receptor, which may optionally block undesired functionality of Fc related to its immune system functions (see “Binding site on Human IgG1 for Fc Receptors”, Shields et al, Vol 276, pp 6591-6604, 2001).
- The above changes are intended as illustrations only of optional changes and are not meant to be limiting in any way. Furthermore, the above explanation is provided for descriptive purposes only, without wishing to be bound by a single hypothesis. In a further embodiment, the fusion protein includes the C1ORF32 fragment fused to an Ig Fc region. Recombinant Ig-C1ORF32 fragment polypeptides can be prepared by fusing the coding region of the C1ORF32 fragment to the Fc region of human IgG1 or mouse IgG2a, as described previously (Chapoval, et al., Methods MoI. Med, 45:247-255 (2000)). Optionally, C1ORF32 fusion protein, comprising an amino acid sequence of human C1ORF32 ECD fragment fused to murine or human immunoglobulin Fc. Optionally, said fusion protein comprises the amino acid sequence set forth in anyone of SEQ ID NOs: 29, 30, 41-105, and/or 45, 64, or 96, fused to human IgG1 Fc set forth in any one of SEQ ID NOs: 20, 21, 115. Optionally, the amino acid sequence of said fusion protein is set forth in SEQ ID NO: 39, 108-112, 116-190; optionally and preferably, the amino acid sequence is set forth in any of SEQ ID NOs:112, 120 or alternatively in any one of SEQ ID NOs:110, 136.
- The aforementioned exemplary fusion proteins can incorporate any combination of the variants described herein. In another embodiment the terminal lysine of the aforementioned exemplary fusion proteins is deleted.
- The disclosed fusion proteins can be isolated using standard molecular biology techniques. For example, an expression vector containing a DNA sequence encoding a C1ORF32
- ECD fragments or fusion proteins thereof fusion protein is transfected into 293 cells by calcium phosphate precipitation and cultured in serum-free DMEM. The supernatant is collected at 72 h and the fusion protein is purified by Protein G, or preferably Protein A SEPHAROSE® columns (Pharmacia, Uppsala, Sweden). Optionally, a DNA sequence encoding a C1ORF32 fragments fusion protein is transfected into GPEx® retrovectors and expressed in CHO-S cells following four rounds of retrovector transduction. The protein is clarified from supernatants using protein A chromatography.
- In another embodiment the second polypeptide may have a conjugation domain through which additional molecules can be bound to the C1ORF32 fragments fusion proteins. In one such embodiment, the conjugated molecule is capable of targeting the fusion protein to a particular organ or tissue; further specific, illustrative, non-limiting examples of such targeting domains and/or molecules are given below.
- In another such embodiment the conjugated molecule is another immunomodulatory agent that can enhance or augment the effects of the C1ORF32 fusion protein. In another embodiment the conjugated molecule is Polyethylene Glycol (PEG).
- Peptide or Polypeptide Linker Domain
- The disclosed C1ORF32 fusion proteins optionally contain a peptide or polypeptide linker domain that separates the C1ORF32 polypeptide from the second polypeptide. In one embodiment, the linker domain contains the hinge region of an immunoglobulin. In a further embodiment, the hinge region is derived from a human immunoglobulin. Suitable human immunoglobulins that the hinge can be derived from include IgG, IgD and IgA. In a further embodiment, the hinge region is derived from human IgG. Amino acid sequences of immunoglobulin hinge regions and other domains are well known in the art. In one embodiment, C1ORF32 fusion polypeptides contain the hinge, CH2 and CH3 regions of a human immunoglobulin Cγ1 chain, optionally with the Cys at position 220 (according to full length human IgG1,
position 5 in SEQ ID NO: 20) replaced with a Ser (SEQ ID NO: 115) having at least 85%, 90%, 95%, 99% or 100% sequence homology to amino acid sequence set forth in SEQ ID NO: 20: -
EPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMI SRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKP REEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP APIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTC LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF LYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL SPGK - The hinge can be further shortened to remove
amino acids - In another embodiment, C1ORF32 fusion polypeptides contain the CH2 and CH3 regions of a human immunoglobulin Cγ1 chain having at least 85%, 90%, 95%, 99% or 100% sequence homology to amino acid sequence set forth in SEQ ID NO: 21:
-
APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH EDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVL TVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPR EPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWE SNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG NVFSCSVMHEALHNHYTQKSLSLSPGK - In another embodiment, the C1ORF32 fusion polypeptides contain the CH2 and CH3 regions of a murine immunoglobulin Cy2a chain at least 85%, 90%, 95%, 99% or 100% sequence homology to amino acid sequence set forth in SEQ ID NO:31:
-
EPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLM ISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQ THREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDL PAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLT CMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSY FMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFS RTPGK. - In another embodiment, the linker domain contains a hinge region of an immunoglobulin as described above, and further includes one or more additional immunoglobulin domains.
- Other suitable peptide/polypeptide linker domains include naturally occurring or non-naturally occurring peptides or polypeptides. Peptide linker sequences are at least 2 amino acids in length. Optionally the peptide or polypeptide domains are flexible peptides or polypeptides. A “flexible linker” herein refers to a peptide or polypeptide containing two or more amino acid residues joined by peptide bond(s) that provides increased rotational freedom for two polypeptides linked thereby than the two linked polypeptides would have in the absence of the flexible linker. Such rotational freedom allows two or more antigen binding sites joined by the flexible linker to each access target antigen(s) more efficiently. Exemplary flexible peptides/polypeptides include, but are not limited to, the amino acid sequences Gly-Ser (SEQ ID NO: 24), Gly-Ser-Gly-Ser (SEQ ID NO: 25), Ala-Ser (SEQ ID NO:26), Gly-Gly-Gly-Ser (SEQ ID NO: 27), Gly4-Ser (SEQ ID NO: 106), (Gly4-Ser)2 (SEQ ID NO: 107), (Gly4-Ser)3 (SEQ ID NO: 32) and (Gly4-Ser)4 (SEQ ID NO: 33). Additional flexible peptide/polypeptide sequences are well known in the art. Other suitable peptide linker domains include helix forming linkers such as Ala-(Glu-Ala-Ala-Ala-Lys)n-Ala (n=1-5) (for n=1, SEQ ID NO:114 as a non-limiting example). Additional helix forming peptide/polypeptide sequences are well known in the art. Additional example of a cleavable linker is TEV-linker Gly Ser Glu Asn Leu Tyr Phe Gln Gly Ser Gly (SEQ ID NO:113). Non-limiting examples of C1ORF32 polypeptide fragments fused to Fc portion via a linker are depicted in SEQ ID NOs: 8 and 108-112.
- Dimerization, Multimerization and Targeting Domains
- The fusion proteins disclosed herein optionally contain a dimerization or multimerization domain that functions to dimerize or multimerize two or more fusion proteins. The domain that functions to dimerize or multimerize the fusion proteins can either be a separate domain, or alternatively can be contained within one of the other domains (C1ORF32 polypeptide, second polypeptide, or peptide/polypeptide linker domain) of the fusion protein.
- Dimerization or multinierization can occur between or among two or more fusion proteins through dimerization or multimerization domains. Alternatively, dimerization or multimerization of fusion proteins can occur by chemical crosslinking. The dimers or multimers that are formed can be homodimeric/homomultimeric or heterodimeric/heteromultimeric.The second polypeptide “partner” in the C1ORF32 fusion polypeptides may be comprised of one or more other proteins, protein fragments or peptides as described herein, including but not limited to any immunoglobulin (Ig) protein or portion thereof, preferably the Fc region, or a portion of a biologically or chemically active protein such as the papillomavirus E7 gene product, melanoma-associated antigen p97), and HIV env protein (gp120). The “partner” is optionally selected to provide a soluble dimer/multimer and/or for one or more other biological activities as described herein.
- A “dimerization domain” is formed by the association of at least two amino acid residues or of at least two peptides or polypeptides (which may have the same, or different, amino acid sequences). The peptides or polypeptides may interact with each other through covalent and/or non-covalent associations). Optional dimerization domains contain at least one cysteine that is capable of forming an intermolecular disulfide bond with a cysteine on the partner fusion protein. The dimerization domain can contain one or more cysteine residues such that disulfide bond(s) can form between the partner fusion proteins. In one embodiment, dimerization domains contain one, two or three to about ten cysteine residues. In a further embodiment, the dimerization domain is the hinge region of an immunoglobulin.
- Additional exemplary dimerization domains can be any known in the art and include, but not limited to, coiled coils, acid patches, zinc fingers, calcium hands, a CH1-CL pair, an “interface” with an engineered “knob” and/or “protruberance” as described in U.S. Pat. No. 5,821,333, leucine zippers (e.g., from jun and/or fos) (U.S. Patent No. 5,932,448), and/or the yeast transcriptional activator GCN4, SH2 (src homology 2), SH3 (src Homology 3) (Vidal, et al, Biochemistry, 43, 7336-44 ((2004)), phosphotyrosine binding (PTB) (Zhou, et al., Nature, 378:584-592 (1995)), WW (Sudol, Prog, Biochys. MoL Bio., 65:113-132 (1996)), PDZ (Kim, et al., Nature, 378: 85-88 (1995); Komau, et al, Science, 269.1737-1740 (1995)) 14-3-3, WD40 (Hu5 et al., J Biol Chem., 273, 33489-33494 (1998)) EH, Lim, an isoleucine zipper, a receptor dimer pair (e.g., interleukin-8 receptor (IL-8R); and integrin heterodimers such as LFA-I and GPIIIb/IIIa), or the dimerization region(s) thereof, dimeric ligand polypeptides (e.g. nerve growth factor (NGF), neurotrophin-3 (NT-3), interleukin-8 (IL-8), vascular endothelial growth factor (VEGF), VEGF-C, VEGF-D, PDGF members, and brain-derived neurotrophic factor (BDNF) (Arakawa, et al., J Biol. Chem., 269(45): 27833-27839 (1994) and Radziejewski, et al., Biochem., 32(48): 1350 (1993)) and can also be variants of these domains in which the affinity is altered. The polypeptide pairs can be identified by methods known in the art, including yeast two hybrid screens. Yeast two hybrid screens are described in U.S. Pat. Nos. 5,283,173 and 6,562,576. Affinities between a pair of interacting domains can be determined using methods known in the art, including as described in Katahira, et at, J. Biol Chem, 277, 9242-9246 (2002)). Alternatively, a library of peptide sequences can be screened for heterodimerization, for example, using the methods described in WO 01/00814. Useful methods for protein-protein interactions are also described in U.S. Pat. No. 6,790,624.
- A “multimerization domain” is a domain that causes three or more peptides or polypeptides to interact with each other through covalent and/or non-covalent association(s). Suitable multimerization domains include, but are not limited to, coiled-coil domains. A coiled-coil is a peptide sequence with a contiguous pattern of mainly hydrophobic residues spaced 3 and 4 residues apart, usually in a sequence of seven amino acids (heptad repeat) or eleven amino acids (undecad repeat), which assembles (folds) to form a multimeric bundle of helices. Coiled-coils with sequences including some irregular distribution of the 3 and 4 residues spacing are also contemplated. Hydrophobic residues are in particular the hydrophobic amino acids Val, Ile, Leu, Met, Tyr, Phe and Trp. “Mainly hydrophobic” means that at least 50% of the residues must be selected from the mentioned hydrophobic amino acids.
- The coiled coil domain may be derived from laminin In the extracellular space, the heterotrimeric coiled coil protein laminin plays an important role in the formation of basement membranes. Apparently, the multifunctional oligomeric structure is required for laminin function. Coiled coil domains may also be derived from the thrombospondins in which three (TSP-I and TSP-2) or five (TSP-3, TSP-4 and TSP-5) chains are connected, or from COMP (COMPcc) (Guo, et at., EMBO J, 1998, 17: 5265-5272) which folds into a parallel five-stranded coiled coil (Malashkevich, et al., Science, 274: 761-765 (1996)). Additional non limiting examples of coiled-coil domains derived from other proteins, and other domains that mediate polypeptide multimerization are known in the art such as the vasodialator-stimulated phosphoprotein (VASP) domain, matrilin-1 (CMP), viral fusion peptides, soluble NSF (N-ethylmaleimide-sensitive factor) Attachment Protein receptor (SNARE) complexes, leucine-rich repeats, certain tRNA synthetases, are suitable for use in the disclosed fusion proteins.
- In another embodiment, C1ORF32 polypeptides, fusion proteins, or fragments thereof can be induced to form multimers by binding to a second multivalent polypeptide, such as an antibody. Antibodies suitable for use to multimerize C1ORF32 polypeptides, fusion proteins, or fragments thereof include, but are not limited to, IgM antibodies and cross-linked, multivalent IgG, IgA, IgD, or IgE complexes.
- Dimerization or multimerization can occur between or among two or more fusion proteins through dimerization or multimerization domains, including those described above. Alternatively, dimerization or multimerization of fusion proteins can occur by chemical crosslinking. Fusion protein dimers can be homodimers or heterodimers. Fusion protein multimers can be homomultimers or heteromultimers. Fusion protein dimers as disclosed herein are of formula II: N-R1-R2-R3-C N-R4-R5-R6-C or, alternatively, are of formula N-R1-R2-R3-C C-R4-R5-R6-N wherein the fusion proteins of the dimer provided by formula II are defined as being in a parallel orientation and the fusion proteins of the dimer provided by formula III are defined as being in an antiparallel orientation. Parallel and antiparallel dimers are also referred to as cis and trans dimers, respectively. “N” and “C” represent the N- and C-termini of the fusion protein, respectively. The fusion protein constituents “R1”, “R2” and “R3” are as defined above with respect to formula I. With respect to both formula II and formula III, “R4” is a C1ORF32 polypeptide or a second polypeptide, “R5” is an optional peptide/polypeptide linker domain, and “R6” is a C1ORF32 polypeptide or a second polypeptide, wherein “R6” is a C1ORF32 polypeptide when “R4” is a second polypeptide, and “R6′” is a second polypeptide when “R4” is a C1ORF32 polypeptide. In one embodiment, “R1” is a C1ORF32 polypeptide, “R4” is also a C1ORF32 polypeptide, and “R3” and “R6” are both second polypeptides.
- Fusion protein dimers of formula II are defined as homodimers when “R1”=“R4”, “R2”=“R5” and “R3”=“R6”. Similarly, fusion protein dimers of formula III are defined as homodimers when “R1”=“R6”, “R2”=“R5” and “R3”=“R4”. Fusion protein dimers are defined as heterodimers when these conditions are not met for any reason. For example, heterodimers may contain domain orientations that meet these conditions (i.e., for a dimer according to formula II, “R1” and “R4” are both C1ORF32 polypeptides, “R2” and “R5” are both peptide/polypeptide linker domains and “R3” and “R6” are both second polypeptides), however the species of one or more of these domains is not identical. For example, although “R3” and “R6” may both be C1ORF32 polypeptides, one polypeptide may contain a wild-type C1ORF32 amino acid sequence while the other polypeptide may be a variant C1ORF32 polypeptide. An exemplary variant C1ORF32 polypeptide is C1ORF32 polypeptide that has been modified to have increased or decreased binding to a target cell, increased activity on immune cells, increased or decreased half life or stability. Dimers of fusion proteins that contain either a CHI or CL region of an immunoglobulin as part of the polypeptide linker domain preferably form heterodimers wherein one fusion protein of the dimer contains a CHI region and the other fusion protein of the dimer contains a CL region.
- Fusion proteins can also be used to form multimers. As with dimers, multimers may be parallel multimers, in which all fusion proteins of the multimer are aligned in the same orientation with respect to their N- and C-termini. Multimers may be antiparallel multimers, in which the fusion proteins of the multimer are alternatively aligned in opposite orientations with respect to their N- and C-termini. Multimers (parallel or antiparallel) can be either homomultimers or heteromultimers. The fusion protein is optionally produced in dimeric form; more preferably, the fusion is performed at the genetic level as described below, by joining polynucleotide sequences corresponding to the two (or more) proteins, portions of proteins and/or peptides, such that a joined or fused protein is produced by a cell according to the joined polynucleotide sequence. A description of preparation for such fusion proteins is described with regard to U.S. Pat. No. 5,851,795 to Linsley et al, which is hereby incorporated by reference as if fully set forth herein as a non-limiting example only.
- Targeting Domains
- The C1ORF32 polypeptides and fusion proteins can contain a targeting domain to target the molecule to specific sites in the body. Optional targeting domains target the molecule to areas of inflammation. Exemplary targeting domains are antibodies, or antigen binding fragments thereof that are specific for inflamed tissue or to a proinflammatory cytokine including but not limited to IL17, IL-4, IL-6, IL-12, IL-21, IL-22, and IL-23. In the case of neurological disorders such as Multiple Sclerosis, the targeting domain may target the molecule to the CNS or may bind to VCAM-I on the vascular epithelium. Additional targeting domains can be peptide aptamers specific for a proinflammatory molecule. In other embodiments, the C1ORF32 fusion protein can include a binding partner specific for a polypeptide displayed on the surface of an immune cell, for example a T cell. In still other embodiments, the targeting domain specifically targets activated immune cells. Optional immune cells that are targeted include Th0, Th1, Th 17, Th2 and Th22 T cells, other cells that secrete, or cause other cells to secrete inflammatory molecules including, but not limited to, IL-1beta, TNF-alpha, TGF-beta, IFN-gamma, IL-17, IL-6, IL-23, IL-22, IL-21, and MMPs, and Tregs. For example, a targeting domain for Tregs may bind specifically to CD25.
- The above changes are intended as illustrations only of optional changes and are not meant to be limiting in any way. Furthermore, the above explanation is provided for descriptive purposes only, without wishing to be bound by a single hypothesis.
- Dimerization or multimierization can occur between or among two or more fusion proteins through dimerization or multimerization domains Alternatively, dimerization or multimerization of fusion proteins can occur by chemical crosslinking. The dimers or multimers that are formed can be homodimeric/homomultimeric or heterodimeric/heteromultimeric. The second polypeptide “partner” in the C1ORF32 fusion polypeptides may be comprised of one or more other proteins, protein fragments or peptides as described herein, including but not limited to any immunoglobulin (Ig) protein or portion thereof, preferably the Fc region, or a portion of a biologically or chemically active protein such as the papillomavirus E7 gene product, melanoma-associated antigen p97), and HIV env protein (gp120). The “partner” is optionally selected to provide a soluble dimer/multimer and/or for one or more other biological activities as described herein.
- Addition of Groups
- If a protein according to the present invention is a linear molecule, it is possible to place various functional groups at various points on the linear molecule which are susceptible to or suitable for chemical modification. Functional groups can be added to the termini of linear forms of the protein according to at least some embodiments of the invention. In some embodiments, the functional groups improve the activity of the protein with regard to one or more characteristics, including but not limited to, improvement in stability, penetration (through cellular membranes and/or tissue barriers), tissue localization, efficacy, decreased clearance, decreased toxicity, improved selectivity, improved resistance to expulsion by cellular pumps, and the like. For convenience sake and without wishing to be limiting, the free N-terminus of one of the sequences contained in the compositions according to at least some embodiments of the invention will be termed as the N-terminus of the composition, and the free C-terminal of the sequence will be considered as the C-terminus of the composition. Either the C-terminus or the N-terminus of the sequences, or both, can be linked to a carboxylic acid functional groups or an amine functional group, respectively.
- Non-limiting examples of suitable functional groups are described in Green and Wuts, “Protecting Groups in Organic Synthesis”, John Wiley and Sons,
Chapters 5 and 7, 1991, the teachings of which are incorporated herein by reference. Preferred protecting groups are those that facilitate transport of the active ingredient attached thereto into a cell, for example, by reducing the hydrophilicity and increasing the lipophilicity of the active ingredient, these being an example for “a moiety for transport across cellular membranes”. - These moieties can optionally and preferably be cleaved in vivo, either by hydrolysis or enzymatically, inside the cell. (Ditter et al., J. Pharm. Sci. 57:783 (1968); Ditter et al., J. Pharm. Sci. 57:828 (1968); Ditter et al., J. Pharm. Sci. 58:557 (1969); King et al., Biochemistry 26:2294 (1987); Lindberg et al., Drug Metabolism and Disposition 17:311 (1989); and Tunek et al., Biochem. Pharm. 37:3867 (1988), Anderson et al., Arch. Biochem. Biophys. 239:538 (1985) and Singhal et al., FASEB J. 1:220 (1987)). Hydroxyl protecting groups include esters, carbonates and carbamate protecting groups Amine protecting groups include alkoxy and aryloxy carbonyl groups, as described above for N-terminal protecting groups. Carboxylic acid protecting groups include aliphatic, benzylic and aryl esters, as described above for C-terminal protecting groups. In one embodiment, the carboxylic acid group in the side chain of one or more glutamic acid or aspartic acid residue in a composition of the present invention is protected, preferably with a methyl, ethyl, benzyl or substituted benzyl ester, more preferably as a benzyl ester. Non-limiting, illustrative examples of N-terminal protecting groups include acyl groups (—CO—R1) and alkoxy carbonyl or aryloxy carbonyl groups (—CO—O—R1), wherein R1 is an aliphatic, substituted aliphatic, benzyl, substituted benzyl, aromatic or a substituted aromatic group. Specific examples of acyl groups include but are not limited to acetyl, (ethyl)-CO—, n-propyl-CO—, iso-propyl-CO—, n-butyl-CO—, sec-butyl-CO—, t-butyl-CO—, hexyl, lauroyl, palmitoyl, myristoyl, stearyl, oleoyl phenyl-CO—, substituted phenyl-CO—, benzyl-CO— and (substituted benzyl)-CO—. Examples of alkoxy carbonyl and aryloxy carbonyl groups include CH3—O—CO—, (ethyl)-O—CO—, n-propyl-O—CO—, iso-propyl-O—CO—, n-butyl-O—CO—, sec-butyl-O—CO—, t-butyl-O—CO—, phenyl-O—CO—, substituted phenyl-O—CO— and benzyl-O—CO—, (substituted benzyl)-O—CO—, Adamantan, naphtalen, myristoleyl, toluen, biphenyl, cinnamoyl, nitrobenzoy, toluoyl, furoyl, benzoyl, cyclohexane, norbornane, or Z-caproic. In order to facilitate the N-acylation, one to four glycine residues can be present in the N-terminus of the molecule.
- The carboxyl group at the C-terminus of the compound can be protected, for example, by a group including but not limited to an amide (i.e., the hydroxyl group at the C-terminus is replaced with —NH2, —NHR2 and —NR2R3) or ester (i.e. the hydroxyl group at the C-terminus is replaced with —OR2). R2 and R3 are optionally independently an aliphatic, substituted aliphatic, benzyl, substituted benzyl, aryl or a substituted aryl group. In addition, taken together with the nitrogen atom, R2 and R3 can optionally form a C4 to C8 heterocyclic ring with from about 0-2 additional heteroatoms such as nitrogen, oxygen or sulfur. Non-limiting suitable examples of suitable heterocyclic rings include piperidinyl, pyrrolidinyl, morpholino, thiomorpholino or piperazinyl. Examples of C-terminal protecting groups include but are not limited to —NH2, —NHCH3, —N(CH3)2, —NH(ethyl), —N(ethyl)2, —N(methyl) (ethyl), —NH(benzyl), -N(C1-C4 alkyl)(benzyl), —NH(phenyl), —N(C1-C4 alkyl) (phenyl), —OCH3, —O-(ethyl), —O-(n-propyl), —O-(n-butyl), —O-(iso-propyl), —O-(sec-butyl), —O-(t-butyl), —O-benz yl and —O-phenyl.
- Substitution by Peptidomimetic Moieties
- A “peptidomimetic organic moiety” can optionally be substituted for amino acid residues in the composition of this invention both as conservative and as non-conservative substitutions. These moieties are also termed “non-natural amino acids” and may optionally replace amino acid residues, amino acids or act as spacer groups within the peptides in lieu of deleted amino acids. The peptidomimetic organic moieties optionally and preferably have steric, electronic or configurational properties similar to the replaced amino acid and such peptidomimetics are used to replace amino acids in the essential positions, and are considered conservative substitutions. However such similarities are not necessarily required. According to preferred embodiments of the present invention, one or more peptidomimetics are selected such that the composition at least substantially retains its physiological activity as compared to the native protein according to the present invention.
- Peptidomimetics may optionally be used to inhibit degradation of the peptides by enzymatic or other degradative processes. The peptidomimetics can optionally and preferably be produced by organic synthetic techniques. Non-limiting examples of suitable peptidomimetics include D amino acids of the corresponding L amino acids, tetrazol (Zabrocki et al., J. Am. Chem. Soc. 110:5875-5880 (1988)); isosteres of amide bonds (Jones et al., Tetrahedron Lett. 29: 3853-3856 (1988)); LL-3-amino-2-propenidone-6-carboxylic acid (LL-Acp) (Kemp et al., J. Org. Chem. 50:5834-5838 (1985)). Similar analogs are shown in Kemp et al., Tetrahedron Lett. 29:5081-5082 (1988) as well as Kemp et al., Tetrahedron Lett. 29:5057-5060 (1988), Kemp et al., Tetrahedron Lett. 29:4935-4938 (1988) and Kemp et al., J. Org. Chem. 54:109-115 (1987). Other suitable but exemplary peptidomimetics are shown in Nagai and Sato, Tetrahedron Lett. 26:647-650 (1985); Di Maio et al., J. Chem. Soc. Perkin Trans., 1687 (1985); Kahn et al., Tetrahedron Lett. 30:2317 (1989); Olson et al., J. Am. Chem. Soc. 112:323-333 (1990); Garvey et al., J. Org. Chem. 56:436 (1990). Further suitable exemplary peptidomimetics include hydroxy-1,2,3,4-tetrahydroisoquinoline-3-carboxylate (Miyake et al., J. Takeda Res. Labs 43:53-76 (1989)); 1,2,3,4-tetrahydro-isoquinoline-3-carboxylate (Kazmierski et al., J. Am. Chem. Soc. 133:2275-2283 (1991)); histidine isoquinolone carboxylic acid (HIC) (Zechel et al., Int. J. Pep. Protein Res. 43 (1991)); (2S, 3S)-methyl-phenylalanine, (2S, 3R)-methyl-phenylalanine, (2R, 3S)-methyl-phenylalanine and (2R, 3R)-methyl-phenylalanine (Kazmierski and Hruby, Tetrahedron Lett. (1991)).
- Exemplary, illustrative but non-limiting non-natural amino acids include beta-amino acids (beta3 and beta2), homo-amino acids, cyclic amino acids, aromatic amino acids, Pro and Pyr derivatives, 3-substituted Alanine derivatives, Glycine derivatives, ring-substituted Phe and Tyr Derivatives, linear core amino acids or diamino acids. They are available from a variety of suppliers, such as Sigma-Aldrich (USA) for example.
- Protein Chemical Modifications
- In the present invention any part of a protein according to at least some embodiments of the invention may optionally be chemically modified, i.e. changed by addition of functional groups. For example the side amino acid residues appearing in the native sequence may optionally be modified, although as described below alternatively other parts of the protein may optionally be modified, in addition to or in place of the side amino acid residues. The modification may optionally be performed during synthesis of the molecule if a chemical synthetic process is followed, for example by adding a chemically modified amino acid. However, chemical modification of an amino acid when it is already present in the molecule (“in situ” modification) is also possible.
- The amino acid of any of the sequence regions of the molecule can optionally be modified according to any one of the following exemplary types of modification (in the peptide conceptually viewed as “chemically modified”). Non-limiting exemplary types of modification include carboxymethylation, acylation, phosphorylation, glycosylation or fatty acylation. Ether bonds can optionally be used to join the serine or threonine hydroxyl to the hydroxyl of a sugar. Amide bonds can optionally be used to join the glutamate or aspartate carboxyl groups to an amino group on a sugar (Garg and Jeanloz, Advances in Carbohydrate Chemistry and Biochemistry, Vol. 43, Academic Press (1985); Kunz, Ang. Chem. Int. Ed. English 26:294-308 (1987)). Acetal and ketal bonds can also optionally be formed between amino acids and carbohydrates. Fatty acid acyl derivatives can optionally be made, for example, by acylation of a free amino group (e.g., lysine) (Toth et al., Peptides: Chemistry, Structure and Biology, Rivier and Marshal, eds., ESCOM Publ., Leiden, 1078-1079 (1990)).
- As used herein the term “chemical modification”, when referring to a protein or peptide according to the present invention, refers to a protein or peptide where at least one of its amino acid residues is modified either by natural processes, such as processing or other post-translational modifications, or by chemical modification techniques which are well known in the art. Examples of the numerous known modifications typically include, but are not limited to: acetylation, acylation, amidation, ADP-ribosylation, glycosylation, GPI anchor formation, covalent attachment of a lipid or lipid derivative, methylation, myristylation, pegylation, prenylation, phosphorylation, ubiquitination, or any similar process.
- Other types of modifications optionally include the addition of a cycloalkane moiety to a biological molecule, such as a protein, as described in PCT Application No. WO 2006/050262, hereby incorporated by reference as if fully set forth herein. These moieties are designed for use with biomolecules and may optionally be used to impart various properties to proteins.
- Furthermore, optionally any point on a protein may be modified. For example, pegylation of a glycosylation moiety on a protein may optionally be performed, as described in PCT Application No. WO 2006/050247, hereby incorporated by reference as if fully set forth herein. One or more polyethylene glycol (PEG) groups may optionally be added to O-linked and/or N-linked glycosylation. The PEG group may optionally be branched or linear. Optionally any type of water-soluble polymer may be attached to a glycosylation site on a protein through a glycosyl linker.
- Altered Glycosylation
- Proteins according to at least some embodiments of the invention may be modified to have an altered glycosylation pattern (i.e., altered from the original or native glycosylation pattern).
- As used herein, “altered” means having one or more carbohydrate moieties deleted, and/or having at least one glycosylation site added to the original protein.
- Glycosylation of proteins is typically either N-linked or O-linked. N-linked refers to the attachment of the carbohydrate moiety to the side chain of an asparagine residue. The tripeptide sequences, asparagine-X-serine and asparagine-X-threonine, where X is any amino acid except proline, are the recognition sequences for enzymatic attachment of the carbohydrate moiety to the asparagine side chain. Thus, the presence of either of these tripeptide sequences in a polypeptide creates a potential glycosylation site. O-linked glycosylation refers to the attachment of one of the sugars N-acetylgalactosamine, galactose, or xylose to a hydroxyamino acid, most commonly serine or threonine, although 5-hydroxyproline or 5-hydroxylysine may also be used.
- Addition of glycosylation sites to proteins according to at least some embodiments of the invention is conveniently accomplished by altering the amino acid sequence of the protein such that it contains one or more of the above-described tripeptide sequences (for N-linked glycosylation sites). The alteration may also be made by the addition of, or substitution by, one or more serine or threonine residues in the sequence of the original protein (for O-linked glycosylation sites). The protein's amino acid sequence may also be altered by introducing changes at the DNA level.
- Another means of increasing the number of carbohydrate moieties on proteins is by chemical or enzymatic coupling of glycosides to the amino acid residues of the protein.
- Depending on the coupling mode used, the sugars may be attached to (a) arginine and histidine, (b) free carboxyl groups, (c) free sulfhydryl groups such as those of cysteine, (d) free hydroxyl groups such as those of serine, threonine, or hydroxyproline, (e) aromatic residues such as those of phenylalanine, tyrosine, or tryptophan, or (f) the amide group of glutamine. These methods are described in WO 87/05330, and in Aplin and Wriston, CRC Crit. Rev. Biochem., 22: 259-306 (1981).
- Removal of any carbohydrate moieties present on proteins according to at least some embodiments of the invention may be accomplished chemically or enzymatically. Chemical deglycosylation requires exposure of the protein to trifluoromethanesulfonic acid, or an equivalent compound. This treatment results in the cleavage of most or all sugars except the linking sugar (N-acetylglucosamine or N-acetylgalactosamine), leaving the amino acid sequence intact.
- Chemical deglycosylation is described by Hakimuddin et al., Arch. Biochem. Biophys., 259: 52 (1987); and Edge et al., Anal. Biochem., 118: 131 (1981). Enzymatic cleavage of carbohydrate moieties on proteins can be achieved by the use of a variety of endo- and exo-glycosidases as described by Thotakura et al., Meth. Enzymol., 138: 350 (1987).
- Methods of Treatment
- As used herein “therapeutic agent” is any one of the C1ORF32 proteins and polypeptides fragments according to at least some embodiments of the present invention, and/or fusion proteins and/or multimeric proteins comprising same, and/or nucleic acid sequence or fragments thereof encoding same.
- As mentioned herein above, the therapeutic agents can be used to treat immune related disorders as recited herein, and/or autoimmune disorders as recited herein, and/or infectious disorders as recited herein, and/or for blocking and/or promoting immune costimulation mediated by the C1ORF32 polypeptides in a subject.
- According to an additional aspect of the present invention the therapeutic agents can be used to prevent pathologic inhibition of T cell activity, such as that directed against chronic infections; and/or prevent pathologic stimulation of T cell activity, such as that directed against autoantigens in autoimmune diseases. For example, these molecules can be administered to cells in culture, in vitro or ex vivo, or to human subjects, e.g., in vivo, to treat, prevent and to diagnose a variety of disorders. Preferred subjects include human patients, having disorders mediated by cells expressing the C1ORF32 protein, and cells that possess C1ORF32 activity.
- According to an additional aspect of the present invention the therapeutic agents can be used to inhibit T cell activation, as can be manifested for example by T cell proliferation and cytokine secretion.
- Thus, according to an additional aspect of the present invention there is provided a method of treating immune related disorders as recited herein, and/or autoimmune disorders as recited herein, and/or infectious disorders as recited herein, and/or for blocking or promoting immune stimulation mediated by the C1ORF32 polypeptide in a subject by administering to a subject in need thereof an effective amount of any one of the therapeutic agents and/or a pharmaceutical composition comprising any of the therapeutic agents and further comprising a pharmaceutically acceptable diluent or carrier.
- The subject according to the present invention is a mammal, preferably a human which is diagnosed with one of the disease, disorder or conditions described hereinabove, or alternatively is predisposed to at least one infectious disorder, and/or immune related disorder.
- “Treatment” refers to both therapeutic treatment and prophylactic or preventative measures. Those in need of treatment include those already with the disorder as well as those in which the disorder is to be prevented. Hence, the mammal to be treated herein may have been diagnosed as having the disorder or may be predisposed or susceptible to the disorder. “Mammal” for purposes of treatment refers to any animal classified as a mammal, including humans, domestic and farm animals, and zoo, sports, or pet animals, such as dogs, horses, cats, cows, etc. Preferably, the mammal is human.
- As used herein the term “treating” refers to preventing, delaying the onset of, curing, reversing, attenuating, alleviating, minimizing, suppressing or halting the deleterious effects of the above-described diseases, disorders or conditions. It also includes managing the disease as described above. By “manage” it is meant reducing the severity of the disease, reducing the frequency of episodes of the disease, reducing the duration of such episodes, reducing the severity of such episodes and the like.
- Treating, according to the present invention, can be effected by specifically upregulating the amount and/or the expression of at least one of the polypeptides of the present invention in the subject.
- Optionally, upregulation may be effected by administering to the subject at least one of the polypeptides of the present invention (e.g., recombinant or synthetic) or an active portion thereof, as described herein. However, since the bioavailability of large polypeptides may potentially be relatively small due to high degradation rate and low penetration rate, administration of polypeptides is preferably confined to small peptide fragments (e.g., about 100 amino acids). The polypeptide or peptide may optionally be administered in as part of a pharmaceutical composition, described in more detail below.
- It will be appreciated that treatment of the above-described diseases according to at least some embodiments of the present invention may be combined with other treatment methods known in the art (i.e., combination therapy), as described herein.
- Immune System Related Disease Treatment
- The therapeutic agents and/or a pharmaceutical composition comprising same, as recited herein, according to at least some embodiments of the present invention can also be used in combination with one or more of the following agents to regulate an immune response: soluble gp39 (also known as CD40 ligand (CD40L), CD154, T-BAM, TRAP), soluble CD29, soluble CD40, soluble CD80 (e.g. ATCC 68627), soluble CD86, soluble CD28 (e.g. 68628), soluble CD56, soluble Thy-1, soluble CD3, soluble TCR, soluble VLA-4, soluble VCAM-1, soluble LECAM-1, soluble ELAM-1, soluble CD44, antibodies reactive with gp39 (e.g. ATCC HB-10916, ATCC HB-12055 and ATCC HB-12056), antibodies reactive with CD40 (e.g. ATCC HB-9110), antibodies reactive with B7 (e.g. ATCC HB-253, ATCC CRL-2223, ATCC CRL-2226, ATCC HB-301, ATCC HB-11341, etc), antibodies reactive with CD28 (e.g. ATCC HB-11944 or mAb 9.3), antibodies reactive with LFA-1 (e.g. ATCC HB-9579 and ATCC TIB-213), antibodies reactive with LFA-2, antibodies reactive with IL-2, antibodies reactive with IL-12, antibodies reactive with IFN-gamma, antibodies reactive with CD2, antibodies reactive with CD48, antibodies reactive with any ICAM (e.g., ICAM-1 (ATCC CRL-2252), ICAM-2 and ICAM-3), antibodies reactive with CTLA4 (e.g. ATCC HB-304), antibodies reactive with Thy-1, antibodies reactive with CD56, antibodies reactive with CD3, antibodies reactive with CD29, antibodies reactive with TCR, antibodies reactive with VLA-4, antibodies reactive with VCAM-1, antibodies reactive with LECAM-1, antibodies reactive with ELAM-1, antibodies reactive with CD44; L104EA29YIg, CD80 monoclonal antibodies (mAbs), CD86 mAbs, gp39 mAbs, CD40 mAbs, CD28 mAbs; anti-LFA1 mAbs, antibodies or other agents targeting mechanisms of the immune system such as CD52 (alemtuzumab), CD25 (daclizumab), VLA-4 (natalizumab), CD20 (rituximab), IL2R (daclizumab) and MS4A1 (ocrelizumab); novel oral immunomodulating agents have shown to prevent lymphocyte recirculation from lymphoid organs such as fingolimod (FTY720) or leading to lymphocyte depletion such as mylinax (oral cladribine) or teriflunomide; and agents that prevent immunoactivation such as panaclar (dimethyl fumarate BG-12) or laquinimod (ABR216062). Other combinations will be readily appreciated and understood by persons skilled in the art. In some embodiments, the therapeutic agents can be used to attenuate or reverse the activity of a pro-inflammatory drug, and/or limit the adverse effects of such drugs.
- As persons skilled in the art will readily understand, the combination can include the therapeutic agents and/or a pharmaceutical composition comprising same, according to at least some embodiments of the invention and one other immunosuppressive agent; the therapeutic agents and/or a pharmaceutical composition comprising same, as recited herein, with two other immunosuppressive agents, the therapeutic agents and/or a pharmaceutical composition comprising same, as recited herein, with three other immunosuppressive agents, etc. The determination of the optimal combination and dosages can be determined and optimized using methods well known in the art.
- The therapeutic agent according to the present invention and one or more other therapeutic agents can be administered in either order or simultaneously.
- The invention also encompasses the use of the therapeutic agents and/or a pharmaceutical composition comprising same according to at least some embodiments of the invention in combination with other pharmaceutical agents to treat immune system diseases. For example, autoimmune disease may be treated with molecules according to at least some embodiments of the invention in conjunction with, immunosuppressants such as corticosteroids, cyclosporin, cyclophosphamide, prednisone, azathioprine, methotrexate, rapamycin, tacrolimus, biological agents such as TNF-alpha blockers or antagonists, immunosuppressive agents (e.g., antibodies against other lymphocyte surface markers (e.g., CD40, alpha-4 integrin) or against cytokines), other fusion proteins (e.g., CTLA-4-Ig (Orencia®), TNFR-Ig (Enbrel®)), TNF-alpha blockers such as Enbrel, Remicade, Cimzia and Humira, cyclophosphamide (CTX) (i.e. Endoxan®, Cytoxan®, Neosar®, Procytox®, Revimmune™), methotrexate (MTX) (i.e. Rheumatrex®, Trexall®), belimumab (i.e. Benlysta®), or other immunosuppressive drugs (e.g., cyclosporin A, FK506-like compounds, rapamycin compounds, or steroids), anti-proliferatives, cytotoxic agents, or other compounds that may assist in immunosuppression. or any other biological agent targeting any inflammatory cytokine, nonsteroidal antiinflammatory drugs/Cox-2 inhibitors, hydroxychloroquine, sulphasalazopryine, gold salts, etanercept, infliximab, mycophenolate mofetil, basiliximab, atacicept, rituximab, cytoxan, interferon beta-1a, interferon beta-1b, glatiramer acetate, mitoxantrone hydrochloride, anakinra and/or other biologics and/or intravenous immunoglobulin (IVIG). Non-limiting examples of such known therapeutics include interferons, such as IFN-beta-1a (REBIF®. AVONEX® and CINNOVEX ®) and IFN-beta-1b (BETASERON®, EXTAVIA®, BETAFERON®, ZIFERON®); glatiramer acetate (COPAXONE®), a polypeptide; natalizumab (TYSABRI®); and mitoxantrone (NOVANTRONE®), a cytotoxic agent.
- Thus, treatment of multiple sclerosis using the agents according to at least some embodiments of the present invention may be combined with, for example, any known therapeutic agent or method for treating multiple sclerosis. Non-limiting examples of such known therapeutic agent or method for treating multiple sclerosis include interferon class, IFN-beta-1a (REBIF®, AVONEX® and CINNOVEX®) and IFN-beta-1b (BETASERON®, EXTAVIA®, BETAFERON®, ZIFERON®); glatiramer acetate (COPAXONE®), a polypeptide; natalizumab (TYSABRI®); and mitoxantrone (NOVANTRONE®), a cytotoxic agent, Fampridine (AMPYRA®). Other drugs include corticosteroids, methotrexate, cyclophosphamide, azathioprine, and intravenous immunoglobulin (IVIG), inosine, Ocrelizumab (R1594), Mylinax (Caldribine), alemtuzumab (Campath), daclizumab (Zenapax), Panaclar/dimethyl fumarate (BG-12), Teriflunomide (HMR1726), fingolimod (FTY720), laquinimod (ABR216062), as well as Haematopoietic stem cell transplantation, Neurovax, Rituximab (Rituxan) BCG vaccine, low dose naltrexone, helminthic therapy, angioplasty, venous stents, and alternative therapy, such as vitamin D, polyunsaturated fats, medical marijuana.
- Thus, treatment of rheumatoid arthritis, using the agents according to at least some embodiments of the present invention may be combined with, for example, any known therapeutic agent or method for treating rheumatoid arthritis. Non-limiting examples of such known therapeutic agents or methods for treating rheumatoid arthritis include glucocorticoids, nonsteroidal anti-inflammatory drug (NSAID) such as salicylates, or cyclooxygenase-2 inhibitors, ibuprofen and naproxen, diclofenac, indomethacin, etodolac Disease-modifying antirheumatic drugs (DMARDs)-Oral DMARDs: Auranofin (Ridaura), Azathioprine (Imuran), Cyclosporine (Sandimmune, Gengraf, Neoral, generic), D-Penicillamine (Cuprimine), Hydroxychloroquine (Plaquenil), IM gold Gold sodium thiomalate (Myochrysine) Aurothioglucose (Solganal), Leflunomide (Arava), Methotrexate (Rheumatrex), Minocycline (Minocin), Staphylococcal protein A immunoadsorption (Prosorba column), Sulfasalazine (Azulfidine). Biologic DMARDs: TNF-α blockers including Adalimumab (Humira), Etanercept (Enbrel), Infliximab (Remicade), golimumab (Simponi), certolizumab pegol (Cimzia), and other Biological DMARDs, such as Anakinra (Kineret), Rituximab (Rituxan), Tocilizumab (Actemra), CD28 inhibitor including Abatacept (Orencia) and Belatacept.
- Thus, treatment of IBD, using the agents according to at least some embodiments of the present invention may be combined with, for example, any known therapeutic agent or method for treating IBD. Non-limiting examples of such known therapeutic agents or methods for treating IBD include immunosuppression to control the symptom, such as prednisone, Mesalazine (including Asacol, Pentasa, Lialda, Aspiro),azathioprine (Imuran), methotrexate, or 6-mercaptopurine, steroids, Ondansetron, TNF-α blockers (including infliximab, adalimumab golimumab, certolizumab pegol), Orencia (abatacept), ustekinumab (Stelara®), Briakinumab (ABT-874), Certolizumab pegol (Cimzia®), ITF2357 (givinostat), Natalizumab (Tysabri), Firategrast (SB -683699), Remicade (infliximab), vedolizumab (MLN0002), other drugs including GSK1605786 CCX282-B (Traficet-EN), AJM300, Stelara (ustekinumab), Semapimod (CNI-1493) tasocitinib (CP-690550), LMW Heparin MMX, Budesonide MMX, Simponi (golimumab), MultiStem®, Gardasil HPV vaccine, Epaxal Berna (virosomal hepatitis A vaccine), surgery, such as bowel resection, strictureplasty or a temporary or permanent colostomy or ileostomy; antifungal drugs such as nystatin (a broad spectrum gut antifungal) and either itraconazole (Sporanox) or fluconazole (Diflucan); alternative medicine, prebiotics and probiotics, cannabis, Helminthic therapy or ova of the Trichuris suis helminth.
- Thus, treatment of psoriasis, using the agents according to at least some embodiments of the present invention may be combined with, for example, any known therapeutic agent or method for treating psoriasis. Non-limiting examples of such known therapeutics for treating psoriasis include topical agents, typically used for mild disease, phototherapy for moderate disease, and systemic agents for severe disease. Non-limiting examples of topical agents: bath solutions and moisturizers, mineral oil, and petroleum jelly; ointment and creams containing coal tar, dithranol (anthralin), corticosteroids like desoximetasone (Topicort), Betamethasone, fluocinonide, vitamin D3 analogues (for example, calcipotriol), and retinoids. Non-limiting examples of phototherapy: sunlight; wavelengths of 311-313 nm, psoralen and ultraviolet A phototherapy (PUVA). Non-limiting examples of systemic agents: Biologics, such as interleukin antagonists, TNF-α blockers including antibodies such as infliximab (Remicade), adalimumab (Humira), golimumab, certolizumab pegol, and recombinant TNF-α decoy receptor, etanercept (Enbrel); drugs that target T cells, such as efalizumab (Xannelim/Raptiva), alefacept (Ameviv), dendritic cells such Efalizumab; monoclonal antibodies (MAbs) targeting cytokines, including anti-IL-12/IL-23 (ustekinumab (brand name Stelara)) and anti-Interleukin-17; Briakinumab (ABT-874); small molecules, including but not limited to ISA247; Immunosuppressants, such as methotrexate, cyclosporine; vitamin A and retinoids (synthetic forms of vitamin A); and alternative therapy, such as changes in diet and lifestyle, fasting periods, low energy diets and vegetarian diets, diets supplemented with fish oil rich in Vitamin A and Vitamin D (such as cod liver oil), Fish oils rich in the two omega-3 fatty acids eicosapentaenoic acid (EPA) and docosahexaenoic acid (DHA) and contain Vitamin E Ichthyotherapy, Hypnotherapy, cannabis.
- Thus, treatment of
type 1 diabetes, using the agents according to at least some embodiments of the present invention may be combined with, for example, any known therapeutic agent or method for treating type ldiabetes. Non-limiting examples of such known therapeutics for treatingtype 1 diabetes include insulin, insulin analogs, islet transplantation, stem cell therapy including PROCHYMAL®, non-insulin therapies such as il-1beta inhibitors including Anakinra (Kineret®), Abatacept (Orencia®), Diamyd, alefacept (Ameviv®), Otelixizumab, DiaPep277 (Hsp60 derived peptide), Alpha 1-Antitrypsin, Prednisone, azathioprine, Ciclosporin, El-INT (an injectable islet neogenesis therapy comprising an epidermal growth factor analog and a gastrin analog), statins including Zocor®, Simlup®, Simcard®, Simvacor®, Sitagliptin (dipeptidyl peptidase (DPP-4) inhibitor), Anti-CD3 mAb (e.g., Teplizumab); CTLA4-Ig (abatacept), Anti IL-1Beta (Canakinumab), Anti-CD20 mAb (e.g, rituximab). - Thus, treatment of uveitis, using the agents according to at least some embodiments of the present invention may be combined with, for example, any known therapeutic agent or method for treating uveitis. Non-limiting examples of such known therapeutics for treating uveitis include corticosteroids, topical cycloplegics, such as atropine or homatropine, or injection of PSTTA (posterior subtenon triamcinolone acetate), antimetabolite medications, such as methotrexate, TNF-α blockers (including infliximab, adalimumab, etanercept, golimumab, certolizumab pegol).
- Thus, treatment for Sjogren's syndrome, using the agents according to at least some embodiments of the present invention may be combined with, for example, any known therapeutic agent or method for treating for Sjogren's syndrome. Non-limiting examples of such known therapeutics for treating for Sjogren' s syndrome include Cyclosporine, pilocarpine (Salagen) and cevimeline (Evoxac), Hydroxychloroquine (Plaquenil), cortisone (prednisone and others) and/or azathioprine (Imuran) or cyclophosphamide (Cytoxan), Dexamethasone, Thalidomide, Dehydroepiandrosterone, NGX267, Rebamipide, FID 114657, Etanercept, Raptiva, Belimumab, MabThera (rituximab); Anakinra, intravenous immune globulin (IVIG), Allogeneic Mesenchymal Stem Cells (AlloMSC), Automatic neuro-electrostimulation by “Saliwell Crown”.
- Thus, treatment for systemic lupus erythematosus, using the agents according to at least some embodiments of the present invention may be combined with, for example, any known therapeutic agent or method for treating for systemic lupus erythematosus. Non-limiting examples of such known therapeutics for treating for systemic lupus erythematosus include corticosteroids and Disease-modifying antirheumatic drugs (DMARDs), commonly anti-malarial drugs such as plaquenil and immunosuppressants (e.g. methotrexate and azathioprine) Hydroxychloroquine, cytotoxic drugs (e.g., cyclophosphamide and mycophenolate), Hydroxychloroquine (HCQ), Benlysta (belimumab), nonsteroidal anti-inflammatory drugs, Prednisone, Cellcept, Prograf, Atacicept, Lupuzor, Intravenous Immunoglobulins (IVIGs), CellCept (mycophenolate mofetil), Orencia, CTLA4-IgG4m (RG2077), rituximab, Ocrelizumab, Epratuzumab, CNTO 136, Sifalimumab (MEDI-545), A-623 (formerly AMG 623), AMG 557, Rontalizumab, paquinimod (ABR-215757), LY2127399, CEP-33457, Dehydroepiandrosterone, Levothyroxine, abetimus sodium (LIP 394), Memantine, Opiates, Rapamycin, Renal transplantation, stem cell transplantation.
- The therapeutic agents and/or a pharmaceutical composition comprising same, as recited herein, according to at least some embodiments of the invention, may be administered as the sole active ingredient or together with other drugs in immunomodulating regimens or other anti-inflammatory agents e.g. for the treatment or prevention of allo- or xenograft acute or chronic rejection or inflammatory or autoimmune disorders, or to induce tolerance.
- For example, it may be used in combination with a calcineurin inhibitor, e.g. cyclosporin A or FK506; an immunosuppressive macrolide, e.g. rapamycine or a derivative thereof; e.g. 40-O-(2-hydroxy)ethyl-rapamycin, a lymphocyte homing agent, e.g. FTY720 or an analog thereof, corticosteroids; cyclophosphamide; azathioprene; methotrexate; leflunomide or an analog thereof; mizoribine; mycophenolic acid; mycophenolate mofetil; 15-deoxyspergualine or an analog thereof; immunosuppressive monoclonal antibodies, e.g., monoclonal antibodies to leukocyte receptors, e.g., MHC, CD2, CD3, CD4,
CD 1 la/CD18, CD7, CD25, CD 27, B7, CD40, CD45, CD58, CD 137, ICOS, CD150 (SLAM), 0X40, 4-1BB or their ligands; or other immunomodulatory compounds, e.g. CTLA4-Ig (abatacept, ORENCIA® or belatacept), CD28-Ig, B7-H4-Ig, or other costimulatory agents, or adhesion molecule inhibitors, e.g. mAbs or low molecular weight inhibitors including LFA-1 antagonists, Selectin antagonists and VLA-4 antagonists. - Where the therapeutic agents and/or a pharmaceutical composition comprising same, as recited herein, according to at least some embodiments of the invention are administered in conjunction with other immunosuppressive/immunomodulatory or anti-inflammatory therapy, e.g. as herein above specified, dosages of the co-administered immunosuppressant, immunomodulatory or anti-inflammatory compound will of course vary depending on the type of co-drug employed, e.g. whether it is a steroid or a cyclosporin, on the specific drug employed, on the condition being treated and so forth.
- According to at least some embodiments of the present invention, there is provided use of a combination of the therapeutic agents and/or a pharmaceutical composition comprising same, as recited herein, and a known therapeutic agent effective for treating infection.
- The therapeutic agents and/or a pharmaceutical composition comprising same, as recited herein, can be administered in combination with one or more additional therapeutic agents used for treatment of bacterial infections, including, but not limited to, antibiotics including
- Aminoglycosides, Carbapenems, Cephalosporins, Macrolides, Lincosamides, Nitrofurans, penicillins, Polypeptides, Quinolones, Sulfonamides, Tetracyclines, drugs against mycobacteria including but not limited to Clofazimine, Cycloserine, Cycloserine, Rifabutin, Rifapentine, Streptomycin and other antibacterial drugs such as Chloramphenicol, Fosfomycin, Metronidazole, Mupirocin, and Tinidazole.
- The therapeutic agents and/or a pharmaceutical composition comprising same, as recited herein, can be administered in combination with one or more additional therapeutic agents used for treatment of viral infections, including, but not limited to, antiviral drugs such as oseltamivir (brand name Tamiflu) and zanamivir (brand name Relenza) Arbidol—adamantane derivatives (Amantadine, Rimantadine)—neuraminidase inhibitors (Oseltamivir, Laninamivir, Peramivir, Zanamivir) nucleotide analog reverse transcriptase inhibitor including Purine analogue guanine (Aciclovir#/Valacyclovir, Ganciclovir/Valganciclovir, Penciclovir/Famciclovir) and adenine (Vidarabine), Pyrimidine analogue, uridine (Idoxuridine, Trifluridine, Edoxudine), thymine (Brivudine), cytosine (Cytarabine); Foscarnet; Nucleoside analogues/NARTIs: Entecavir, Lamivudine, Telbivudine, Clevudine; Nucleotide analogues/NtRTIs: Adefovir , Tenofovir; Nucleic acid inhibitors such as Cidofovir; InterferonInterferon alfa-2b, Peginterferon alfa-2a; Ribavirin#/Taribavirin; antiretroviral drugs including zidovudine, lamivudine, abacavir, lopinavir, ritonavir, tenofovir/emtricitabine, efavirenz each of them alone or a various combinations, gp41 (Enfuvirtide), Raltegravir, protease inhibitors such as Fosamprenavir, Lopinavir and Atazanavir, Methisazone, Docosanol, Fomivirsen, Tromantadine.
- The therapeutic agents and/or a pharmaceutical composition comprising same, as recited herein, can be administered in combination with one or more additional therapeutic agents used for treatment of fungal infections, including, but not limited to, antifungal drugs of the Polyene antifungals, Imidazole, triazole, and thiazole antifungals, Allylamines, Echinocandins or other anti fungal drugs.
- Alternatively or additionally, an upregulating method may optionally be effected by specifically upregulating the amount (optionally expression) in the subject of at least one of the polypeptides of the present invention or active portions thereof.
- As is mentioned hereinabove and in the Examples section which follows, the biomolecular sequences of this aspect of the present invention may be used as valuable therapeutic tools in the treatment of diseases, disorders or conditions in which altered activity or expression of the wild-type gene product (known protein) is known to contribute to disease, disorder or condition onset or progression. For example, in case a disease is caused by overexpression of a membrane bound-receptor, a soluble variant thereof may be used as an antagonist which competes with the receptor for binding the ligand, to thereby terminate signaling from the receptor.
- According to at least some embodiments, immune cells, preferably T cells, can be contacted in vivo or ex vivo with the therapeutic agents to modulate immune responses. The T cells contacted with the therapeutic agents can be any cell which expresses the T cell receptor, including α/β and γ/δ T cell receptors. T-cells include all cells which express CD3, including T-cell subsets which also express CD4 and CDS. T-cells include both naive and memory cells and effector cells such as CTL. T-cells also include cells such as Th1, Tc1, Th2, Tc2, Th3, Th17, Th22, Treg, and Tr1 cells. T-cells also include NKT-cells and similar unique classes of the T-cell lineage.
- In a further embodiment, the additional therapeutic agent functions to inhibit or reduce T cell activation through a separate pathway. In one such embodiment, the additional therapeutic agent is a CTL A-4 fusion protein, such as CTLA-4-Ig (abatacept). CTLA-4-Ig fusion proteins compete with the co-stimulatory receptor, CD28, on T cells for binding to CD80/CD86 (B7-1/B7-2) on antigen presenting cells, and thus function to inhibit T cell activation. In another embodiment, the additional therapeutic agent is a CTLA-4-Ig fusion protein known as belatacept. Belatacept contains two amino acid substitutions (L104E and A29Y) that markedly increase its avidity to CD86 in vivo. In another embodiment, the additional therapeutic agent is Maxy-4.
- In another embodiment, the second therapeutic agent is cyclophosphamide (CTX). Cyclophosphamide (the generic name for Endoxan®, Cytoxan®, Neosar®, Procytox®, Revimmune™), also known as cytophosphane, is a nitrogen mustard alkylating agent from the oxazophorines group. It is used to treat various types of cancer and some autoimmune disorders. In a further embodiment, IgC1ORF32 polypeptides, fragments or fusion proteins thereof and CTX are coadministered in effective amount to prevent or treat a chronic autoimmune disease or disorder such as Systemic lupus erythematosus (SLE). Cyclophosphamide (CTX) is the primary drug used for diffuse proliferative glomerulonephritis in patients with renal lupus. In some embodiments the combination therapy is administered in an effective amount to reduce the blood or serum levels of anti-double stranded DNA (anti-ds DNA) auto antibodies and/or to reduce proteinuria in a patient in need thereof.
- In another embodiment, the second therapeutic is Tysabri or another therapeutic for MS. In a further embodiment, IgC1ORF32 polypeptides, fragments or fusion proteins thereof is cycled with Tysabri or used during a drug holiday in order to allow less frequent dosing with the second therapeutic and reduce the risk of side effects such as PML and to prevent resistance to the second therapeutic.
- In another embodiment, the second therapeutic agent preferentially treats chronic inflammation, whereby the treatment regimen targets both acute and chronic inflammation. In a further embodiment the second therapeutic is a TNF-alpha blocker.
- In another embodiment, the second therapeutic agent is a small molecule that inhibits or reduces differentiation, proliferation, activity, and/or cytokine production and/or secretion by Th1, Th17, Th22, and/or other cells that secrete, or cause other cells to secrete, inflammatory molecules, including, but not limited to, IL-1beta, TNF-alpha, TGF-beta, IFN-gamma, IL-17, IL-6, IL-23, IL-22, IL-21, and MMPs. In another embodiment, the second therapeutic agent is a small molecule that interacts with Tregs, enhances Treg activity, promotes or enhances IL-10 secretion by Tregs, increases the number of Tregs, increases the suppressive capacity of Tregs, or combinations thereof.
- Typically useful small molecules are organic molecules, preferably small organic compounds having a molecular weight of more than 100 and less than about 2,500 daltons, more preferably between 100 and 2000, more preferably between about 100 and about 1250, more preferably between about 100 and about 1000, more preferably between about 100 and about 750, more preferably between about 200 and about 500 daltons. Small molecules comprise functional groups necessary for structural interaction with proteins, particularly hydrogen bonding, and typically include at least an amine, carbonyl, hydroxyl or carboxyl group, preferably at least two of the functional chemical groups. The small molecules often comprise cyclical carbon or heterocyclic structures andlor aromatic or polyaromatic structures substituted with one or more of the above functional groups. Small molecules also include biomolecules including peptides, saccharides, fatty acids, steroids, purines, pyrimidines, derivatives, structural analogs or combinations thereof. In one embodiment, the small molecule is retinoic acid or a derivative thereof. The examples below demonstrate that retinoic acid inhibits or reduces differentiation and/or activity of ThI 7 cells. In a further embodiment, the compositions are used in combination or succession with compounds that increase Treg activity or production. Exemplary Treg enhancing agents include but are not limited to glucocorticoid fluticasone, salmeteroal, antibodies to IL-12, IFN-gamma, and IL-4; vitamin D3, and dexamethasone, and combinations thereof. Antibodies to other proinflammatory molecules can also be used in combination or alternation with the disclosed C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof. Preferred antibodies bind to IL-6, IL-23, IL-22 or IL-21.
- As used herein the term “rapamycin compound” includes the neutral tricyclic compound rapamycin, rapamycin derivatives, rapamycin analogs, and other macrolide compounds which are thought to have the same mechanism of action as rapamycin (e.g., inhibition of cytokine function). The language “rapamycin compounds” includes compounds with structural similarity to rapamycin, e.g., compounds with a similar macrocyclic structure, which have been modified to enhance their therapeutic effectiveness. Exemplary Rapamycin compounds are known in the art. The language “FK506-Hke compounds” includes FK506, and FK506 derivatives and analogs, e.g., compounds with structural similarity to FK506, e.g., compounds with a similar macrocyclic structure which have been modified to enhance their therapeutic effectiveness. Examples of FK506-like compounds include, for example, those described in WO 00101385. Preferably, the language “rapamycin compound” as used herein does not include FK506-like compounds.
- Other suitable therapeutics include, but are not limited to, anti-inflammatory agents. The anti-inflammatory agent can be non-steroidal, steroidal, or a combination thereof. One embodiment provides oral compositions containing about 1% (w/w) to about 5% (w/w), typically about 2.5 (w/w) or an anti-inflammatory agent. Representative examples of non-steroidal anti-inflammatory agents include, without limitation, oxicams, such as piroxicam, isoxicam, tenoxicam, sudoxicam; salicylates, such as aspirin, disalcid, benorylate, trilisate, safapryn, solprin, diflunisal, and fendosal; acetic acid derivatives, such as diclofenac, fenclofenac, indomethacin, sulindac, tolmetin, isoxepac, furofenac, tiopinac, zidometacin, acematacin, fentiazac, zomepirac, clmdanac, oxepinac, felbmac, and ketorolac; fenamates, such as mefenamic, meclofenamic, flufenamic, niflumic, and tolfenamic acids; propionic acid derivatives, such as ibuprofen, naproxen, benoxaprofen, flurbiprofen, ketoprofen, fenoprofen, fenbufen, indopropfen, pirprofen, carprofen, oxaprozin, pranoprofen, miroprofen, tioxaprofen, suprofen, alminoprofen, and tiaprofenic; pyrazoles, such as phenylbutazone, oxyphenbutazone, feprazone, azapropazone, and trimethazone. Mixtures of these non-steroidal anti-inflammatory agents may also be employed.
- Representative examples of steroidal anti-inflammatory drugs include, without limitation, corticosteroids such as hydrocortisone, hydroxyl-triamcinolone, alpha-methyl dexamethasone, dexamethasone-phosphate, beclomethasone dipropionates, clobetasol valerate, desonide, desoxymethasone, desoxycorticosterone acetate, dexamethasone, dichlorisone, diflorasone diacetate, diflucortolone valerate, fluadrenolone, fluclorolone acetonide, fludrocortisone, flumethasone pivalate, fiuosinolone acetonide, fluocinonide, flucortine butylesters, fluocortolone, fluprednidene (fluprednylidene) acetate, flurandrenolone, halcinonide, hydrocortisone acetate, hydrocortisone butyrate, methylprednisolone, triamcinolone acetonide, cortisone, cortodoxone, flucetonide, fludrocortisone, difluorosone diacetate, fluradrenolone, fludrocortisone, diflurosone diacetate, fluradrenolone acetonide, medrysone, amcinafel, amcinafide, betamethasone and the balance of its esters, chloroprednisone, chlorprednisone acetate, clocortelone, clescinolone, dichlorisone, diflurprednate, flucloronide, flunisolide, fluoromethalone, fluperolone, fluprednisolone, hydrocortisone valerate, hydrocortisone cyclopentylpropionate, hydrocortamate, meprednisone, paramethasone, prednisolones prednisone, beclomethasone dipropionate, triamcinolone, and mixtures thereof.
- Methods of Therapeutic Use
- The C1ORF32 polypeptides, fragments or fusion proteins thereof are useful as therapeutic agents. According to at least some embodiments, immune cells, preferably T cells, can be contacted in vivo or ex vivo with C1ORF32 fusion polypeptides to decrease or inhibit immune responses including, but not limited to inflammation. According to at least some other embodiments, immune cells, preferably T cells, can be contacted in vivo or ex vivo with C1ORF32 fusion polypeptides to decrease or inhibit T cell exhaustion, optionally in combination with another therapeutic agent. In both cases, preferably the costimulatory pathway is modulated to achieve a desired immune system balance.
- In either case, the T cells contacted with C1ORF32 fusion polypeptides can be any cell which expresses the T cell receptor, including α/β and γ/δ T cell receptors. T-cells include all cells which express CD3, including T-cell subsets which also express CD4 and CDS. T-cells include both naive and memory cells and effector cells such as CTL. T-cells also include cells such as Th1, Tc1, Th2, Tc2, Th3, Th17, Th22, Treg, and Trl cells. T-cells also include NKT-cells and similar unique classes of the T-cell lineage. For example the compositions can be used to modulate Th1, Th17, Th22, or other cells that secrete, or cause other cells to secrete, inflammatory molecules, including, but not limited to, IL-1beta, TNF-alpha, TGF-beta, IFN-gamma, IL-17, IL-6, IL-23, IL-22, IL-21, and MMPs. The compositions can also be used to increase or promote the activity of Tregs, increase the production of cytokines such as IL-10 from Tregs, increase the differentiation of Tregs, increase the number of Tregs, or increase the survival of Tregs. The compositions can also be used to increase or promote the activity of Th2 cells, increase the production of cytokines such as IL-10 or IL-4 from Th2 cells, increase the differentiation of Th2 cells, increase the number of Th2 cells, or increase the survival of Th2 cells.
- Although the below discussion applies generally to the reversal of T cell exhaustion, preferably for treatment of such exhaustion memory T cells are treated. Optionally, additionally or alternatively, treatment of T cell exhaustion encompasses the modulation of cytokine secretion, or other cells that secrete, or cause other cells to secrete, inflammatory molecules, including, but not limited to, IL-2, TNF-alpha, IFN-gamma, 15 Granzyme B and MMPs or modulate the expression of molecues of the costimulatory/coinhibtory-family including, but not limited to PD-1, Tim3, CTLA4 and LAGS.
- In some embodiments, the disclosed C1ORF32 polypeptide, selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof, are administered in combination with a second therapeutic. Combination therapies may be useful in immune modulation. In some embodiments, C1ORF32 polypeptide, selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof, can be used to attenuate or reverse the activity of a pro-inflammatory drug, and/or limit the adverse effects of such drugs.
- Other immune cells that can be treated with the disclosed C1ORF32 polypeptides, fragments or fusion thereof include T cell precursors, antigen presenting cells such as dendritic cells and monocytes or their precursors, B cells or combinations thereof. The C1ORF32 compositions can be used to modulate the production of antibodies by B cells by contacting the B cells with an effective amount of the C1ORF32 composition to inhibit or reduce antibody production by the B cell relative to a control. The C1ORF32 compositions can also modulate the production of cytokines by the B cells.
- Methods of Treating Inflammatory Responses
- The C1ORF32 polypeptides, fragments or fusion proteins thereof, selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof, according to at least some embodiments of the present invention inhibit T cell activation, as manifested by T cell proliferation and cytokine secretion. Specifically, the proteins inhibit T Th1 and Th17 responses, while promoting Th2 responses. The C1ORF32 polypeptides, fragments or fusion proteins thereof, selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof, according to at least some embodiments of the present invention are potentially used for therapy of diseases that require down-regulation of costimulatory pathways and or such that require downregulation of Th1 and/or Th17 responses. A further embodiment provides methods for treating or alleviating one or more symptoms of inflammation. In a further embodiment, the compositions and methods disclosed are useful for treating chronic and persistent inflammation. Inflammation in general can be treated using the disclosed C1ORF32 polypeptides or fragment or fusions thereof.
- According to at least some embodiments of the present invention, there is provided use of an isolated C1ORF32 polypeptide as described herein or a fusion protein comprising an isolated C1ORF32 polypeptide as described herein, optionally in a pharmaceutical composition comprising a pharmaceutically acceptable diluent or carrier, for treatment of an immune related disorder and/or infection.
- An immune response including inflammation can be inhibited or reduced in a subject, preferably a human, by administering an effective amount of C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof, to inhibit or reduce the biological activity of an immune cell or to reduce the amounts of proinflammatory molecules at a site of inflammation. Exemplary proinflammatory molecules include, but are not limited to, IL-1beta, TNF-alpha, TGF-beta, IFN-gamma, IL-17, IL-6, IL-23, IL-22, IL-21, and MMPs. Th1 and Th17 are exemplary T cells that can be targeted for inhibition by C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof, to inhibit or reduce inflammation.
- Without wishing to be limited by a single hypothesis for this biological mechanism or any other biological mechanism described herein, the C1ORF32 polypeptides, fragments or fusion proteins thereof are useful for treating inflammation by any or all of the following: inhibiting or reducing differentiation of Th1, Thl7, Th22, and/or other cells that secrete, or cause other cells to secrete, inflammatory molecules, including, but not limited to, IL-1beta, TNF-alpha, TGF-beta, IFN-gamma, IL-17, IL-6, IL-23, IL-22, IL-21, and MMPs; inhibiting or reducing activity of ThI, Th 17, Th22, and/or other cells that secrete, or cause other cells to secrete, inflammatory molecules, including, but not limited to, IL-1beta, TNF-alpha, TGF-beta, IFN-gamma, IL-17, IL-6, IL-23, IL-22, IL-21, and MMPs; inhibiting or reducing the Th1 and/or Thl7 pathways; inhibiting or reducing cytokine production and/or secretion by Th1, Th17, Th22, and/or other cells that secrete, or cause other cells to secrete, inflammatory molecules, including, but not limited to, IL-1beta, TNF-alpha, TGF-beta, IFN-gamma, IL-17, IL-6 IL-23, IL-22, IL-21, and MMPs; inhibiting or reducing proliferation of Th1, Th17, Th22, and/or other cells that secrete, or cause other cells to secrete, inflammatory molecules, including, but not limited to, IL-1beta, TNF-alpha, TGF-beta, IFN-gamma, IL-17, IL-6, IL-23, IL-22, IL-21, and MMPs.
- Additionally, C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof can also enhance Th2 immune responses. C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof can also act directly on Th2 cells to promote or enhance production of IL-4, IL-5 or IL-10, or to increase the number of Th2 cells, resulting in inhibition of Th1 and/or Th17, and in immune modulation via a Th1/Th2 shift.
- Additionally, C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof can cause Tregs to have an enhanced suppressive effect on an immune response. Tregs can suppress differentiation, proliferation, activity, and/or cytokine production and/or secretion by Th1, Th17, Th22, and/or other cells that secrete, or cause other cells to secrete, inflammatory molecules, including, but not limited to, IL-1beta, TNF-alpha, TGF-beta, IFN-gamma, IL-17, IL-6, IL-23, IL-22, IL-21, and MMPs. For example, C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof can cause Tregs to have an enhanced suppressive effect on Th1 and/or Th17 cells to reduce the level of IFN-gamma and IL-17 produced, respectively. C1ORF32polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof can also act directly on Tregs to promote or enhance production of IL-10 to suppress the Th1 and/or Th17 pathway, and/or to increase the number of Tregs.
- Additionally, C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof can cause Th2 to have an enhanced modulatory effect on an immune response. Th2 cells can modulate differentiation, proliferation, activity, and/or cytokine production and/or secretion by Th1, Th17, Th22, and/or other cells that secrete, or cause other cells to secrete, inflammatory molecules, including, but not limited to, IL-1beta, TNF-alpha, TGF-beta, IFN-gamma, IL-17, IL-6, IL-23, IL-22, IL-21, and MMPs. For example, C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof can cause Th2 cells to have an enhanced modulatory effect on Th1 and/or Th17 cells to reduce the level of IFN-gamma and IL-17 produced, respectively. C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof can also act directly on Th2 cells to promote or enhance production of IL-10 to suppress the Th1 and/or Th17 pathway, and/or to increase the number of Th2 cells.
- Without wishing to be limited by a single hypothesis, it is believed that C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof acts at multiple points in multiple T cell pathways. For example, polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof can inhibit the differentiation of naive T cells into either Th1 or Th17 cells. Alternatively, polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof can interact with Th1 cells or Th17 cells, or both to inhibit or reduce the production of proinflammatory molecules.
- Additionally, C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof may increase the differentiation of and/or promote Th2 responses resulting in an immunomdulatory effect on the Th1 and/or Th17 pathways to reduce the level of INF-gamma and/or IL-17 produced. C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof enhances the production of IL-10 from cells such as Th2 and/or Tregs, which in turn inhibits the activity of Th1 and/or Th17 cells.
- Additionally, C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof can affect Tregs to have an enhanced suppressive effect on Th1 and/or Th17 pathways to reduce the level of INF-gamma and/or IL-17 produced. Additionally, C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof can enhance the production of IL-10 which inhibits the activity of Th1 and/or Th17 cells.
- Inhibition of Th1 Responses
- a. Inhibition of Th1 Development
- One method for inhibiting or reducing inflammation includes administering an effective amount of a C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof to inhibit Th1 development in a subject in need thereof. Inflammation can be inhibited or reduced by blocking naive T cells from differentiating into Th1 cells by administering C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof. In one embodiment, the C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof may inhibit or reduce proliferation of Th1 cells. C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof may also reduce naive T cells from differentiating into Th1 cells, by blocking antigen presenting cell maturation. Alternatively, C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof increase the differentiation of Th2 cells and thereby reduce the number of Th1 cells in a subject. By restricting the number of Th1 cells that can develop in the subject, the amount of proinflammatory molecules such as INF-gamma can be reduced or contained. INF-gamma stimulates the production or release of other proinflammatory molecules including IL-1beta, TNF-alpha, and MMPs. Thus, by controlling the number of Th1 cells in a subject, the levels of these other proinflammatory molecules can be controlled, thereby reducing inflammatory responses.
- b. Inhibition of Proinflammatory Molecules
- Another embodiment provides a method of inhibiting or reducing inflammation in a subject by administering to the subject an effective amount of a C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof to inhibit or reduce production of proinflammatory molecules by Th1 cells.
- Exemplary proinflammatory molecules produced by Th1 cells includes IFN-gamma. In this embodiment the C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof can interact directly with the Th1 cell and inhibit or reduce IFN-gamma production by the Th1 cells. In this embodiment, the amount of proinflammatory molecules is regulated rather than the population of Th1 cells.
- Inhibition of Th17 Responses
- a. Inhibition of Th17 Development
- Inflammation can also be inhibited or reduced in a subject by administering an effective amount of a C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof, to inhibit or block naive T cells from developing into Th17 cells. In one embodiment, the C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof increases the suppressive activity of Tregs on the differentiation of naive T cells into Th17 cells by an amount sufficient to reduce the number of Th17 cells in a subject. Alternatively, the C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof inhibits or reduces proliferation of Th17 cells. C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof may also reduce naive T cells from differentiating into Th17 cells, by blocking antigen presenting cell maturation. By reducing the population of Th17 cells in a subject, the amount of IL-17 can be reduced, as well as IL-22 and IL-21. IL-17 is a proinflammatory cytokine that causes increases in other proinflammatory molecules such as IL-1beta, TNF-alpha, and MMPs. Thus, by reducing the amount of IL-17 these other proinflammatory molecules can be reduced, thereby reducing or inhibiting inflammation.
- b. Inhibition of IL-17 Production
- Still another embodiment provides a method for treating inflammation in a subject by administering an effective amount of C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof, to inhibit production of IL-17 by Th17 cells, as well as IL-22 and IL-21. In this embodiment, the C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof can act directly on Th17 cells, for example by binding to Th17 cells resulting in inhibition of IL-17 (or IL-22 and IL-21) production by those Th17 cells. As noted above, inhibition or reduction of IL-17 (and IL-22 or IL-21) leads to the reduction of other proinflammatory molecules, thereby reducing or inhibitng inflammation.
- Inhibiting Th1 and Th17 Responses
- The disclosed C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof can be used to inhibit both the Th1 and Th17 pathways simultaneously. Using one anti-inflammatory agent to inhibit two separate pathways provides more robust inhibition or reduction of the immune response.
- Promoting Th2 Responses and IL-10 Production.
- Inflammation can also be treated by administering C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof thereof to a subject in an amount effective to enhance Th2 responses, and the suppressive activity of IL-10 producing cells, and to enhance suppressive or modulatory activity on the Th1 and/or Th17 pathways. In this embodiment the disclosed C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof cause an increased suppressive effect on IFN-gamma and/or IL-17 production. Another embodiment provides a method for treating inflammation by administering an effective amount of C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof to increase production of IL-10 by Th2, Tregs or other immune cells.
- Increased production of IL-10 results in the decreased production of IL-17 by Th17 cells and deceased production of IFN-gamma by Th1 cells. In this embodiment, the C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof can interact directly with with immune cells to increase IL-10 production.
- Still another embodiment provides a method for treating inflammation by administering an effective amount of C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof to inhibit or interfere with the Th1 pathway and Th17 pathway, and to enhance the suppressive effect on the Th1 and/or Th17 pathways by Th2 cells.
- The C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof can also be administered to a subject in an amount effective to increase Th2 cell populations or numbers.
- IL-10 production can be increased relative to a control by contacting Th2 cells, Tregs or other immune cells with an effective amount of C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof having C1ORF32 activity. The increase can occur in vitro or in vivo.
- Representative inflammatory or autoimmune diseases and disorders that may be treated using C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof include, but are not limited to multiple sclerosis, rheumatoid arthritis, type I diabetes, psoriasis, systemic lupus erythematosus, inflammatory bowel disease, uveitis, and Sjogren's syndrome.
- C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof acts at multiple points in the inflammatory pathway master regulator to control the expression and/or activity of effectory cytokines such as IFN-gamma and TNF-alpha. Therefore, the C1ORF32 compositions described herein are particularly useful for treating patients that do not respond to TNF-alpha blockers such as Enbrel, Remicade, Cimzia and Humira, or where TNF-alpha blockers are not safe or effective. In addition, because of its activity as a master regulator in the inflammatory pathway, the C1ORF32 compositions disclosed are particularly useful for treating chronic and persistent inflammation.
- In a further embodiment, the C1ORF32 compositions described herein are used to treat relapsing and/or remitting multiple sclerosis.
- Epitope spreading refers to the ability of B and T cell immune response to diversify both at the level of specificity, from a single determinant to many sites on an auto antigen, and at the level of V gene usage (Monneaux, F. et al., Arthritis & Rheumatism, 46(6): 1430-1438 (2002). Epitope spreading is not restricted to systemic autoimmune disease. It has been described in T cell dependent organ specific diseases such as
Diabetes mellitus type 1 and multiple sclerosis in humans, and EAE induced experimental animals with a variety of myelin proteins. - Epitope spreading involves the acquired recognition of new epitopes in the same self molecule as well as epitopes residing in proteins that are associated in the same macromolecular complex. Epitope spreading can be assessed by measuring delayed-type hypersensitivity (DTH) responses, methods of which are known in the art.
- One embodiment provides a method for inhibiting or reducing epitope spreading in a subject by administering to the subject an effective amount of C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof. In a further embodiment the C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof inhibits epitope spreading in individuals with multiple sclerosis. Preferably, the C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof inhibits or blocks multiple points of the inflammation pathway.
- Yet another embodiment provides a method for inhibiting or reducing epitope spreading in subjects with multiple sclerosis by administering to a subject an effective amount of C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof to inhibit or reduce differentiation of, proliferation of, activity of, and/or cytokine production and/or secretion by Th1, Th17, Th22, and/or other cells that secrete, or cause other cells to secrete, inflammatory molecules, including, but not limited to, IL-1beta, TNF-alpha, TGF-beta, IFN-gamma, IL-17, IL-6, IL-23, IL-22, IL-21, and MMPs. Another embodiment provides a method for treating multiple sclerosis by administering to a subject an effective amount of C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof thereof to interact with Tregs, enhance Treg activity, promote or enhances IL-10 secretion by Tregs, increase the number of Tregs, increase the suppressive capacity of Tregs, or combinations thereof. Another embodiment provides a method for treating multiple sclerosis by administering to a subject an effective amount of C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof to interact with Th2 cells, enhance Th2 activity, promote or enhance IL-10 secretion by Th2 cells, increase the number of Th2 cells, increase the modulatory capacity of Th2 cells, or combinations thereof.
- Induction of Immune Tolerance
- In one embodiment, the present invention provides a method for inducing or re-establishing immune tolerance in a subject by administering to the subject an effective amount of C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof. In a further embodiment the C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof induces tolerance in individuals with immune related diseases. In a specific embodiment the C1ORF32 polypeptide, fragment or fusion protein thereof induces tolerance in individuals with multiple sclerosis or any other immune related disease as described herein. Preferably, the C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof inhibits or blocks multiple points of the inflammation pathway. In another specific embodiment, the C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof induces tolerance in individuals with rheumatoid arthritis. Another embodiment provides a method for treating immune related diseases by administering to a subject an effective amount of C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof to induce immune tolerance by interacting with Tregs, enhancing Treg activity, increasing the number of Tregs, increase the suppressive capacity of Tregs, or combinations thereof. Another embodiment provides a method for treating immune related diseases by administering to a subject an effective amount of C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof to promote or enhance IL-10 secretion by immune cells.
- Use of the Therapeutic Agents According to at Least Some Embodiments of the Invention for Adoptive Immunotherapy:
- One of the cardinal features of some models of tolerance is that once the tolerance state has been established, it can be perpetuated to naive recipients by the adoptive transfer of donor-specific regulatory cells. Such adoptive transfer studies have also addressed the capacity of T-cell subpopulations and non-T cells to transfer tolerance. Such tolerance can be induced by blocking costimulation or upon engagement of a co-inhibitory B7 with its counter receptor. This approach, that have been successfully applied in animals and is evaluated in clinical trials in humans, (Scalapino K J and Daikh D I. PLoS One. 2009; 4(6):e6031; Riley et al., Immunity. 2009; 30(5): 656-665) provides a promising treatment option for autoimmune disorders and transplantation. Therapeutic agents according to at least some embodiments of the invention, are used for_for adoptive immunotherapy. Thus, in at least some embodiments, the invention provides methods for in vivo or ex vivo tolerance induction, comprising administering effective amount of the therapeutic agent according to at least some embodiments, to a patient or to leukocytes isolated from the patient, in order to induce differentiation of tolerogenic regulatory cells; followed by ex-vivo enrichment and expansion of said cells and reinfusion of the tolerogenic regulatory cells to said patient.
- Alternatively, immune responses can be enhanced in a patient by removing immune cells from the patient, contacting immune cells in vitro with an agent that inhibits C1ORF32 activity, and/or which inhibits the interaction of C1ORF32 with its natural binding partners, and reintroducing the in vitro stimulated immune cells into the patient. In another embodiment, a method of modulating immune responses involves isolating immune cells from a patient, transfecting them with a nucleic acid molecule encoding a form of C1ORF32, such that the cells express all or a portion of the C1ORF32 polypeptide according to various embodiments of the present invention on their surface, and reintroducing the transfected cells into the patient. The transfected cells have the capacity to modulate immune responses in the patient.
- Pharmaceutical Compositions
- The present invention, in some embodiments, features a pharmaceutical composition comprising a therapeutically effective amount of a therapeutic agent according to the present invention. According to the present invention the therapeutic agent could be any one of soluble C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof or a corresponding nucleic acid sequence encoding. The pharmaceutical composition according to the present invention is further used for the treatment of immune related disorder and/or infection as described herein. The therapeutic agents of the present invention can be provided to the subject alone, or as part of a pharmaceutical composition where they are mixed with a pharmaceutically acceptable carrier.
- As used herein, “pharmaceutically acceptable carrier” includes any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible. Preferably, the carrier is suitable for intravenous, intramuscular, subcutaneous, parenteral, spinal or epidermal administration (e.g., by injection or infusion). Depending on the route of administration, the active compound, i.e., soluble C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof or a corresponding nucleic acid sequence encoding. The pharmaceutical compounds according to at least some embodiments of the present invention may include one or more pharmaceutically acceptable salts. A “pharmaceutically acceptable salt” refers to a salt that retains the desired biological activity of the parent compound and does not impart any undesired toxicological effects (see e.g., Berge, S. M., et al. (1977) J. Pharm. Sci. 66: 1-19). Examples of such salts include acid addition salts and base addition salts. Acid addition salts include those derived from nontoxic inorganic acids, such as hydrochloric, nitric, phosphoric, sulfuric, hydrobromic, hydroiodic, phosphorous and the like, as well as from nontoxic organic acids such as aliphatic mono- and dicarboxylic acids, phenyl-substituted alkanoic acids, hydroxy alkanoic acids, aromatic acids, aliphatic and aromatic sulfonic acids and the like. Base addition salts include those derived from alkaline earth metals, such as sodium, potassium, magnesium, calcium and the like, as well as from nontoxic organic amines, such as N,N′-dibenzylethylenediamine, N-methylglucamine, chloroprocaine, choline, diethanolamine, ethylenediamine, procaine and the like.
- A pharmaceutical composition according to at least some embodiments of the present invention also may include one or more pharmaceutically acceptable anti-oxidants. Examples of pharmaceutically acceptable antioxidants include: (1) water soluble antioxidants, such as ascorbic acid, cysteine hydrochloride, sodium bisulfate, sodium metabisulfite, sodium sulfite and the like; (2) oil-soluble antioxidants, such as ascorbyl palmitate, butylated hydroxyanisole (BHA), butylated hydroxytoluene (BHT), lecithin, propyl gallate, alpha-tocopherol, and the like; and (3) metal chelating agents, such as citric acid, ethylenediamine tetraacetic acid (EDTA), sorbitol, tartaric acid, phosphoric acid, and the like. A pharmaceutical composition according to at least some embodiments of the present invention also may include additives such as detergents and solubilizing agents (e.g., TWEEN 20 (polysorbate-20), TWEEN 80 (polysorbate-80)) and preservatives (e.g., Thimersol, benzyl alcohol) and bulking substances (e.g., lactose, mannitol).
- Examples of suitable aqueous and nonaqueous carriers that may be employed in the pharmaceutical compositions according to at least some embodiments of the present invention include water, buffered saline of various buffer content (e.g., Tris-HCl, acetate, phosphate), pH and ionic strength, ethanol, polyols (such as glycerol, propylene glycol, polyethylene glycol, and the like), and suitable mixtures thereof, vegetable oils, such as olive oil, and injectable organic esters, such as ethyl oleate.
- Proper fluidity can be maintained, for example, by the use of coating materials, such as lecithin, by the maintenance of the required particle size in the case of dispersions, and by the use of surfactants.
- These compositions may also contain adjuvants such as preservatives, wetting agents, emulsifying agents and dispersing agents. Prevention of presence of microorganisms may be ensured both by sterilization procedures, supra, and by the inclusion of various antibacterial and antifungal agents, for example, paraben, chlorobutanol, phenol sorbic acid, and the like. It may also be desirable to include isotonic agents, such as sugars, sodium chloride, and the like into the compositions. In addition, prolonged absorption of the injectable pharmaceutical form may be brought about by the inclusion of agents which delay absorption such as aluminum monostearate and gelatin.
- Pharmaceutically acceptable carriers include sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion. The use of such media and agents for pharmaceutically active substances is known in the art. Except insofar as any conventional media or agent is incompatible with the active compound, use thereof in the pharmaceutical compositions according to at least some embodiments of the present invention is contemplated. Supplementary active compounds can also be incorporated into the compositions.
- Therapeutic compositions typically must be sterile and stable under the conditions of manufacture and storage. The composition can be formulated as a solution, microemulsion, liposome, or other ordered structure suitable to high drug concentration. The carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), and suitable mixtures thereof. The proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants. In many cases, it will be preferable to include isotonic agents, for example, sugars, polyalcohols such as mannitol, sorbitol, or sodium chloride in the composition. Prolonged absorption of the injectable compositions can be brought about by including in the composition an agent that delays absorption, for example, monostearate salts and gelatin. Sterile injectable solutions can be prepared by incorporating the active compound in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by sterilization microfiltration. Generally, dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above. In the case of sterile powders for the preparation of sterile injectable solutions, the preferred methods of preparation are vacuum drying and freeze-drying (lyophilization) that yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
- Sterile injectable solutions can be prepared by incorporating the active compound in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by sterilization microfiltration. Generally, dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above. In the case of sterile powders for the preparation of sterile injectable solutions, the preferred methods of preparation are vacuum drying and freeze-drying (lyophilization) that yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
- The amount of active ingredient which can be combined with a carrier material to produce a single dosage form will vary depending upon the subject being treated, and the particular mode of administration. The amount of active ingredient which can be combined with a carrier material to produce a single dosage form will generally be that amount of the composition which produces a therapeutic effect. Generally, out of one hundred per cent, this amount will range from about 0.01 per cent to about ninety-nine percent of active ingredient, preferably from about 0.1 per cent to about 70 per cent, most preferably from about I per cent to about 30 per cent of active ingredient in combination with a pharmaceutically acceptable carrier.
- Dosage regimens are adjusted to provide the optimum desired response (e.g., a therapeutic response). For example, a single bolus may be administered, several divided doses may be administered over time or the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation. It is especially advantageous to formulate parenteral compositions in dosage unit form for ease of administration and uniformity of dosage. Dosage unit form as used herein refers to physically discrete units suited as unitary dosages for the subjects to be treated; each unit contains a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier. The specification for the dosage unit forms according to at least some embodiments of the present invention are dictated by and directly dependent on (a) the unique characteristics of the active compound and the particular therapeutic effect to be achieved, and (b) the limitations inherent in the art of compounding such an active compound for the treatment of sensitivity in individuals.
- A composition of the present invention can be administered via one or more routes of administration using one or more of a variety of methods known in the art. As will be appreciated by the skilled artisan, the route and/or mode of administration will vary depending upon the desired results. Preferred routes of administration for therapeutic agents according to at least some embodiments of the present invention include intravascular delivery (e.g. injection or infusion), intravenous, intramuscular, intradermal, intraperitoneal, subcutaneous, spinal, oral, enteral, rectal, pulmonary (e.g. inhalation), nasal, topical (including transdermal, buccal and sublingual), intravesical, intravitreal, intraperitoneal, vaginal, brain delivery (e.g. intra-cerebroventricular, intra-cerebral, and convection enhanced diffusion), CNS delivery (e.g. intrathecal, perispinal, and intra-spinal) or parenteral (including subcutaneous, intramuscular, intraperitoneal, intravenous (IV) and intradermal), transdermal (either passively or using iontophoresis or electroporation), transmucosal (e.g., sublingual administration, nasal, vaginal, rectal, or sublingual), administration or administration via an implant, or other parenteral routes of administration, for example by injection or infusion, or other delivery routes and/or forms of administration known in the art. The phrase “parenteral administration” as used herein means modes of administration other than enteral and topical administration, usually by injection, and includes, without limitation, intravenous, intramuscular, intraarterial, intrathecal, intracapsular, intraorbital, intracardiac, intradermal, intraperitoneal, transtracheal, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal, epidural and intrastemal injection and infusion or using bioerodible inserts, and can be formulated in dosage forms appropriate for each route of administration. In a specific embodiment, a protein, a therapeutic agent or a pharmaceutical composition according to at least some embodiments of the present invention can be administered intraperitoneally or intravenously.
- Compositions of the present invention can be delivered to the lungs while inhaling and traverse across the lung epithelial lining to the blood stream when delivered either as an aerosol or spray dried particles having an aerodynamic diameter of less than about 5 microns. A wide range of mechanical devices designed for pulmonary delivery of therapeutic products can be used, including but not limited to nebulizers, metered dose inhalers, and powder inhalers, all of which are familiar to those skilled in the art. Some specific examples of commercially available devices are the Ultravent nebulizer (Mallinckrodt Inc., St. Louis, Mo.); the Acorn II nebulizer (Marquest Medical Products, Englewood, Colo.); the Ventolin metered dose inhaler (Glaxo Inc., Research Triangle Park, N.C.); and the Spinhaler powder inhaler (Fisons Corp., Bedford, Mass.). Nektar, Alkermes and Mannkind all have inhalable insulin powder preparations approved or in clinical trials where the technology could be applied to the formulations described herein.
- In some in vivo approaches, the compositions disclosed herein are administered to a subject in a therapeutically effective amount. As used herein the term “effective amount” or “therapeutically effective amount” means a dosage sufficient to treat, inhibit, or alleviate one or more symptoms of the disorder being treated or to otherwise provide a desired pharmacologic and/or physiologic effect. The precise dosage will vary according to a variety of factors such as subject-dependent variables (e.g., age, immune system health, etc.), the disease, and the treatment being effected. For the polypeptide compositions disclosed herein and nucleic acids encoding the same, as further studies are conducted, information will emerge regarding appropriate dosage levels for treatment of various conditions in various patients, and the ordinary skilled worker, considering the therapeutic context, age, and general health of the recipient, will be able to ascertain proper dosing. The selected dosage depends upon the desired therapeutic effect, on the route of administration, and on the duration of the treatment desired. For polypeptide compositions, generally dosage levels of 0.0001 to 100 mg/kg of body weight daily are administered to mammals and more usually 0.001 to 20 mg/kg. For example dosages can be 0.3 mg/kg body weight, 1 mg/kg body weight, 3 mg/kg body weight, 5 mg/kg body weight or 10 mg/kg body weight or within the range of 1-10 mg/kg. An exemplary treatment regime entails administration once per week, once every two weeks, once every three weeks, once every four weeks, once a month, once every 3 months or once every three to 6 months. Generally, for intravenous injection or infusion, dosage may be lower. Dosage regimens are adjusted to provide the optimum desired response (e.g., a therapeutic response). For example, a single bolus may be administered, several divided doses may be administered over time or the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation. It is especially advantageous to formulate parenteral compositions in dosage unit form for ease of administration and uniformity of dosage. Dosage unit form as used herein refers to physically discrete units suited as unitary dosages for the subjects to be treated; each unit contains a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier. The specification for the dosage unit forms according to at least some embodiments of the present invention are dictated by and directly dependent on (a) the unique characteristics of the active compound and the particular therapeutic effect to be achieved, and (b) the limitations inherent in the art of compounding such an active compound for the treatment of sensitivity in individuals.
- Optionally the polypeptide formulation may be administered in an amount between 0.0001 to 100 mg/kg weight of the patient/day, preferably between 0.001 to 20.0 mg/kg/day, according to any suitable timing regimen. A therapeutic composition according to at least some embodiments according to at least some embodiments of the present invention can be administered, for example, three times a day, twice a day, once a day, three times weekly, twice weekly or once weekly, once every two weeks or 3, 4, 5, 6, 7 or 8 weeks. Moreover, the composition can be administered over a short or long period of time (e.g., 1 week, 1 month, 1 year, 5 years).
- Alternatively, therapeutic agent can be administered as a sustained release formulation, in which case less frequent administration is required. Dosage and frequency vary depending on the half-life of the therapeutic agent in the patient. In general, the half-life for fusion proteins may vary widely. The dosage and frequency of administration can vary depending on whether the treatment is prophylactic or therapeutic. In prophylactic applications, a relatively low dosage is administered at relatively infrequent intervals over a long period of time. Some patients continue to receive treatment for the rest of their lives. In therapeutic applications, a relatively high dosage at relatively short intervals is sometimes required until progression of the disease is reduced or terminated, and preferably until the patient shows partial or complete amelioration of symptoms of disease. Thereafter, the patient can be administered a prophylactic regime. Actual dosage levels of the active ingredients in the pharmaceutical compositions of the present invention may be varied so as to obtain an amount of the active ingredient which is effective to achieve the desired therapeutic response for a particular patient, composition, and mode of administration, without being toxic to the patient. The selected dosage level will depend upon a variety of pharmacokinetic factors including the activity of the particular compositions of the present invention employed, the route of administration, the time of administration, the rate of excretion of the particular compound being employed, the duration of the treatment, other drugs, compounds and/or materials used in combination with the particular compositions employed, the age, sex, weight, condition, general health and prior medical history of the patient being treated, and like factors well known in the medical arts.
- A “therapeutically effective dosage” of C1ORF32 soluble protein polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof, preferably results in a decrease in severity of disease symptoms, an increase in frequency and duration of disease symptom-free periods, an increase in lifepan, disease remission, or a prevention or reduction of impairment or disability due to the disease affliction.
- One of ordinary skill in the art would be able to determine a therapeutically effective amount based on such factors as the subject's size, the severity of the subject's symptoms, and the particular composition or route of administration selected. In certain embodiments, the polypeptide compositions are administered locally, for example by injection directly into a site to be treated. Typically, the injection causes an increased localized concentration of the polypeptide compositions which is greater than that which can be achieved by systemic administration. For example, in the case of a neurological disorder like Multiple Sclerosis, the protein may be administered locally to a site near the CNS. In another example, as in the case of an arthritic disorder like Rheumatoid Arthritis, the protein may be administered locally to the synovium in the affected joint. The polypeptide compositions can be combined with a matrix as described above to assist in creating a increased localized concentration of the polypeptide compositions by reducing the passive diffusion of the polypeptides out of the site to be treated.
- Pharmaceutical compositions of the present invention may be administered with medical devices known in the art. For example, in an optional embodiment, a pharmaceutical composition according to at least some embodiments of the present invention can be administered with a needles hypodermic injection device, such as the devices disclosed in U.S. Pat. Nos. 5,399,163; 5,383,851; 5,312,335; 5,064,413; 4,941,880; 4,790,824; or 4,596,556. Examples of well-known implants and modules useful in the present invention include: U.S. Pat. No. 4,487,603, which discloses an implantable micro-infusion pump for dispensing medication at a controlled rate; U.S. Pat. No. 4,486,194, which discloses a therapeutic device for administering medicaments through the skin; U.S. Pat. No. 4,447,233, which discloses a medication infusion pump for delivering medication at a precise infusion rate; U.S. Pat. No. 4,447,224, which discloses a variable flow implantable infusion apparatus for continuous drug delivery; U.S. Pat. No. 4,439,196, which discloses an osmotic drug delivery system having multi-chamber compartments; and U.S. Pat. No. 4,475,196, which discloses an osmotic drug delivery system. These patents are incorporated herein by reference. Many other such implants, delivery systems, and modules are known to those skilled in the art.
- The active compounds can be prepared with carriers that will protect the compound against rapid release, such as a controlled release formulation, including implants, transdermal patches, and microencapsulated delivery systems. Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid. Many methods for the preparation of such formulations are patented or generally known to those skilled in the art. See, e.g., Sustained and Controlled Release Drug Delivery Systems, J. R. Robinson, ed., Marcel Dekker, Inc., New York, 1978.
- Therapeutic compositions can be administered with medical devices known in the art. For example, in an optional embodiment, a therapeutic composition according to at least some embodiments of the present invention can be administered with a needles hypodermic injection device, such as the devices disclosed in U.S. Pat. Nos. 5,399,163; 5,383,851; 5,312,335; 5,064,413; 4,941,880; 4,790,824; or 4,596,556. Examples of well-known implants and modules useful in the present invention include: U.S. Pat. No. 4,487,603, which discloses an implantable micro-infusion pump for dispensing medication at a controlled rate; U.S. Pat. No. 4,486,194, which discloses a therapeutic device for administering medicaments through the skin; U.S. Pat. No. 4,447,233, which discloses a medication infusion pump for delivering medication at a precise infusion rate; U.S. Pat. No. 4,447,224, which discloses a variable flow implantable infusion apparatus for continuous drug delivery; U.S. Pat. No. 4,439,196, which discloses an osmotic drug delivery system having multi-chamber compartments; and U.S. Pat. No. 4,475,196, which discloses an osmotic drug delivery system. These patents are incorporated herein by reference. Many other such implants, delivery systems, and modules are known to those skilled in the art.
- In certain embodiments, C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof according to at least some embodiments of the present invention can be formulated to ensure proper distribution in vivo. For example, the blood-brain barrier (BBB) excludes many highly hydrophilic compounds. To ensure that the therapeutic compounds according to at least some embodiments of the present invention cross the BBB (if desired), they can be formulated, for example, in liposomes. For methods of manufacturing liposomes, see, e.g., U.S. Pat. Nos. 4,522,811; 5,374,548; and 5,399,331. The liposomes may comprise one or more moieties which are selectively transported into specific cells or organs, thus enhance targeted drug delivery (see, e.g., V. V. Ranade (1989) J. Clin. Pharmacol. 29:685). Exemplary targeting moieties include folate or biotin (see, e.g., U.S. Pat. No. 5,416,016 to Low et al.); mannosides (Umezawa et al., (1988) Biochem. Biophys. Res. Commun. 153:1038); antibodies (P. G. Bloeman et al. (1995) FEBS Lett. 357:140; M. Owais et al. (1995) Antimicrob. Agents Chemother. 39:180); surfactant protein A receptor (Briscoe et al. (1995) Am. J Physiol. 1233:134); p120 (Schreier et al. (1994) J. Biol. Chem. 269:9090); see also K. Keinanen; M. L. Laukkanen (1994) FEBS Lett. 346:123; J. J. Killion; I. J. Fidler (1994) Immunomethods 4:273.
- Formulations for Parenteral Administration
- In a further embodiment, compositions disclosed herein, including those containing peptides and polypeptides, are administered in an aqueous solution, by parenteral injection. The formulation may also be in the form of a suspension or emulsion. In general, pharmaceutical compositions are provided including effective amounts of a peptide or polypeptide, and optionally include pharmaceutically acceptable diluents, preservatives, solubilizers, emulsifiers, adjuvants and/or carriers. Such compositions optionally include one or more for the following: diluents, sterile water, buffered saline of various buffer content (e.g., Tris-HCl, acetate, phosphate), pH and ionic strength; and additives such as detergents and solubilizing agents (e.g., TWEEN 20 (polysorbate-20), TWEEN 80 (polysorbate-80)), anti-oxidants (e.g., water soluble antioxidants such as ascorbic acid, sodium metabisulfite, cysteine hydrochloride, sodium bisulfate, sodium metabisulfite, sodium sulfite; oil-soluble antioxidants, such as ascorbyl palmitate, butylated hydroxyanisole (BHA), butylated hydroxytoluene (BHT), lecithin, propyl gallate, alpha-tocopherol; and metal chelating agents, such as citric acid, ethylenediamine tetraacetic acid (EDTA), sorbitol, tartaric acid, phosphoric acid), and preservatives (e.g., Thimersol, benzyl alcohol) and bulking substances (e.g., lactose, mannitol). Examples of non-aqueous solvents or vehicles are ethanol, propylene glycol, polyethylene glycol, vegetable oils, such as olive oil and corn oil, gelatin, and injectable organic esters such as ethyl oleate. The formulations may be freeze dried (lyophilized) or vacuum dried and redissolved/resuspended immediately before use. The formulation may be sterilized by, for example, filtration through a bacteria retaining filter, by incorporating sterilizing agents into the compositions, by irradiating the compositions, or by heating thecompositions.
- Formulations for Topical Administration
- C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof, nucleic acids, and vectors disclosed herein can be applied topically. Topical administration does not work well for most peptide formulations, although it can be effective especially if applied to the lungs, nasal, oral (sublingual, buccal), vaginal, or rectal mucosa.
- Compositions can be delivered to the lungs while inhaling and traverse across the lung epithelial lining to the blood stream when delivered either as an aerosol or spray dried particles having an aerodynamic diameter of less than about 5 microns.
- A wide range of mechanical devices designed for pulmonary delivery of therapeutic products can be used, including but not limited to nebulizers, metered dose inhalers, and powder inhalers, all of which are familiar to those skilled in the art. Some specific examples of commercially available devices are the Ultravent nebulizer (Mallinckrodt Inc., St. Louis, Mo.); the Acorn II nebulizer (Marquest Medical Products, Englewood, Colo.); the Ventolin metered dose inhaler (Glaxo Inc., Research Triangle Park, N.C.); and the Spinhaler powder inhaler (Fisons Corp., Bedford, Mass.). Nektar, Alkermes and Mannkind all have inhalable insulin powder preparations approved or in clinical trials where the technology could be applied to the formulations described herein.
- Formulations for administration to the mucosa will typically be spray dried drug particles, which may be incorporated into a tablet, gel, capsule, suspension or emulsion. Standard pharmaceutical excipients are available from any formulator. Oral formulations may be in the form of chewing gum, gel strips, tablets or lozenges.
- Transdermal formulations may also be prepared. These will typically be ointments, lotions, sprays, or patches, all of which can be prepared using standard technology. Transdermal formulations will require the inclusion of penetration enhancers.
- Controlled Delivery Polymeric Matrices
- C1ORF32 polypeptide selected from the group consisting of SEQ ID NOs: 29, 30, 41-105, or a fragment, variant, a homolog, a fusion protein or a conjugate thereof, nucleic acids, and vectors disclosed herein may also be administered in controlled release formulations. Controlled release polymeric devices can be made for long term release systemically following implantation of a polymeric device (rod, cylinder, film, disk) or injection (microparticles). The matrix can be in the form of microparticles such as microspheres, where peptides are dispersed within a solid polymeric matrix or microcapsules, where the core is of a different material than the polymeric shell, and the peptide is dispersed or suspended in the core, which may be liquid or solid in nature. Unless specifically defined herein, microparticles, microspheres, and microcapsules are used interchangeably. Alternatively, the polymer may be cast as a thin slab or film, ranging from nanometers to four centimeters, a powder produced by grinding or other standard techniques, or even a gel such as a hydrogel.
- Either non-biodegradable or biodegradable matrices can be used for delivery of polypeptides or nucleic acids encoding the polypeptides, although biodegradable matrices are preferred. These may be natural or synthetic polymers, although synthetic polymers are preferred due to the better characterization of degradation and release profiles. The polymer is selected based on the period over which release is desired. In some cases linear release may be most useful, although in others a pulse release or “bulk release” may provide more effective results. The polymer may be in the form of a hydrogel (typically in absorbing up to about 90% by weight of water), and can optionally be crosslinked with multivalent ions or polymers.
- The matrices can be formed by solvent evaporation, spray drying, solvent extraction and other methods known to those skilled in the art. Bioerodible microspheres can be prepared using any of the methods developed for making microspheres for drug delivery, for example, as described by Mathiowitz and Langer, J. Controlled Release, 5:13-22 (1987); Mathiowitz, et al., Reactive Polymers, 6:275-283 (1987); and Mathiowitz, et al., J. Appl Polymer ScL, 35:755-774 (1988). The devices can be formulated for local release to treat the area of implantation or injection—which will typically deliver a dosage that is much less than the dosage for treatment of an entire body—or systemic delivery. These can be implanted or injected subcutaneously, into the muscle, fat, or swallowed.
- Soluble polypeptides according to at least some embodiments of the present invention may also be modified with a label capable of providing a detectable signal, either directly or indirectly, including, but not limited to, radioisotopes and fluorescent compounds. Such labeled polypeptides can be used for various uses, including but not limited to, prognosis, prediction, screening, early diagnosis, determination of progression, therapy selection and treatment monitoring of disease and/or an indicative condition, as detailed above.
- According to at least some embodiments, the present invention provides a method for imaging an organ or tissue, the method comprising: (a) administering to a subject in need of such imaging, a labeled polypeptide; and (b) detecting the labeled polypeptide to determine where the labeled polypeptide is concentrated in the subject. When used in imaging applications, the labeled polypeptides according to at least some embodiments of the present invention typically have an imaging agent covalently or noncovalently attached thereto. Suitable imaging agents include, but are not limited to, radionuclides, detectable tags, fluorophores, fluorescent proteins, enzymatic proteins, and the like. One of skill in the art will be familiar with other methods for attaching imaging agents to polypeptides. For example, the imaging agent can be attached via site-specific conjugation, e.g., covalent attachment of the imaging agent to a peptide linker such as a polyarginine moiety having five to seven arginines present at the carboxyl-terminus of and Fc fusion molecule. The imaging agent can also be directly attached via non-site specific conjugation, e.g., covalent attachment of the imaging agent to primary amine groups present in the polypeptide. One of skill in the art will appreciate that an imaging agent can also be bound to a protein via noncovalent interactions (e.g., ionic bonds, hydrophobic interactions, hydrogen bonds, Van der Waals forces, dipole-dipole bonds, etc.).
- In certain instances, the polypeptide is radiolabeled with a radionuclide by directly attaching the radionuclide to the polypeptide. In certain other instances, the radionuclide is bound to a chelating agent or chelating agent-linker attached to the polypeptide. Suitable radionuclides for direct conjugation include, without limitation, 18 F, 124 I, 125 I, 131 I, and mixtures thereof. Suitable radionuclides for use with a chelating agent include, without limitation, 47 Sc, 64 Cu, 67 Cu, 89 Sr, 86 Y, 87 Y, 90 Y,105 Rh, 111 Ag, 111 In, 117m Sn, 149 Pm, 153 Sm, 166 Ho, 177 Lu, 186 Re, 188 Re, 211 At, 212 Bi, and mixtures thereof. Preferably, the radionuclide bound to a chelating agent is 64 Cu, 90 Y, 111 In, or mixtures thereof. Suitable chelating agents include, but are not limited to, DOTA, BAD, TETA, DTPA, EDTA, NTA, HDTA, their phosphonate analogs, and mixtures thereof. One of skill in the art will be familiar with methods for attaching radionuclides, chelating agents, and chelating agent-linkers to polypeptides of the present invention. In particular, attachment can be conveniently accomplished using, for example, commercially available bifunctional linking groups (generally heterobifunctional linking groups) that can be attached to a functional group present in a non-interfering position on the polypeptide and then further linked to a radionuclide, chelating agent, or chelating agent-linker.
- Non-limiting examples of fluorophores or fluorescent dyes suitable for use as imaging agents include Alexa Fluor® dyes (Invitrogen Corp.; Carlsbad, Calif.), fluorescein, fluorescein isothiocyanate (FITC), Oregon Green™; rhodamine, Texas red, tetrarhodamine isothiocynate (TRITC), CyDye™ fluors (e.g., Cy2, Cy3, Cy5), and the like.
- Examples of fluorescent proteins suitable for use as imaging agents include, but are not limited to, green fluorescent protein, red fluorescent protein (e.g., DsRed), yellow fluorescent protein, cyan fluorescent protein, blue fluorescent protein, and variants thereof (see, e.g., U.S. Pat. Nos. 6,403,374, 6,800,733, and 7,157,566). Specific examples of GFP variants include, but are not limited to, enhanced GFP (EGFP), destabilized EGFP, the GFP variants described in Doan et al., Mol. Microbiol., 55:1767-1781 (2005), the GFP variant described in Crameri et al., Nat. Biotechnol., 14:315-319 (1996), the cerulean fluorescent proteins described in Rizzo et al., Nat. Biotechnol, 22:445 (2004) and Tsien,Annu. Rev. Biochem., 67:509 (1998), and the yellow fluorescent protein described in Nagal et al., Nat. Biotechnol., 20:87-90 (2002). DsRed variants are described in, e.g., Shaner et al., Nat. Biotechnol., 22:1567-1572 (2004), and include mStrawberry, mCherry, morange, mBanana, mHoneydew, and mTangerine. Additional DsRed variants are described in, e.g., Wang et al., Proc. Natl. Acad. Sci. U.S.A., 101:16745-16749 (2004) and include mRaspberry and mPlum. Further examples of DsRed variants include mRFPmars described in Fischer et al., FEBS Lett.,577:227-232 (2004) and mRFPruby described in Fischer et al., FEBS Lett., 580:2495-2502 (2006).
- In other embodiments, the imaging agent that is bound to a polypeptide according to at least some embodiments of the present invention comprises a detectable tag such as, for example, biotin, avidin, streptavidin, or neutravidin. In further embodiments, the imaging agent comprises an enzymatic protein including, but not limited to, luciferase, chloramphenicol acetyltransferase, β-galactosidase, β-glucuronidase, horseradish peroxidase, xylanase, alkaline phosphatase, and the like.
- Any device or method known in the art for detecting the radioactive emissions of radionuclides in a subject is suitable for use in the present invention. For example, methods such as Single Photon Emission Computerized Tomography (SPECT), which detects the radiation from a single photon gamma-emitting radionuclide using a rotating gamma camera, and radionuclide scintigraphy, which obtains an image or series of sequential images of the distribution of a radionuclide in tissues, organs, or body systems using a scintillation gamma camera, may be used for detecting the radiation emitted from a radiolabeled polypeptide of the present invention. Positron emission tomography (PET) is another suitable technique for detecting radiation in a subject. Miniature and flexible radiation detectors intended for medical use are produced by Intra-Medical LLC (Santa Monica, Calif.). Magnetic Resonance Imaging (MRI) or any other imaging technique known to one of skill in the art is also suitable for detecting the radioactive emissions of radionuclides. Regardless of the method or device used, such detection is aimed at determining where the labeled polypeptide is concentrated in a subject, with such concentration being an indicator of disease activity.
- Non-invasive fluorescence imaging of animals and humans can also provide in vivo diagnostic information and be used in a wide variety of clinical specialties. For instance, techniques have been developed over the years for simple ocular observations following UV excitation to sophisticated spectroscopic imaging using advanced equipment (see, e.g., Andersson-Engels et al., Phys. Med. Biol., 42:815-824 (1997)). Specific devices or methods known in the art for the in vivo detection of fluorescence, e.g., from fluorophores or fluorescent proteins, include, but are not limited to, in vivo near-infrared fluorescence (see, e.g., Frangioni, Curr. Opin. Chem. Biol., 7:626-634 (2003)), the Maestro™ in vivo fluorescence imaging system (Cambridge Research & Instrumentation, Inc.; Woburn, Mass.), in vivo fluorescence imaging using a flying-spot scanner (see, e.g., Ramanujam et al., IEEE Transactions on Biomedical Engineering, 48:1034-1041 (2001), and the like.
- Other methods or devices for detecting an optical response include, without limitation, visual inspection, CCD cameras, video cameras, photographic film, laser-scanning devices, fluorometers, photodiodes, quantum counters, epifluorescence microscopes, scanning microscopes, flow cytometers, fluorescence microplate readers, or signal amplification using photomultiplier tubes.
- The present invention is further illustrated by the below examples related to C1ORF32 antigen, its domains and expression data as well as prophetic examples describing the manufacture of fully human antibodies thereto. This information and examples is illustrative and should not be construed as further limiting. The contents of all figures and all references, patents and published patent applications cited throughout this application are expressly incorporated herein by reference.
- This Example relates to production of ECD fragments.
- Materials and Methods
- To produce C1ORF32-P8-ECD-mFC in CHO cells, retrovector constructs containing cDNA that code for the protein were transduced into CHO cells, and 3-4 rounds of transductions were carried out. Cell pool of the last transduction was grown in shake flasks by fed-batch production. Medium was harvested at 12-14 days when cell viability dropped to ˜50%.
- The harvested medium was clarified by depth filtration followed by 0.2 μm filter, and the clarified material was subjected to Protein A chromatography. The eluate, pH ˜3.7, was incubated with mixing for 60 minutes at room temperature to facilitate viral inactivation, neutralized to pH ˜7.2 and filtered through a 0.2 μm filter. Finally, the solution was buffer exchanged to PBS pH 7.2, concentrated to the desired protein concentration and filtered.
- Results
- SDS-PAGE analysis, under non-reducing conditions, of C1ORF32-P8-V1-ECD-mFC produced in CHO cells, as described below, revealed three main bands: the expected MW of ˜100 kD, a band at MW of ˜751(D, and a third one at MW of ˜55 kD. SDS-PAGE analysis in reduced conditions revealed two main bands—one at the expected MW of ˜50 kD and an additional of ˜301(D.
- Western Blot analyses using anti-C1ORF32-P8-V1-ECD and anti—mFc demonstrated the presence of mainly three protein species: the intact full-size dimer consisting of two chains each with an C1ORF32 ECD and a Fc (homodimer); a one-arm cleaved dimer consisting of one chain with an C1ORF32 ECD and a Fc and second chain with mainly the Fc (heterodimer); and a two-armed cleaved dimer composed of two chains with mainly the Fc (fully cleaved dimer).
- N-terminal sequencing revealed a major cleavage site towards the C-terminus of the C1ORF32 ECD between amino acids F and A at positions 179 and 180 of H19011_1_P8_V1 or H19011_1_P8 (Seq ID NOs: 4 or 5). To prevent this cleavage the amino acids F and A at positions 179 and 180 of H19011_1_P8_V1 or H19011_1_P8 (SEQ ID NOs: 4 or 5) were mutated as follows: FA→GA, FA→AA, and FA→GG. The resulted C1ORF32 ECD fragments are represented by, for example, SEQ ID NOs : 64, 96, and 45, respectively.
- The Fc-fused C1ORF32 ECD proteins were produced as follows: Fc-fused C1ORF32 ECD (SEQ ID NO:108), corresponds to C1ORF32 ECD without signal peptide (SEQ ID NO: 64) fused to mouse mIgG2a Fc (SEQ ID NO: 31) via GS_TEV_linker_SG (SEQ ID NO:113).
- Fc-fused C1ORF32 ECD-Delta DLLPSFAVEIM (SEQ ID NO:110) corresponds to C1ORF32 ECD-Delta DLLPSFAVEIM fragment without signal peptide (SEQ ID NO:51) fused to mouse mIgG2a Fc (SEQ ID NO: 31) via GS_TEV_linker_SG (SEQ ID NO:113). C1ORF32 ECD-Delta RTGLLADLLPSFAVEIM (SEQ ID NO:112) corresponds to C1ORF32 ECD-Delta RTGLLADLLPSFAVEIM fragment without signal peptide (SEQ ID. NO:29) fused to mouse mIgG2a Fc (SEQ ID NO: 31) via GS_TEV_linker_SG (SEQ ID NO:113).
- All the fused proteins were produced using two service providers; Catalent and ExcellGene, each using its own production protocol as described below:
- Production by Catalent (Middleton, Wis., USA): Codon-optimized cDNA sequences encoding C1ORF32 ECD (SEQ ID NO:108), Fc-fused C1ORF32 ECD-Delta DLLPSFAVEIM (SEQ ID NO:110), and C1ORF32 ECD-Delta RTGLLADLLPSFAVEIM (SEQ ID NO:112) were produced at Catalent in CHO cells, in pIRESpuro3 vector.
- The cDNA sequence of the insert was verified by Catalent and was used to construct GPEx® retrovectors, followed by four rounds of retrovector transduction into Catalent's “in-house” CHO-S cell line. A pooled population was produced and expanded and gene copy index was 2.7. Cell culture supernatants were analyzed by Catalent's Fc ELISA assay and relative productivity of the 4× transduced pool was 28 μg/ml.
- The protein was produced in 5 L wave bioreactor, and purified according to their in-house process. The level of purity was estimated at >95%, by SDS PAGE and Coomassie staining (data not shown). The concentration of purified protein was measured by absorbance at A280 nm, and estimated at 1.60 mg/ml (using an absorbance coefficient of 1.28 mg/ml). Endotoxin levels were tested, and estimated at 0.25-0.5 EU/ml. A total of ˜400 mg were obtained from ˜10L of cell pool.
- Production by ExcellGene (Valais, Switzerland): Codon-optimized cDNA sequences encoding C1ORF32 ECD (SEQ ID NO:108), Fc-fused C1ORF32 ECD-Delta DLLPSFAVEIM (SEQ ID NO:110), and C1ORF32 ECD-Delta RTGLLADLLPSFAVEIM (SEQ ID NO:112) were synthesized and subcloned into ExcellGene's proprietary expression vector (pXLG6), designed for high yield transient gene expression vectors. Expression vectors were then transiently-transfected into Exellgene's CHOExpress™ host cells, and cells were cultured for 12-14 days in TubeSpin50® bioreactors. Viability was determined daily, and productivity was assessed at the end of the culture by Western Blot analysis. A second transient transfection was then performed, and the resultant cells were cultured in 1-2 L to obtain the required amount of protein. Culture supernatants were clarified and purified on Protein A columns. Purified proteins were analyzed by a standard SDS-PAGE gel under standard conditions, for which results are shown in
FIG. 2 , and concentration was determined by A280. Proteins were tested for bioburden and endotoxin. InFIG. 2 , lane 12 relates to the protein having the sequence of SEQ ID NO:110, while lane 13 relates to the protein having the sequence of SEQ ID NO:112. - The effect of Fc-fused C1ORF32 ECD (SEQ ID NO:108), Fc-fused C1ORF32 ECD-Delta DLLPSFAVEIM (SEQ ID NO:110), and C1ORF32 ECD-Delta RTGLLADLLPSFAVEIM (SEQ ID NO:112)on TCR-mediated activation of mouse T cells, was evaluated by testing their effect on IFNγ secretion and on the expression of the activation marker CD69 in CD4+CD25− purified T cells.
- Methods
- CD4+CD25− T cells were isolated from pools of spleens and lymph nodes of BALB/C mice by one step negative selection using T cell isolation Kit (Miltenyi Cat#130-093-227) according to the manufacturer's instructions. The purity obtained was >95%. The cells used in the functional assays, CD4+ T cells, were untouched CD4+CD25− cells, which include CD4+CD62Lhigh naive T cells (85-90% of bulk CD4 population) and CD4+CD62Llow memory cells.
- Anti-CD3 mAb (clone 145-2C11) alone or together with Fc-fused C1ORF32 ECD (SEQ ID NO:108), Fc-fused C1ORF32 ECD-Delta DLLPSFAVEIM (SEQ ID NO:110), and C1ORF32 ECD-Delta RTGLLADLLPSFAVEIM (SEQ ID NO:112) or with control mIgG2a (BioXCell Cat. #BE0085) were co-immobilized at the stated concentrations on 96-well flat bottom tissue culture plates (Sigma, Cat. #92096), overnight at 4° C. Wells were washed 3 times with PBS and plated with 1×105 CD4+ T cells per well at 37° C. Culture supernatants were collected 48 h post stimulation and analyzed for IFNy secretion using mouse IFNγ ELISA kit (R&D Systems). The effect of immobilized Fc-fused C1ORF32 ECD (SEQ ID NO:108), Fc-fused C1ORF32 ECD-Delta DLLPSFAVEIM (SEQ ID NO:110), and C1ORF32 ECD-Delta RTGLLADLLPSFAVEIM (SEQ ID NO:112) (10 μg/ml) on the activation marker CD69 was analyzed by FACS, 48 h post simulations with plate bound anti-CD3.
- Effect of Fc-Fused C1ORF32 ECD (SEQ ID NO:108), Fc-Fused C1ORF32 ECD-Delta DLLPSFAVEIM (SEQ ID NO:110), and C1ORF32 ECD-Delta RTGLLADLLPSFAVEIM (SEQ ID NO:112) on Mouse CD4 T Cells IFNγ Secretion
- In order to evaluate the effect of Fc-fused C1ORF32 ECD (SEQ ID NO:108), Fc-fused C1ORF32 ECD-Delta DLLPSFAVEIM (SEQ ID NO:110), and C1ORF32 ECD-Delta RTGLLADLLPSFAVEIM (SEQ ID NO:112) on CD4 T cell response, titrated amounts of the respective Fc-fusion C1ORF32 ECD protein or control mIgG2a were immobilized on 96-well plates together with anti-CD3 mAb, and IFNy secretion from CD4+ T cells was analyzed. Cells were activated for 48 hrs using full RPMI containing 10% FBS, 1 mM sodium pyruvate, 100 IU/ml Pen-Strep (without 2-ME). The results presented in
FIG. 3 indicate potent inhibitory effect Fc-fused C1ORF32 ECD (SEQ ID NO:108), Fc-fused C1ORF32 ECD-Delta DLLPSFAVEIM (SEQ ID NO:110), and C1ORF32 ECD-Delta RTGLLADLLPSFAVEIM (SEQ ID NO:112) on CD4 T cells IFN-γ secretion. - Effect of Fc-fused C1ORF32 ECD (SEQ ID NO:108), Fc-fused C1ORF32 ECD-Delta DLLPSFAVEIM (SEQ ID NO:110), and C1ORF32 ECD-Delta RTGLLADLLPSFAVEIM (SEQ ID NO:112) on the Early Activation Marker CD69
- In order to evaluate the effect of Fc-fused C1ORF32 ECD (SEQ ID NO:108), Fc-fused C1ORF32 ECD-Delta DLLPSFAVEIM (SEQ ID NO:110), and C1ORF32 ECD-Delta RTGLLADLLPSFAVEIM (SEQ ID NO:112) on the early activation marker CD69, an experiment similar to that described in
FIG. 3 herein was carried out, using 10 ug/ml of Fc-fused C1ORF32 ECD (SEQ ID NO:108), Fc-fused C1ORF32 ECD-Delta DLLPSFAVEIM (SEQ ID NO:110), or C1ORF32 ECD-Delta RTGLLADLLPSFAVEIM (SEQ ID NO:112), respectively. All Fc-fused C1ORF32 ECD proteins tested had a suppressive effect on early activation markers CD69 at 48h post stimulation as manifested in a reduction of CD69 upregulation upon stimulation, as shown inFIG. 4 . - Conclusion
- Immobilized Fc-fused C1ORF32 ECD (SEQ ID NO:108), Fc-fused C1ORF32 ECD-Delta DLLPSFAVEIM (SEQ ID NO:110), or C1ORF32 ECD-Delta RTGLLADLLPSFAVEIM (SEQ ID NO:112) inhibit CD4 T cell activation to a similar extent as manifested by reduced IFNy secretion and CD69 expression compare to control Ig upon TCR stimulation.
- Naive CD4+ T cells were isolated from spleens of D011.10 mice (Jackson) via automax sort: CD4-negative sort (Miltenyi Cat#130-095-248), including anti-CD25 (Miltenyi Cat#130-091-072) in the negative sort cocktail, followed by CD62L-positive sort (Miltenyi Cat #130-049-701). Balb/c total splenocytes were also collected from one mouse, and irradiated with 3000rads to serve as antigen presenting cells (APCs) for the D011.10 CD4+ T cells. Naive CD4+ T cells were cultured at 2.5×105 cells per well in flat-bottom 96-well plates with irradiated APCs at a ratio of 1:1 (APCs to T cells) in 200u1 of HL-1 medium, and activated with 2 ug/ml OVA323-339 in the presence of one of Fc-fused C1ORF32 ECD (SEQ ID NO:108), (produced in CHO-S and in CHO-DG44 as detailed in Example 2) Fc-fused C1ORF32 ECD-Delta DLLPSFAVEIM (SEQ ID NO:110), (produced in CHO-DG44 as detailed in Example 2) and or C1ORF32 ECD-Delta RTGLLADLLPSFAVEIM (SEQ ID NO:112) (produced in CHO-S and in CHO-DG44 as detailed in Example 3) or Isotype control Ig (mIgG2a, BioXCell Cat. #BE0085) at the indicated concentrations (0.1-10 ug/ml). The cells were pulsed with luCi of tritiated-thymidine at 24 hours, and harvested at 72 hours.
- Results and conclusions:
- As demonstrated in
FIG. 5 , the Fc-fused C1ORF32 ECD (SEQ ID NO:108), as well as Fc-fused C1ORF32 ECD-Delta DLLPSFAVEIM (SEQ ID NO:110), or C1ORF32 ECD-Delta RTGLLADLLPSFAVEIM (SEQ ID NO:112) inhibit T cell proliferation in response to OVA323-339 activation in a dose dependent manner A slightly reduced activity (approximately 3 fold) was achieved by the proteins produced in CHO-DG44 versus those produced in CHO-S. These differences reflect batch to batch variation of these proteins. - A plurality of animals, having a disease model appropriate for testing of the autoimmune disease, receives each of the above described Fc-fused ECD proteins in a plurality of doses. A dose dependent response is seen.
- Similarly, a plurality of animals infected with an infectious disease in which T cell exhaustion is exhibited (for example through chronic viral infection) and receives each of the above Fc-fused ECD proteins in a plurality of doses, in combination with an pharmaceutical agent in a pharmaceutically effective amount against the infectious agent. A dose dependent response is seen.
- Effect of C1ORF32 Protein Fragments and/or Fusion Proteins on Activation of Naive CD4+ T Cells with Anti-CD3/ANTI-CD28 Coated Beads
- Naive CD4+ T cells are isolated from 5 SJL (Harlan, Israel) mice via automax sort. Beads are coated with anti-CD3 (0.5 ug/m1; clone 2C11) and anti-CD28 (2 ug/ml; clone 37.51 eBioscience) following manufacturer's protocol (Dynabeads M-450 Epoxy Cat. 140.11, Invitrogen), and with increasing concentrations of any one of the C1ORF32 protein fragments and/or fusion proteins thereof (0.1-10 ug/ml). The total amount of protein used for beads coating with any one of the C1ORF32 protein fragments and/or fusion proteins thereof is completed to 10 ug/ml with Control Ig. Naive CD4+ T cells (0.5×106/well) are activated with the coated beads at a ratio of 1:2 (beads to T cells). The cells are pulsed with luCi of tritiated-thymidine after 24 hours, and harvested after 72.
- The ability of any one of the C1ORF32 protein fragments and/or fusion proteins thereof to inhibite T cell proliferation and elicit its effect in a dose dependent manner is checked. An appropriate response is seen.
- Dose Response Effect of C1ORF32 Protein Fragments and/or Fusion Proteins Thereof on Mouse CD4+ T Cell Activation With Plate Bound Anti-CD3, as Manifested in Cytokine Production and Expression of the Activation Marker CD69
- Untouched CD4+CD25− T cells are isolated from pools of spleen and lymph node cells of BALB/C mice by negative selection using CD4+CD62L+ T cell isolation Kit (Miltenyi Cat#130-093-227) according to the manufacturer's instructions. The desired purity obtained is >95%.
- Tissue culture 96-well plates are coated overnight at 4° C. with 2 ug/ml anti-CD3 mAb (clone 145-2C11) in the presence of any one of the C1ORF32 protein fragments and/or fusion proteins thereof at 1, 5 and 10 μg/ml. Control mIgG2a (Clone C1.18.4 from BioXCell; Cat#BE0085) is added to each well in order to complete a total protein concentration of 12 μg/ml per well. Wells are plated with 1×105 CD4+CD25− T cells per well. At 48 hrs post stimulation, culture supernatants are collected and analyzed using mouse IFNγ ELISA kit, and cells are analyzed for expression of the activation marker CD69 by flow cytometry.
- The inhibitory effects of any one of the C1ORF32 protein fragments and/or fusion proteins thereof on CD4 T cell activation is demonstrated by reduced IFNγ secretion and reduced expression of CD69 upon TCR stimulation, compared to control mIgG2a and CTLA4-Ig.
- The Effect of C1ORF32 Protein Fragments and/or Fusion Proteins Thereof on CD4+ T Cell Differentiation In Vitro
- To test the ability of any one of the C1ORF32 protein fragments and/or fusion proteins thereof to inhibit CD4+ T cell differentiation, naïve CD4+ T cells are isolated from D011.10 mice, which are transgenic for a T cell receptor (TCR) that is specific for OVA323-339 peptide. Using D011.10 T cells enables studying both polyclonal (anti-CD3/anti-CD28 mAbs) and peptide-specific responses on the same population of CD4+ T cells. Naïve CD4+ T cells are isolated from D011.10 mice and activated in culture in the presence of anti-CD3/anti-CD28 coated beads or OVA323-339 peptide plus irradiated BALB/c splenocytes, in the presence of any one of the C1ORF32 protein fragments and/or fusion proteins thereof, control Ig, or B7-H4 Ig. The cells are activated in the presence of Th driving conditions as follows: Th0 cell-(IL-2), Th1 cell-(IL-2+ IL-12), Th2 cell-(IL-2+ IL-4), or Th17 cell-(TGF-β+ IL-6+ IL-23+ anti-IL-2). The effects on T cell differentiation and Th-specific responses are assessed by measuring cell proliferation and subtype specific cytokine production: IL-4, IL-5, IL-10, IL-17, IFN-γ. An appropriate response is seen.
- Assesment of the Effect of Any One of the C1ORF32 Protein Fragments and/or Fusion Proteins Thereof on Human T Cells Activation
- The effect of any one of the C1ORF32 protein fragments and/or fusion proteins thereof on human T cell response is tested by two different in vitro assays using purified human T cells. In the first assay, human T cells are activated by anti-CD3 and anti-CD28 coated beads, and in the other assay, activation is carried out using anti-CD3 and anti-CD28 antibodies in the presence of autologous, irradiated PBMCs. The regulatory activity of any one of the C1ORF32 protein fragments and/or fusion proteins thereof on human T cell activation, is evaluated by measuring cell proliferation and cytokine release.
- Study I—Activation of Human T Cells with Anti-CD3 and Anti-CD28-Coated Beads is Inhibited by Fusion Proteins
- Naïve CD4+ T cells are isolated from 4 healthy human donors and activated with anti-CD3 mAb/anti-CD28 mAb coated beads in the presence of control mIgG2a, or any one of the C1ORF32 protein fragments and/or fusion proteins thereof. Two side-by-side culture sets are set up; one culture being pulsed at 24 hours with tritiated-thymidine and harvested at 72 hours while the second plate is harvested at 96 hours for cytokine production via LiquiChip.
- Study II—Activation of Human T Cells with Irradiated Autologous PBMCs is Inhibited by Fusion Proteins
- Total PBMCs are isolated from fresh blood of healthy human donors using ficoll gradient. 10×106 total PBMCs are resuspended in Ex-Vivo 20 medium, and irradiated at 3000rad. These cells are used to activate the isolated T cells in vitro, by presenting the anti-CD3, anti-CD28 and either of the test proteins. The rest of PBMCs are used for isolation of T cells using CD4+ T cell Isolation Kit II from Miltenyi.
- For activation, 5×105 isolated T cells are cultured in the presence of 5×105 autologous irradiate PBMCs. Anti-CD3 (0.5 μg/ml), anti-CD28 (2 ug/ml) and either of any one of the C1ORF32 protein fragments and/or fusion proteins thereof or control Ig (mIgG2a) are added in a soluble form. The cultures are pulsed with 1 uCi of triated thymidine at 24 hrs, and proliferation is measured at 72 hours.
- The effects of any one of the C1ORF32 protein fragments on human T cell responses are evaluated following their ectopic expression in ‘T cell stimulator’ cells: a murine thymoma cell line, Bw5147, which are engineered to express membrane-bound anti-human CD3 antibody fragments, that can trigger the TCR-complex on human T cells, with or without co-expression of putative costimulatory or coinhibitory ligands.
- Codon-optimized cDNAs encoding any one of the C1ORF32 protein fragments are gene-synthesized and directionally cloned into a retroviral vector pCJK2 via Sfi-I sites. Monocistronic expression constructs are generated. The constructs are validated by agarose gel electrophoresis and were expressed in Bw5147 cells displaying high levels of membrane bound anti-CD3 antibody (Bw-3/2) (Leitner et al., 2010). As negative control Bw5147 cells transduced with “empty” vector (pCJK2) are used. In addition, Bw-3/2 cells expressing costimulatory molecules (ICOSL and CD70) and Bw-3/2-cells expressing coinhibitory molecules (B7-H3 and B7-H1/PD-L1) are also used as controls. Homogenously high expression of the stimulating membrane-bound anti-CD3 antibody is confirmed by FACS using a DyLight-649 anti-mouse IgG (H+L) antibody that reacts with the murine single chain antibody expressed on the stimulator cells. Presence and high level transcription of expression monocistronic constructs in the respective stimulator cells is confirmed by qPCR.
- T cells are purified from buffy coats or heparinised blood derived from healthy volunteer donors and the mononuclear fraction is obtained by standard density centrifugation using Ficoll-Paque (GE-Healthcare). Untouched bulk human T cells are obtained through MACS-depletion of CD11b, CD14, CD16, CD19, CD33 and MHC-class II-bearing cells with the respective biotinylated mAb in conjunction with paramagnetic streptavidin beads (Leitner et al., 2009).
- Purified CD8 T cells and CD4 T cells are obtained by adding biotinylated CD4 and CD8 mAb to the pools. Naïve CD4 T cells are isolated using the Naïve CD4+T cell Isolation Kit II (Miltenyi Biotec). Following isolation, cells are analyzed for purity by FACS, and samples with sufficient purity (>90%) were used for the experiments.
- The stimulator cells are harvested, counted, irradiated (2×3000 rad) and seeded in flat-bottom 96-well plates (20000 cells/well). Liquid nitrogen stored MACS-purified T cells are thawed, counted and added to the wells at 100.000 cells per well; total volume was 200 μl/well. Triplicate wells are set up for each condition. Following 48 hours of co-culture, 3H-thymidine (final concentration of 0.025 mCi; PerkinElmer/NewEngland Nuclear Corporation, Wellesley, MA) are added to the wells. Following further culturing for 18 hours, the plates were harvested on filter-plates and incorporation of 3H-Thymidine was determined as described in Pfistershammer et al., 2004. In addition, a series of experiments with MACS-purified T cell subsets (CD8 T cells, CD4 T cells, and naïve CD45RA-positive CD4 T cells) are performed. Additional controls in all experiments include wells with stimulator cells alone to assess the cells microscopically and also to determine basal 3H-Thymidine incorporation of the stimulator cell w/o T cells. Results with stimulator cells that quickly disintegrated following irradiation are excluded from the analysis.
- Results show the effect of stimulator cells expressing any one of the C1ORF32 protein fragments on the proliferation of human bulk T cells, CD4+ T cells, CD8+ T cells, or naïve CD4 CD45RA+ T cells, compared to cells expressing control costimulatory molecules (ICOSL and CD70), which results in a consistent and pronounced stimulation of proliferation of all cell subtypes, and compared to cells expressing control coinhibitory molecules (B7-H3 and B7-H1/PD-L1), which results in a mild inhibition of proliferation of different T cell subtypes.
- Splenocytes from D011.10 mice (transgenic mice in which all of the CD4+ T cells express a T cell receptor that is specific for OVA323-339 peptide) are activated in the presence of OVA323-339 peptide, and cells are collected at t=0, 6, 12, 24, and 48 hours following initial activation to determine which cell type is expressing a receptor for any one of the C1ORF32 protein fragments over time. Cells are then co-stained for CD3, CD4, CD8, B220, CD19, CD11b, and CD11c.
- Assesment of the Effect of Any One of the C1ORF32 Protein Fragments and/or Fusion Proteins Thereof on the Ability of B Cells to Class-Switch and Secrete Antibody
- Resting B cells are isolated from unprimed C57BL/6 mice and activated in vitro in the presence of anti-CD40 plus (i) no exogenous cytokine, (ii) IL-4, or (iii) IFN-γ. The cell cultures receive control Ig (mIgG2a), anti-CD86 mAb (as a positive control for increased Ig production), or any one of any one of the C1ORF32 protein fragments and/or fusion proteins thereof, at the time of culture set up, and are cultured for 5 days. Any one of the C1ORF32 protein fragments and/or fusion proteins thereof are tested at three concentrations each. At the end of culture, supernatants are tested for the presence of IgM, IgG1, and IgG2a via ELISA. If there appears to be an alteration in the ability of the B cells to class-switch to one isotype of antibody versus another, then the number of B cells that have class switched is determined via ELISPOT. If there is an alteration in the number of antibody producing cells, then it is determined if there is an alteration in the level of γ1- and γ2a-sterile transcripts versus the mature transcripts for IgG1 and IgG2a. An appropriate response is seen.
- Assesment of the Therapeutic Effect of Any One of the C1ORF32 Protein Fragments and/or Fusion Proteins Thereof for Treatment of Autoimmune Diseases
- Efficacy of Any One of the C1ORF32 Protein Fragments and/or Fusion Proteins Thereof in Mouse R-EAE Model of Multiple Sclerosis
- The therapeutic effect of any one of the C1ORF32 protein fragments and/or fusion proteins thereof for treatment of autoimmune diseases is tested in a mouse model of Multiple Sclerosis; Relapsing Remitting Experimental Autoimmune Encephalomyelitis (R-EAE):
- Female SJL mice 6 weeks old are purchased from Harlan and maintained in the CCM facility for 1 week prior to beginning the experiment. Mice are randomly assigned into groups of 10 animals and primed with 50 μg PLP139-151/CFA on
day 0. Mice receive 6 i.p. injections of 100 ug/dose of any one of the C1ORF32 protein fragments and/or fusion proteins thereof, mIgG2a isotype control, or CTLA4-Ig (mouse ECD fused to mouse IgG2a Fc) as positive control. Treatments begin at the time of onset of disease remission and are given 3 times per week for 2 weeks. Mice are followed for disease symptoms. On day 35, (during the peak of the disease relapse) 5 mice of each group are assayed for DTH (delayed type hypersensitivity) response to disease inducing epitope (PLP139-151) and to relapse-associated myelin epitope (PLP178-191) via injection of 10 μg of PLP139-151 in one ear and PLP178-191 into the opposite ear. The level of ear swelling is assayed at 24 hours post challenge. - The decrease in disease severity of R-EAE-induced mice upon treatment with any one of the C1ORF32 protein fragments and/or fusion proteins thereof, in a therapeutic mode is tested and compared to the level of inhibition of CTLA4-Ig.
- In addition, inhibition of DTH responses to the disease inducing epitope (PLP139-151) and to relapse-associated epitope (PLP178-191). in ROEAE mice treated with any one of the C1ORF32 protein fragments and/or fusion proteins thereof is tested.
- To test the dose dependency of the efficacy of any one of the C1ORF32 protein fragments and/or fusion proteins thereof as well as its mode of action in the PLP-induced R-EAE model, disease is induced as described above and mice are treated from onset of disease remission with 100, 30 or 10 ug/dose of any one of the C1ORF32 protein fragments and/or fusion proteins thereof, 3 times per week over two weeks. The ability of C1ORF32 protein fragments and/or fusion proteins thereof to decrease the level of disease severity in a dose dependent manner, as well as the ability to inhibit DTH responses to spread epitopes PLP178-191 and MBP84-104, to inhibit proliferation as well as reduction in IFNγ, IL-17, IL-4 and IL-10 release is tested.
- The beneficial effect of any one of the C1ORF32 protein fragments and/or fusion proteins thereof in the R-EAE model on reduction in the infiltration of immune cells to the CNS is also tested.
- Efficacy of Any of the C1ORF32 Protein Fragments and/or Fusion Proteins Thereof in Mouse CIA Models of Rheumatoid Arthritis
- Any one of the C1ORF32 protein fragments and/or fusion proteins thereof is tested in mouse model of collagen-induced arthritis (CIA) which is a model of rheumatoid arthritis. Male DBA/1 mice are housed in groups of 8-10, and maintained at 21° C.±2° C. on a 12 h light/dark cycle with food and water ad libitum. Arthritis is induced by immunisation with type II collagen emulsified in complete Freund's adjuvant. Mice are monitored on a daily basis for signs of arthritis. On the appearance of arthritis (day 1) treatment with any one of the C1ORF32 protein fragments and/or fusion proteins thereof, mIgG2a isotype control or CTLA4-Ig (mouse ECD fused to mouse IgG2a Fc) as positive control (100 ug/dose, each) is initiated and given 3 times per week for 10 days. Hind footpad swelling is measured (using microcalipers), as well as the number and degree of joint involvement in all four limbs. This yields two measurements, clinical score and footpad thickness that can be used for statistical assessment.
- At the end of the treatment period mice are bled and sacrificed. For histological analysis, paws are removed at post mortem, fixed in buffered formalin (10% v/v), then decalcified in EDTA in buffered formalin (5.5% w/v). The tissues are then embedded in paraffin, sectioned and stained with haematoxylin and eosin. The scoring system is as follows:
- 0=normal; 1 =synovitis but cartilage loss and bone erosions absent or limited to discrete foci; 2=synovitis and significant erosions present but normal joint architecture intact; 3=synovitis, extensive erosions, joint architecture disrupted.
- The ability of the treatment of mice with established CIA with any one of the C1ORF32 protein fragments and/or fusion proteins thereof to result in potent reduction of clinical score, paw swelling and histological damage is tested and compared to the efficacy obtained with CTLA4-Ig.
- Effect of Any of the C1ORF32 Protein Fragments and/or Fusion Proteins Thereof on Tolerance Induction in Transfer Model of CIA
- To further understand the effect of any one of the C1ORF32 protein fragments and/or fusion proteins thereof on immune regulation, the ability of these proteins to induce tolerance in a transfer model of arthritis is analyzed.
- In brief, spleen and LN cells from arthritic DBA/1 mice treated for 10 days with any one of the C1ORF32 protein fragments and/or fusion proteins thereof or control Ig2a are removed and injected i.p into T-cell deficient C.B-17 SCID recipients. The mice then receive an injection of 100 μg type II collagen (without CFA), necessary for successful transfer of arthritis. Arthritis is then monitored in the SCID mice. Histology is performed and anti-collagen antibody levels are measured to determine that the C1ORF32 protein fragments and/or fusion proteins thereof treatment confers long-term disease protection.
- Assessment of the Effect of Any One of C1ORF32 Protein Fragments and/or Fusion Proteins Thereof in a Viral Infection Model of TMEV
- Theiler's murine encephalomyelitis virus (TMEV) is a natural endemic pathogen of mice that causes an induced demyelinating disease (TMEV-IDD) in susceptible strains of mice (SJL/J, H-2KS) that resembles the primary progressive form of MS (Munz et al., Nat Rev Immunol 2009; 9:246-58). TMEV infection results in a life-long persistent virus infection of the CNS leading to development of a chronic T cell-mediated autoimmune demyelinating disease triggered via de novo activation of CD4 T cell responses to endogenous myelin epitopes in the inflamed CNS (i.e. epitope spreading) (Miller et al., Nat Med 1997; 3:1133-6; Katz-Levy et al., J Clin Invest 1999; 104:599-610).
- SJL mice clear the majority of the virus within 21 days post infection, however a latent viral infection is maintained and infect microglia, astrocytes, and neurons. Disease symptoms are manifested around day 25-30 post infection.
- The effect of treatment with any one of C1ORF32 protein fragments and/or fusion proteins thereof on acute and chronic phases of viral infection is studied in the TMEV-IDD model by assessment of viral clearance and disease severity.
- Female SJL/J mice (5-6 weeks) are infected with TMEV by intracranial inoculation in the right cerebral hemisphere of 3×107 plaque forming units (PFU) of the BeAn strain 8386 of TMEV in 30 ul serum-free medium. From
day 2 post infection mice are treated with Control Ig, or any one of C1ORF32 protein fragments and/or fusion proteins thereof, at 100 ug/dose each; 3 doses/week for 2 weeks. - Mice are followed for clinical scoring. On day 7 and day 14 post infection (after 3 and 6 treatments respectively) brains and spinal cords are collected from 5 mice in each treatment group for plaque assays. The tissues are weighted so that the ratio of PFU/mg of CNS tissue could be calculated after the plaque assay is completed.
- TMEV plaque assay:
- Brains and spinal cords of mice treated with Control Ig (mouse IgG2a), or with any one of C1ORF32 protein fragments and/or fusion proteins thereof are collected at days 7 and 14 post-infection from non-perfused anesthetized mice. The Brains and spinal cords are weighed, and homogenized. CNS homogenates are serially diluted in DMEM and added to tissue culture-treated plates of confluent BHK-21 cells for lh incubation at room temperature, with periodic gentle rocking.
- A media/agar solution is mixed 1:1 (volume:volume), added to cells and allowed to solidify at room temperature. The plates are then cultured at 34 deg C for 5 days. At the end of culture, 1 ml of formalin is added and incubated at room temperature for 1 h to fix the BHK monolayer. The formalin is poured off into a waste container, and the agar is removed from the plates. Plaques are visualized by staining with crystal violet for 5 min, and plates are gently rinsed with diH2O. To determine PFU/ml homogenate, the number of plaques on each plate is multiplied by the dilution factor of the homogenate and divided by the amount of homogenate added per plate. The PFU/ml is divided by the weight of the tissue to calculate PFU/mg tissue.
- Assessment of the Effect of Any One of C1ORF32 Protein Fragments and/or Fusion Proteins Thereof on Primary and Secondary Immune Response to Viral Infection in a Mouse Model of Influenza
- To test the effect of any one of C1ORF32 protein fragments and/or fusion proteins thereof on primary and secondary immune responses to viral infection, BALB/c naïve mice (for primary immune responses) and ‘HA-memory mice’, is used, as well as ‘polyclonal flu-memory mice’ (to assess secondary responses mediated by memory CD4 T cells), which are generated as detailed in Teijaro et al., J Immunol. 2009: 182; 5430-5438, and described below.
- To obtain ‘HA-memory mice’, first HA-specific memory CD4 T cells are generated, naive CD4 T cells are purified from spleens of HA-TCR mice [BALB/c-HA mice which express transgenic T cell receptor (TCR) specific for influenza hemagglutinin (HA) peptide (110-119)] and primed in vitro by culture with 5.0 microg/ml HA peptide and mitomycin C-treated, T-depleted BALB/c splenocytes as APCs for 3 days at 37° C. The resultant activated HA-specific effector cells are transferred into congenic BALB/c (Thyl.1) hosts (5×106 cells/mouse) to yield “HA-memory mice” with a stable population of HA-specific memory CD4 T cells.
- To obtain ‘polyclonal-memory mice’, first polyclonal influenza-specific memory CD4 T cells are generated, by infecting BALB/c mice intranasally with a sublethal dose of PR8 influenza, CD4 T cells are isolated 2-4 months postinfection, and the frequency of influenza-specific memory CD4 T cells is determined by ELISPOT. CD4 T cells from previously primed mice are transferred into BALB/c hosts to generate “polyclonal flu-memory” mice with a full complement of endogenous T cells.
- Primary and secondary responses to influenza virus are tested by infecting naïve BALB/c mice or BALB/c-HA memory mice and BALB/c ‘polyclonal flu-memory mice’ with sublethal or lethal doses of PR8 influenza virus by intranasal administration. Mice are treated with any one of C1ORF32 protein fragments and/or fusion proteins thereof or with mIgG2a control before and following influenza challenge. Weight loss and mortality will be monitored daily. Six days after the challenge, viral content in the bronchoalveolar lavage (BAL) is analyzed by collecting lavage liquid and testing the supernatant for viral content by determining the tissue culture
infectious dose 50% (TCID50) in MDCK cells. In addition, lung tissue histopathology is performed. - To test the effect of any one of C1ORF32 protein fragments and/or fusion proteins thereof on T cell expansion BALB/c or BALB/c-HA memory mice or BALB/c ‘polyclonal flu-memory mice’ are infected as above and administered with BrdU (1 mg/dose) on
days 3, 4 and 5 post infection. On day 6, spleen and lung are harvested and BrdU incorporation is estimated. Cytokine production by lung memory CD4 T cells during influenza challenge is also studied in HA-specific memory CD4 T cells stimulated in vitro with HA peptide in the presence of any one of C1ORF32 protein fragments and/or fusion proteins thereof or IgG2a for 18 hours. - Assessment of the Effect of Any One of C1ORF32 Protein Fragments and/or Fusion Proteins Thereof on Primary and Secondary CD8 T Cell Response to Viral Infection in a Mouse Model of Influenza
- The effect of any one of C1ORF32 protein fragments and/or fusion proteins thereof on primary CD8 T cell responses to influenza virus is studied according to methods as described in the literature (Hendriks et al., J Immunol 2005; 175; 1665-1676; Bertram et al., J Immunol. 2004; 172:981-8) using C57BL/6 mice infected with influenza A HKx31 by intranasal or intraperitoneal administration. Any one of C1ORF32 protein fragments and/or fusion proteins thereof or mIgG2a control is administered during priming Animal weight loss and mortality is monitored daily. To follow virus-specific CD8+ T cells, MHC H-2Db tetramers loaded with the major CD8 T cell epitope, the NP366-374 peptide are used. Virus-specific H-2Db/NP366-374+ CD8+ T cells in the lung, draining lymph nodes, and spleen are expected to reach a peak around day 8-10 post infection and decline thereafter to only 1.5% virus-specific CD8 T cells (Hendriks et al J Immunol 2005; 175; 1665-1676; Bertram et al., J Immunol. 2002; 168:3777-85; Bertram et a., J Immunol. 2004; 172:981-8). Thus, mice are sacrificed at days 8 and 21 post infection, and virus-specific CD8 T cell numbers is evaluated in the lung, draining lymph nodes and spleen. Viral clearance is assessed. CD8 T cell responses are evaluated in spleen cell suspensions, and include intracellular IFN-γ staining and CTL activity, as previously described (Bertram et a., J Immunol. 2004; 172:981-8) and detailed below.
- Cells are surface-stained with FITC-conjugated anti-mouse CD62L, PE-conjugated anti-mouse CD8 to measure CD8+ activated T cells (or anti-mouse CD4 to follow CD4+ cells). In addition to these Abs, allophycocyanin-labeled tetramers consisting of murine class I MHC molecule H-2Db, β2-microglobulin, and influenza NP peptide, NP366-374 are used to measure influenza-specific CD8 T cells. For intracellular IFN-γ staining, cell suspensions are restimulated in culture medium for 6 h at 37° C. with 1 μM NP366-374 peptide and GolgiStop (BD PharMingen, San Diego, Calif.). Cells are then harvested, resuspended in PBS/2% FCS/azide, and surface stained with PE-anti-CD8 and FITC-anti-CD62L as described above. After surface staining, cells will be fixed in Cytofix/Cytoperm solution (BD PharMingen) and then stained with allophycocyanin-conjugated antimouse IFN-γ diluted in 1× perm/wash solution (BD PharMingen). Samples are analyzed by Flow Cytometry.
- For cytotoxicity assays (CTL responses) splenocytes from influenza-infected mice are incubated for 2 h at 37° C. to remove adherent cells. Serial 3-fold dilutions of effectors are assayed for anti-influenza NP366-374-specific CTL activity against 51Cr-labeled EL4 cells pulsed with 50 μM NP366-374 peptide for 6 h as described by Bertram et al 2002 and Bertram et al 2004.
- At 3 weeks postinfection, some mice are rechallenged with the serologically distinct influenza A/PR8/34 (PR8), which shares the NP gene with influenza A HKx31, but differs in hemagglutinin and neuraminidase, so that neutralizing Abs do not limit the secondary CTL response. Mice are sacrificed at
days 5 & 7 following virus rechallenge, and virus-specific CD8 T cell numbers is evaluated in the lung, draining lymph nodes and spleen as described by Hendriks et al and Bertram et al (Hendriks et al., J Immunol 2005; 175; 1665-1676; Bertram et al., J Immunol. 2004; 172:981-8) and detailed above. Secondary CD8 T cell responses, including intracellular IFN-γ staining and CTL activity, are evaluated in spleen cell suspensions of mice atdays 5 & 7 following virus rechallenge, as described above. - To determine the effect of any one of C1ORF32 protein fragments and/or fusion proteins thereof on expansion and accumulation of memory CD8+ T cells during the secondary response, adoptive transfer experiments are performed, according to methods previously described (Hendriks et al., J Immunol 2005; 175; 1665-1676; Bertram et al., J Immunol. 2004; 172:981-8): mice are immunized with influenza influenza A HKx31. Twenty-one days later, T cells are purified from spleens on mouse T cell enrichment immunocolumns (Cedarlane Laboratories, Hornsby, Ontario, Canada) and labeled with CFSE (alternatively Thy1.1 congenic mice are used as recipients). Equal numbers of tetramer-positive T cells are injected through the tail vein of recipient mice. Mice are rechallenged with influenza virus as described above, and 7 days later splenocytes are evaluated for donor virus-specific CD8 T cells, as detailed above.
- Assessment of Protein Expression in Exhausted T Cells, and the Binding and Effect of Any One of C1ORF32 Protein Fragments and/or Fusion Proteins Thereof on Reversing Exhausted T Cell Phenotype
- Memory CD8 T-cell differentiation proceeds along distinct pathways after an acute versus a chronic viral infection (Klenerman and HillNat Immunol 6, 873-879, 2005). Memory CD8 T cells generated after an acute viral infection are highly functional and constitute an important component of protective immunity. In contrast, chronic infections are often characterized by varying degrees of functional impairment of virus-specific T-cell responses, and this defect is a principal reason for the inability of the host to eliminate the persisting pathogen. Although functional effector T cells are initially generated during the early stages of infection, they gradually lose function during the course of the chronic infection leading to exhausted phenotype characterized by impaired T cell functionality.
- Study I. The effect of any one of C1ORF32 protein fragments and/or fusion proteins thereof on clearance of viral infection and on T cell functions during acute and chronic viral infection.
- The effect of any one of C1ORF32 protein fragments and/or fusion proteins thereof on acute and chronic viral infection is evaluated in a mouse model of infection with LCMV (lymphocytic chroriomeningitis virus) according to methodology described by Wherry et al J. Virol. 77: 4911-4927, 2003 and Barber et al Nature, 2006, and detailed below.
- Two LCMV strains that can cause either acute or chronic infections in adult mice are used; the Armstrong strain which is cleared within a week, and the clone 13 strain which establishes a persistent infection that can last for months. As these two strains differ in only two amino acids, preserving all known T cell epitopes, it is possible to track the same CD8 T cell responses after an acute or chronic viral infection. In contrast to the highly robust memory CD8 T cells generated after an acute Armstrong infection, LCMV-specific CD8 T cells become exhausted during a persistent clone 13 infection (Wherry et al J. Virol. 77: 4911-4927, 2003; Barber et al., Nature. 2006; 439:682-7).
- Mice are infected with 2 ×105 PFU of Armstrong strain of LCMV intraperitoneally to initiate acute infection or 2 ×106 PFU of C1-13 intravenously to initiate chronic infection. Mice are treated i.p. with any one of C1ORF32 protein fragments and/or fusion proteins thereof or with mIgG2a control, and with specific anti-C1ORF32 protein—antibody, or an isotype control.
- The mice are monitored for numbers of virus specific CD8 T cells in the spleen, using virus-specific MHC tetramer epitopes, such as DbNP396-404 and DbGP33-41 which differ in acute or chronic infections. CD8 T cell functional assays, such as intracellular cytokines levels and CTL activity, are carried out as described by Wherry et al J. Virol. 77: 4911-4927, 2003, and similarly to those described in Example 40. Additional assays include production by splenocytes after stimulation with virus specific epitopes; and assessment of viral titers in the serum and in the spleen, liver, lung and kidney (Wherry et al J. Virol. 77: 4911-4927, 2003; Barber et al., Nature. 2006; 439:682-7).
- Study II. Assessment of C1ORF32 protein expression on exhausted T cells and binding of any one of C1ORF32 protein fragments and/or fusion proteins thereof to exhausted T cells in order to evaluate regulation ofthese proteins or their counterpart receptors during exhaustion of T cells:
- T cells are isolated from mice with chronic LCMV infection induced with C1-13 strain. The cells are co-stained with fluorescently labeled anti-PD-1 Ab as positive control (PD-1 is highly expressed by exhausted T cells) and biotinylated C1ORF32 protein fragments and/or fusion proteins thereof or biotinylated anti-C1ORF32 protein antibodies, and respective isotype control. Binding is detected by FACS analysis using fluorescently labeled streptavidin.
- Follicular helper T (Tfh) cells are a subset of CD4+ T cells specialized in B cell help (reviewed by Crotty, Annu. Rev. Immunol. 29: 621-663, 2011). Tfh cells migrate into B cell follicles within lymph nodes, and interact with cognate B cells at the T cell-B cell border and subsequently induce germinal center B cell differentiation and germinal center formation within the follicle (Reviewed by Crotty, Annu. Rev. Immunol. 29: 621-663, 2011). The requirement of Tfh cells for B cell help and T cell-dependent antibody responses, indicates that this cell type is of great importance for protective immunity against various types of infectious agents, as well as for rational vaccine design.
- Tfh cells are readily identifiable at the peak of the CD4+ T cell response to an acute lymphocytic choriomeningitis virus (LCMV) infection as CXCR5hi′SLAMloBTLAhiPD1hiPD1hiBcl6+ virus-specific CD4+ T cells (Choi et al 2011, Immunity 34: 932-946). T cells are isolated from mice with acute LCMV infection induced with 2 ×105 PFU of Armstrong strain of LCMV administered intraperitoneally. The cells are co-stained with fluorescently labeled antibodies for markers of Tfh (CXCRS, PD1, BTLA, Bc16) which are highly expressed by Tfh cells, and biotinylated C1ORF32 protein fragments and/or fusion proteins thereof or biotinylated antibodies specific for C1ORF32 proteins, and respective isotype controls. Binding of Fc fused protein or antibody is detected by FACS analysis using fluorescently labeled streptavidin. An appropriate response is seen.
- Assessment of the Effect of Any One of C1ORF32 Protein Fragments and/or Fusion Proteins Thereof on Follicular Helper T (TFH) Cells Generation and Activity
- In order to investigate the effect of any one of C1ORF32 protein fragments and/or fusion proteins thereof on Tfh differentiation and development of B cell immunity in vivo, C57BL/6 are treated with any one of C1ORF32 protein fragments and/or fusion proteins thereof and an isotype control throughout the course of an acute viral infection with Armstrong strain of LCMV (lymphocytic choriomeningitis virus). Tfh differentiation and Bc16 protein expression is assessed by FACS analysis as described by Eto et al 2011 (PLoS One 6: e17739). Splenocytes are analyzed 8 days following LCMV infection, Tfh generation (CD44hiCXCR5hiSLAMlo) and Bcl6 expression is evaluated by FACS analysis. In addition, the effect of any one of C1ORF32 protein fragments and/or fusion proteins thereof on antigen-specific B cell responses is evaluated as described by Eto et al 2011 (PLoS One 6: e17739), including titers of anti-LCMV IgG in the serum at 8 days following LCMV infection, and quantitation by FACS analysis of plasma cell (CD138+IgD−) development at 8 days post-infection, gated on CD19+ splenocytes.
- The Effect of Any One of C1ORF32 Protein Fragments and/or Fusion Proteins Thereof in Modulation of
Type 1 Diabetes in NOD Mice, CD28-KO NOD, and B7-2-KO NOD - The effect of any one of C1ORF32 protein fragments and/or fusion proteins thereof is studied in a widely used mouse model of
type 1 diabetes: nonobese diabetic (NOD) mice which develop spontaneous In NOD mice, spontaneous insulitis, the hallmark pathologic lesion, evolves through several characteristic stages that begin with peri-insulitis and end with with invading and destructive insulitis and overt diabetes. Peri-insulitis is first observed at 3-4 wk of age, invading insulitis at 8-10 wk, and destructive insulitis appears just before the onset of clinical diabetes, with the earliest cases at 10-12 wk. At 20 wk of age, 70-80% of female NOD mice become diabetic (Ansari et al 2003 J. Exp. Med. 198: 63-69). - Two KO mice: CD-28-KO NOD mice and B7-1/B7-2 double KO NOD mice, —which develop accelerated diabetes (Lenschow et al 1996 Immunity 5: 285-293; Salomon et al 2000 Immunity 12: 431-440), are also used.
- Study I: NOD mice are treated with any one of C1ORF32 protein fragments and/or fusion proteins thereof early and late phases during the evolution of diabetes, before or after disease onset, to examine the effects of these compounds on disease pathogenesis and to demonstrate that such treatment reduces disease onset and ameliorates pathogenesis. To study the effect on insulitis, blood glucose levels are measured 3 times/week, for up to 25 weeks (Ansari et al 2003 J. Exp. Med. 198: 63-69).
- Mechanism of disease modification and mode of action is studied by experimental evaluation of individual immune cell types: pancreas, pancreatic LNs and spleen will be harvested to obtain Tregs, Th subtypes and CD8 T cells, DCs and B cells. Effect on cytokines secretion from cells isolated from pancreas, pancreatic LN and spleen is analysed, focused on IFNg, IL-17, IL-4, IL-10 and TGFb. Upon effect of the tested compounds, the mechanism of disease modification is studied by examination of individual immune cell types (including Tregs, Th subtypes and CD8 T cells, DCs and B cells); cytokines (IFNg, IL-17, IL-4, IL-10 and TGFb) and histology. Histologycal analysis of the pancreas is carried out to compare the onset of insulitis, and the lymphocyte infiltration.
- Study II—The effect of any one of C1ORF32 protein fragments and/or fusion proteins thereof in modulation of
Type 1 Diabetes in Adoptive transfer model - To further investigate the mode of action of the Ig fusion proteins, an adoptive transfer model of diabetes is used. T cells from diabetic or prediabetic NOD donors are transfered to NOD SCID recipient mice. These mice are monitored for development of diabetes. The urine glucose and blood glucose, and assess histology of the pancreas, and T cell responses are monitored as described in the previous example.
- Study III—Diabetes is also induced by the transfer of activated CD4+CD62L+CD25-BDC2.5 T cells (transgenic for TCR recognizing islet specific peptide 1040-p31 activated by incubation with 1040-p31) to NOD recipients. Mice are treated with any one of C1ORF32 protein fragments and/or fusion proteins thereof, control mIgG2a or positive control. Treatments begin 1 day following transfer. Mice are followed for glucose levels 10-28 days post transfer (Bour-Jordan et al., J Clin Invest. 2004; 114(7):979-87).
- Seven days post treatment pancreas, spleen, pancreatic LN and peripheral lymph node cells are extracted and examined for different immune cell populations. In addition, recall responses are measured by testing ex-vivo proliferation and cytokine secretion in response to p31 peptide. C1ORF32 protein fragments and/or fusion proteins thereof prevent or reduce disease onset or the severity thereof in the above studies.
- The Effect of Any One Oof C1ORF32 Protein Fragments and/or Fusion Proteins Thereof in Lupus Mouse Models
- Study I: The lupus-prone mouse model, (NZB×NZW)F1 (B/W) is used. Cyclophosphamide (CTX) is the primary drug used for diffuse proliferative glomerulonephritis in patients with renal lupus, Daikh and Wofsy reported that combination treatment with CTX and CTLA4-Ig was more effective than either agent alone in reducing renal disease and prolonging survival of NZB/NZW Fl lupus mice with advanced nephritis (Daikh and Wofsy, J Immunol, 166(5):2913-6 (2001)). In the proof-of-concept study, treatments with any one of C1ORF32 protein fragments and/or fusion proteins thereof and CTX either alone or in combination are tested.
- Blood samples are collected 3 days before the protein treatment and then every other week during and after treatments for plasma anti-dsDNA autoantibody analysis by ELISA. Glomerulonephritis is evaluated by histological analysis of kidneys. Proteinuria is measured by testing fresh urine samples using urinalysis dipsticks.
- C1ORF32 protein fragments and/or fusion proteins thereof have a beneficial effect in at least ameliorating lupus nephtiris.
- Study II: The NZM2410-derived B6.Slel.S1e2.S1e3 mouse model of SLE is used. NZM2410 is a recombinant inbred strain produced from NZB and NZW that develops a highly penetrant lupus-like disease with an earlier onset of disease (Blenman et al 2006 Lab. Invest. 86: 1136-1148). The effect of any one of C1ORF32 protein fragments and/or fusion proteins thereof is studied in this model by assessment of proteinuria and autoantibodies as described above.
- Study III: An induced lupus model is used.This model is based on chronic graft-vs-host (cGVH) disease induced by the transfer of Ia-incompatible spleen cells from one normal mouse strain (such as B6.C-H2(bm12)/KhEg (bm12)) to another (such as C57BL/6), which causes an autoimmune syndrome resembling systemic lupus erythematosus (SLE), including anti-double-stranded DNA (anti-dsDNA) autoantibodies and immune complex-type proliferative glomerulonephritis (Appleby et al Clin. Exp. Immunol. 1989 78: 449-453); Eisenberg and Choudhury 2004 Methods Mol. Med. 102:273-284).
- Lupus is induced in this model following injection of spleen cells from bm12 mice into C57BL/6 recipients. The effect any one of C1ORF32 protein fragments and/or fusion proteins thereof is studied in this model by assessment of proteinuria and autoantibodies as described above. T cell and responses B cell responses will also be evaluated.
- Study IV: The MRL/lpr lupus prone mouse model is used. The effect of any one of C1ORF32 protein fragments and/or fusion proteins thereof is studied in this model by assessment of proteinuria and autoantibodies as described above.
- The Effect of Any of C1ORF32 Protein Fragments and/or Fusion Proteins Thereof in the Control of Intestinal Inflammation
- An adoptive transfer mouse model of colitis in mice is used, whereby Transfer of CD45RBhigh−CD4+ naïve T cells from BALB/c mice to syngeneic SCID mice leads to the development of an IBD-like syndrome by 6-10 wks after T cell reconstitution, similar to human Crohn's disease.
- SCID mice are reconstituted by i.p. injection of syngeneic CD45RBhigh-CD4+ T cells either alone or cotransferred with syngeneic CD45RBlow-CD4+ or CD25+CD4+ cells (4×105/mouse of each cell population) (Liu et al., J Immunol. 2001; 167(3): 1830-8). Colitic SCID mice, reconstituted with syngeneic CD45RBhighCD4+ T cells from spleen of normal mice, are treated i.p. with any one of C1ORF32 protein fragments and/or fusion proteins thereof or Ig isotype control, twice a week starting at the beginning of T cell transfer up to 8 wk. All mice are monitored weekly for weight, soft stool or diarrhea, and rectal prolapse. All mice are sacrificed 8 wk after T cell transfer or when they exhibit a loss of.20% of original body weight. Colonic tissues are collected for histologic and cytologic examinations. C1ORF32 protein fragments and/or fusion proteins thereof have a beneficial effect in at least ameliorating inflammatory bowel disease.
- The Effect of Any One of C1ORF32 Protein Fragments and/or Fusion Proteins Thereof in Mouse Model of Psoriasis
- Human psoriasis plaques are transplanted on to the SCID mice. Shave biopsies (2.5_2.5 cm) are taken from patients with generalized plaque psoriasis involving 5-10% of the total skin that did not receive any systemic treatment for psoriasis or phototherapy for 6 months and did not receive any topical preparations other than emollients for 6 weeks. The biopsies are obtained from active plaques located on the thigh or arm. Each piece of biopsy is divided into four equal parts of approximately 1 cm2 size. Each piece is transplanted to a separate mouse.
- Under general anesthesia, a graft bed of approximately 1 cm2 is created on the shaved area of the back of a 7- to 8-week-old CB17 SCID mouse by removing a full-thickness skin sample, keeping the vessel plexus intact on the fascia covering the underlying back muscles. The partial thickness human skin obtained by shave biopsy is then orthotopically transferred onto the graft bed. Nexaband, a liquid veterinary bandage (Veterinary Products Laboratories, Phoenix, Ariz.) is used to attach the human skin to the mouse skin and an antibiotic ointment (bacitracin) is applied. Mice are treated intraperitoneally three times per week for 4 weeks with any one of C1ORF32 protein fragments and/or fusion proteins thereof, isotype control or CTLA4-Ig (positive control).
- Punch biopsies (2 mm) are obtained on day 0 (before treatment) and day 28 (after treatment) of the study period. Biopsies are snap frozen and cryosections for histopathological and immunohistochemical studies. Therapeutic efficacy is determined by comparing pre- and post treatment data: (i) rete peg lengths to determine the effect on epidermal thickness and (ii) the level of lymphomononuclear cell infiltrates to determine the effect on inflammatory cellular infiltrates. (Raychaudhuri et al. 2008, J Invest Dermatol.;128(8):1969-76; Boehncke et al., 1999 Arch Dermatol Res 291:104-6).
- C1ORF32 protein fragments and/or fusion proteins thereof have a beneficial effect in at least ameliorating psoriasis.
- Study II: The Effect of Any One of C1ORF32 Protein Fragments and/or Fusion Proteins Thereof in Psoriasis and Colitis Model by Adoptive Transfer of CD45RB in CD4+ T Cells in SCID Mice
- Immunocompromised mice are injected intraveneously (i.v.) with 0.3_106 CD4+ CD45RBhi cells. On the day following the adoptive transfer of cells, mice are injected intraperitoneally (i.p.) with 10 microg of staphylococcal enterotoxin B (Davenport et al., Int Immunopharmacol. 2002 Apr.; 2(5):653-72). Recipient mice are treated with any one of C1ORF32 protein fragments and/or fusion proteins thereof, isotype control or CTLA4-Ig (positive control). Mice are evaluated once a week for 8 weeks for weight loss and presence of skin lesions.
- The Effect of Any One of C1ORF32 Protein Fragments and/or Fusion Proteins Thereof in Modulating Transplant Rejection
- Study I: T
HE EFFECT OF any one of C1ORF32 protein fragments and/or fusion proteins thereofIN A MODEL OF ALLOGENEIC ISLET TRANSPLANTATION IN DIABETIC MICE . To test the effect of any one of C1ORF32 protein fragments and/or fusion proteins thereof on transplant rejection, a model of allogeneic islet transplantation is used. Diabetes is induced in C57BL/6 mice by treatment with streptozotocin. Seven days later, the mice are transplanted under the kidney capsule with pancreatic islets which are isolated from BALB/c donor mice. Recipient mice are treated with any one of C1ORF32 protein fragments and/or fusion proteins thereof or with mIgG2a as a negative control. Tolerance with ECDI-fixed donor splenocytes is used as the positive control for successful modulation islet graft rejection. Recipient mice are monitored for blood glucose levels as a measure of graft acceptance/rejection (Luo et al., PNAS, Sep. 23, 2008_vol. 105_no. 38_14527-14532). - Study II: T
HE EFFECT OF any one of C1ORF32 protein fragments and/or fusion proteins thereofIN THE HYA-MODEL OF SKIN GRAFT REJECTION. In humans and certain strains of laboratory mice, male tissue is recognized as non-self and destroyed by the female immune system via recognition of histocompatibility-Y chromosome encoded antigens (Hya). Male tissue destruction is thought to be accomplished by cytotoxic T lymphocytes in a helper-dependent manner - To test the effect of any one of C1ORF32 protein fragments and/or fusion proteins thereof on transplanatation, the Hya model system is used, in which female C57BL/6 mice receive tail skin grafts from male C57BL/6 donors.
- In this study, female C57BL/6 mice are engrafted with orthotopic split-thickness tail skin from age matched male C57BL/6 mice. The mice are treated with any one of C1ORF32 protein fragments and/or fusion proteins thereof, isotype control mIgG2a Immunodominant Hya-encoded CD4 epitope (Dby) attached to female splenic leukocytes (Dby-SP) serve as positive control for successful modulation of graft rejection (Martin et al., J Immunol. 2010 Sep. 15; 185(6): 3326-3336). Skin grafts are scored daily for edema, pigment loss and hair loss. Rejection is defined as complete hair loss and more than 80% pigment loss.
- In addition, T cell recall responses of cells isolated from spleens and draining lymph nodes at different time points are studied in response to CD4 specific epitope (Dby), CD8 epitopes (Uty and Smcy) or irrelevant peptide (OVA 323-339) while anti CD3 stimulation is used as positive control for prolifereation and cytokine secretion.
- Study III: The effect of any one of C1ORF32 protein fragments and/or fusion proteins thereof on graft rejection is studied in a murine model of syngeneic bone marrow cells transplantation using the Hya model system described above. Male hematopoietic cells expressing the CD45.1 marker are transplanted to female host mice which express the CD45.2 congenic marker. Female hosts are treated with any one of C1ORF32 protein fragments and/or fusion proteins thereof or with isotype control mIgG2a. The female hosts are followed over time and the presence of CD45.1+ cells is monitored.
- The Effect of C1ORF32 Protein Fragments and/or Fusion Proteins Thereof in Treatemnt of Alopecia Areata
- To induce alopecia areata (AA), lesional skin from C3H/HeJ mice that had developed spontaneous AA lesions is grafted onto the back of non-affected C3H/HeJ mice, as described previously (McElwee et al., 1998). Breifly, up to six grafts ˜1-1.5cm in diameter are aseptically removed from each donor by pinch cutting. The grafts are placed in sterile PBS while the recipient mice are prepared for transplantation. Recipient mice are anestized and a circular pice of skin ˜1.5 cm in diameter is aseptically removed from the dorsal anto-posterior midline and replaced with a donor skin graft. The graft is oriented 180° from normal in order to have the hair growing in opposite direction to the reciepient hair for easy identification. Four to seven weeks after grafting the recipients develop initial hair loss. Recipient mice are treated with any one of C1ORF32 protein fragments and/or fusion proteins thereof, isotype control or CTLA4-Ig (positive control). Morphological changes are examined and documented daily. Photographs are taken before treatment, and once per week during and after treatment. After completion of treatment, all mice are anesthesized , their dorsal skin is shaved and animals are sacrificed by cervical dislocation. Skin samples are taken for histopathological examination and immunohistochemistry.
- It will be appreciated that various features of the invention which are, for clarity, described in the contexts of separate embodiments may also be provided in combination in a single embodiment. Conversely, various features of the invention which are, for brevity, described in the context of a single embodiment may also be provided separately or in any suitable sub-combination. It will also be appreciated by persons skilled in the art that the present invention is not limited by what has been particularly shown and described hereinabove.
Claims (28)
1. A fusion protein comprising an isolated polypeptide fused to a heterologous sequence, directly or indirectly via a linker peptide, a polypeptide sequence or a chemical linker wherein the amino acid sequence of said fusion protein is set forth in SEQ ID NO: 38, 39, 108-112, 116-190.
2. The fusion protein of claim 2 , wherein the amino acid sequence is set forth in any of SEQ ID NOs: 118 or 122.
3. A pharmaceutical composition comprising a fusion protein of any of claims 2 -3 , and a pharmaceutically acceptable diluent or carrier, adapted for treatment of any immune related disorder and infectious disorder.
4. A method for treating an immune related disorder or an infectious disorder in a subject in need thereof, comprising administering to the subject an effective amount of the fusion protein of claim 1 or pharmaceutical composition thereof.
5. The method of 4, wherein administering an effective amount of the fusion protein-or pharmaceutical composition thereof to the subject inhibits or reduces differentiation of, proliferation of, activity of, and/or cytokine production and/or secretion by an immune cell selected from the group consisting of Thl, Thl7, and/or Th22, other cells that secrete, or cells that cause other cells to secrete, inflammatory molecules.
6. The method of 4, wherein the fusion protein or pharmaceutical composition thereof is administered in an effective amount to inhibit or reduce differentiation of, proliferation of, activity of, and/or cytokine production and/or secretion by Thl, Thl7 and/or Th22 cells.
7. The method of claim 4 , wherein the fusion protein or pharmaceutical composition thereof is administered in an effective amount to enhance the suppressive or immunomodulatory effect of Tregs and/or Th2 cells on Thl or Thl 7 cells.
8. The method of claim 4 , wherein the fusion protein or pharmaceutical composition thereof is administered in an effective amount to promote or enhance IL-10 production.
9. The method of claim 4 , wherein the fusion protein or pharmaceutical composition thereof is administered in an effective amount to increase cell numbers or increase populations of any of Tregs and/or Th2 cells.
10. The method of claim 4 , wherein the fusion protein or pharmaceutical composition thereof is administered in an effective amount to inhibit the Th1 and/or Th1 7 pathways and to enhance the activity of Tregs and/or Th2 cells on the Thl and Thl 7 pathways and/or to promote or enhance IL-10 secretion.
11. The method of claim 4 , wherein the fusion protein or pharmaceutical composition thereof is administered in an effective amount for reducing proinflammatory molecule production in a subject.
12. The method according to claim 4 further comprising administering a second therapeutic agent effective for treatment of said immune related disorder and/or infectious disorder.
13. The method according to claim 4 , wherein the immune related disorder is selected from the group consisting of autoimmune disease and immune disorder associated with graft transplantation rejection, and wherein the infectious disorder is selected from the disease caused by bacterial infection, viral infection, fungal infection and/or other parasite infection.
14. The method according to claim 13 , wherein the immune disorder associated with graft transplantation rejection is selected from the group consisting of acute and chronic rejection of organ transplantation, allogeneic stem cell transplantation, autologous stem cell transplantation, bone marrow transplantation, and graft versus host disease.
15. The method according to claim 13 , wherein the autoimmune disease is selected from the group consisting of multiple sclerosis, rheumatoid arthritis; psoriatic arthritis, discoid lupus erythematosus, systemic lupus erythematosus (SLE); ulcerative colitis; Crohn's disease; benign lymphocytic angiitis, autoimmune lymphoproliferative syndrome, sarcoidosis, autoimmune thrombocytopenic purpura, idiopathic thrombocytopenic purpura, pure red cell aplasia, Sjogren's syndrome, rheumatic disease, polymyalgia rheumatica, mixed connective tissue disease, inflammatory rheumatism, degenerative rheumatism, extra-articular rheumatism, juvenile arthritis, juvenile rheumatoid arthritis, systemic juvenile idiopathic arthritis, arthritis uratica, muscular rheumatism, chronic polyarthritis, reactive arthritis, Reiter's syndrome, rheumatic fever, relapsing polychondritis, Raynaud's phenomenon, vasculitis, cryoglobulinemic vasculitis, ANCA-associated vasculitis, temporal arteritis, giant cell arteritis, Takayasu arteritis, Behcet's disease, antiphospholipid syndrome, myasthenia gravis, autoimmune haemolytic anaemia, Guillain-Barre syndrome, chronic immune polyneuropathy, chronic inflammatory demyelinating polyneuropathy, autoimmune thyroiditis, insulin dependent diabetes mellitus, type I diabetes, Addison's disease, membranous glomerulonephropathy, polyglandular autoimmune syndromes, Goodpasture's disease, autoimmune gastritis, autoimmune atrophic gastritis, pernicious anaemia,pemphigus, pemphigus vulgaris, cirrhosis, primary biliary cirrhosis, idiopathic pulmonary fibrosis, myositis, dermatomyositis, juvenile dermatomyositis, polymyositis, fibromyositis, myogelosis, celiac disease, celiac sprue dermatitis, immunoglobulin A nephropathy, Henoch-Schonlein purpura, Evans syndrome, atopic dermatitis, psoriasis, psoriasis vulgaris, psoriasis arthropathica, Graves' disease, Graves' ophthalmopathy, scleroderma, systemic scleroderma, progressive systemic scleroderma, diffuse scleroderma, localized scleroderma, Crest syndrome, asthma, allergic asthma, allergy, primary biliary cirrhosis, Hashimoto's thyroiditis, fibromyalgia, chronic fatigue and immune dysfunction syndrome (CFIDS), primary myxedema, sympathetic ophthalmia, autoimmune inner ear disease, autoimmune uveitis, autoimmune chronic active hepatitis, collagen diseases, ankylosing spondylitis, periarthritis humeroscapularis, panarteritis nodosa, polyarteritis nodosa, chondrocalcinosis, Wegener's granulomatosis, microscopic polyangiitis, chronic urticaria, bullous skin disorders, pemphigoid, bullous pemphigoid, cicatricial pemphigoid, vitiligo, atopic eczema, eczema, chronic urticaria, autoimmune urticaria, normocomplementemic urticaria! vasculitis, hypocomplementemic urticaria! vasculitis, alopecia areata, alopecia universalis, alopecia totalis, Devic's disease, pernicious anemia, childhood autoimmune hemolytic anemia, idiopathic autoimmune hemolytic anemia, refractory or chronic Autoimmune Cytopenias, Prevention of development of Autoimmune Anti-Factor VIII Antibodies in Acquired Hemophilia A, Cold agglutinin disease, Neuromyelitis Optica, Stiff Person Syndrome, gingivitis, periodontitis, pancreatitis, myocarditis, gastritis, gout, gouty arthritis, idiopathic pericarditis, anti-synthetase syndrome, scleritis, macrophage activation syndrome, PAPA Syndrome, Blau's Syndrome, adult and juvenile Still's disease, cryopyrin associated periodic syndrome, Muckle-Wells syndrome, familial cold auto-inflammatory syndrome, neonatal onset multisystem inflammatory disease, chronic infantile neurologic cutaneous and articular syndrome, familial Mediterranean fever, Hyper IgD syndrome, Schnitzler's syndrome, autoimmune retinopathy, age-related macular degeneration, and TNF receptor-associated periodic syndrome (TRAPS).
16. The method according to claim 13 , wherein the autoimmune disease is selected from the group consisting of multiple sclerosis, rheumatoid arthritis, type I diabetes, psoriasis, atopic dermatitis, psoriasis vulgaris, psoriasis arthropathica, systemic lupus erythematosus, inflammatory bowel disease, uveitis, ulcerative colitis; Crohn's disease, and Sjogren's syndrome.
17. The method according to claim 16 , wherein the multiple sclerosis is selected from the group consisting of benign multiple sclerosis, relapsing remitting multiple sclerosis, secondary progressive multiple sclerosis, primary progressive multiple sclerosis, chronic progressive multiple sclerosis, transitional/progressive multiple sclerosis, progressive relapsing multiple sclerosis, rapidly worsening multiple sclerosis, clinically-definite multiple sclerosis, malignant multiple sclerosis, also known as Marburg's Variant, acute multiple sclerosis and condition relating to multiple sclerosis, selected from the group consisting of Devic's disease, also known as Neuromyelitis Optica; acute disseminated encephalomyelitis, acute demyelinating optic neuritis, demyelinative transverse myelitis, Miller-Fisher syndrome, encephalomyelradiculoneuropathy, acute demyelinative polyneuropathy, tumefactive multiple sclerosis and Balo's concentric sclerosis.
18. The method according to claim 16 , wherein the rheumatoid arthritis is selected from the group consisting of rheumatoid arthritis, gout and pseudo-gout, juvenile idiopathic arthritis, juvenile rheumatoid arthritis, Still's disease, ankylosing spondylitis, rheumatoid vasculitis, and conditions relating to rheumatoid arthritis, selected from the group consisting of osteoarthritis, sarcoidosis, Henoch-Schonlein purpura, Psoriatic arthritis, Reactive arthritis, Spondyloarthropathy, septic arthritis, Haemochromatosis, Hepatitis, vasculitis, Wegener's granulomatosis, Lyme disease, Familial Mediterranean fever, Hyperimmunoglobulinemia D with recurrent fever, TNF receptor associated periodic syndrome, and Enteropathic arthritis associated with inflammatory bowel disease.
19. The method according to claim 16 , wherein the uveitis is selected from the group consisting of anterior uveitis, iridocyclitis, intermediate uveitis pars planitis, posterior uveitis, chorioretinitis and the panuveitis form.
20. The method according to claim 16 , wherein the inflammatory bowel disease is selected from the group consisting of Crohn's disease and ulcerative colitis (UC) and conditions relating to IBD selected from the group consisting of Collagenous colitis, Lymphocytic colitis, Ischaemic colitis, Diversion colitis, Beçhet's disease, Indeterminate colitis.
21. The method according to claim 16 , wherein the psoriasis is selected from the group consisting of Nonpustular Psoriasis including Psoriasis vulgaris and Psoriatic erythroderma, erythrodermic psoriasis, Pustular psoriasis including Generalized pustular psoriasis, pustular psoriasis of von Zumbusch, Pustulosis palmaris et plantaris, persistent palmoplantar pustulosis, pustular psoriasis of the Barber type, pustular psoriasis of the extremities, Annular pustular psoriasis, Acrodermatitis continua, Impetigo herpetiformis, conditions relating to psoriasis include, drug-induced psoriasis, Inverse psoriasis, Napkin psoriasis, Seborrheic-like psoriasis, Guttate psoriasis, Nail psoriasis, and Psoriatic arthritis.
22. The method according to claim 16 , wherein the diabetes is selected from the group consisting of insulin-dependent diabetes mellitus, idiopathic diabetes, juvenile type 1 diabetes, maturity onset diabetes of the young, latent autoimmune diabetes in adults, gestational diabetes, and condition relating to type 1 diabetes selected from the group consisting of neuropathy including polyneuropathy, mononeuropathy, peripheral neuropathy and autonomicneuropathy; eye complications: glaucoma, cataracts, retinopathy.
23. The method according to claim 16 , wherein the Sjogren's syndrome is selected from the group consisting of Primary Sjogren's syndrome and Secondary Sjogren's syndrome and condition relating to Sjogren's syndrome selected from the group consisting of connective tissue disease, such as rheumatoid arthritis, systemic lupus erythematosus, or scleroderma.
24. The method according to claim 16 , wherein the systemic lupus erythematosus is selected from the group consisting of discoid lupus, lupus arthritis, lupus pneumonitis, lupus nephritis, and condition relating to systemic lupus erythematosus, selected from the group consisting of osteoarticular tuberculosis, antiphospholipid antibody syndrome, inflammation of various parts of the heart, selected from the group pericarditis, myocarditis, and endocarditis, Lung and pleura inflammation, pleuritis, pleural effusion, chronic diffuse interstitial lung disease, pulmonary hypertension, pulmonary emboli, pulmonary hemorrhage, and shrinking lung syndrome, lupus headache, Guillain-Barre syndrome, aseptic meningitis, demyelinating syndrome, mononeuropathy, mononeuritis multiplex, myasthenia gravis, myelopathy, cranial neuropathy, polyneuropathy, and vasculitis.
25. The method according to claim 4 , wherein the treating comprises treatment of immune related disorder without global immunosuppression.
26. The method of claim 4 , wherein the subject does not respond to treatment with TNF blockers.
27. A method for treating an immune related disorder or an infectious disorder in a subject in need thereof, comprising administering to the subject an effective amount of the fusion protein of claim 2 or pharmaceutical composition thereof.
28. The method of 28, wherein administering an effective amount of the fusion protein to the subject inhibits or reduces differentiation of, proliferation of, activity of, and/or cytokine production and/or secretion by an immune cell selected from the group consisting of Thl, Thl7, and/or Th22, other cells that secrete, or cells that cause other cells to secrete, inflammatory molecules.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US16/951,130 US20220315641A9 (en) | 2011-06-30 | 2020-11-18 | Polypeptides and uses thereof for treatment of autoimmune disorders and infection |
Applications Claiming Priority (7)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201161502880P | 2011-06-30 | 2011-06-30 | |
US201161581201P | 2011-12-29 | 2011-12-29 | |
PCT/IB2012/053342 WO2013001517A1 (en) | 2011-06-30 | 2012-07-01 | Polypeptides and uses thereof for treatment of autoimmune disorders and infection |
US201314129974A | 2013-12-29 | 2013-12-29 | |
US15/055,960 US20160304579A1 (en) | 2011-06-30 | 2016-02-29 | Polypeptides and uses thereof for treatment of autoimmune disorders and infection |
US15/966,694 US20190248866A1 (en) | 2011-06-30 | 2018-04-30 | Polypeptides and uses thereof for treatment of autoimmune disorders and infection |
US16/951,130 US20220315641A9 (en) | 2011-06-30 | 2020-11-18 | Polypeptides and uses thereof for treatment of autoimmune disorders and infection |
Related Parent Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US15/966,694 Continuation US20190248866A1 (en) | 2011-06-30 | 2018-04-30 | Polypeptides and uses thereof for treatment of autoimmune disorders and infection |
Publications (2)
Publication Number | Publication Date |
---|---|
US20210253667A1 true US20210253667A1 (en) | 2021-08-19 |
US20220315641A9 US20220315641A9 (en) | 2022-10-06 |
Family
ID=47423498
Family Applications (4)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US14/129,974 Active 2032-10-03 US9428574B2 (en) | 2011-06-30 | 2012-07-01 | Polypeptides and uses thereof for treatment of autoimmune disorders and infection |
US15/055,960 Abandoned US20160304579A1 (en) | 2011-06-30 | 2016-02-29 | Polypeptides and uses thereof for treatment of autoimmune disorders and infection |
US15/966,694 Abandoned US20190248866A1 (en) | 2011-06-30 | 2018-04-30 | Polypeptides and uses thereof for treatment of autoimmune disorders and infection |
US16/951,130 Abandoned US20220315641A9 (en) | 2011-06-30 | 2020-11-18 | Polypeptides and uses thereof for treatment of autoimmune disorders and infection |
Family Applications Before (3)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US14/129,974 Active 2032-10-03 US9428574B2 (en) | 2011-06-30 | 2012-07-01 | Polypeptides and uses thereof for treatment of autoimmune disorders and infection |
US15/055,960 Abandoned US20160304579A1 (en) | 2011-06-30 | 2016-02-29 | Polypeptides and uses thereof for treatment of autoimmune disorders and infection |
US15/966,694 Abandoned US20190248866A1 (en) | 2011-06-30 | 2018-04-30 | Polypeptides and uses thereof for treatment of autoimmune disorders and infection |
Country Status (6)
Country | Link |
---|---|
US (4) | US9428574B2 (en) |
EP (1) | EP2726503B1 (en) |
AU (1) | AU2012277376B2 (en) |
CA (1) | CA2836855C (en) |
IL (1) | IL229858B (en) |
WO (1) | WO2013001517A1 (en) |
Families Citing this family (11)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
SI2769729T1 (en) * | 2007-09-04 | 2019-06-28 | Compugen Ltd. | Polypeptides and polynucleotides, and uses thereof as a drug target for producing drugs and biologics |
EP2629797B1 (en) | 2010-10-19 | 2018-05-23 | The Regents of the University of Colorado, A Body Corporate | Peptides for modulating t-cell activity and uses thereof |
BR112014018481A2 (en) | 2012-02-01 | 2017-07-04 | Compugen Ltd | monoclonal or polyclonal antibody or antigen-binding fragment thereof, polynucleotide, monoclonal antibody, vector, hybridoma, antibody, hybridoma 5166-2 and / or 5166-9, antigen-binding antibody or fragment, pharmaceutical composition, antibody use or antibody binding fragment, method for treating cancer, method for diagnosing cancer in an individual, antibody, method, composition or use |
EP3185885B1 (en) * | 2014-08-26 | 2020-08-19 | Compugen Ltd. | Polypeptides and uses thereof as a drug for treatment of autoimmune disorders |
KR102630014B1 (en) | 2014-10-01 | 2024-01-25 | 더 제너럴 하스피탈 코포레이션 | Methods for increasing efficiency of nuclease-induced homology-directed repair |
NZ746741A (en) * | 2016-04-15 | 2023-12-22 | Alpine Immune Sciences Inc | Icos ligand variant immunomodulatory proteins and uses thereof |
US20210139920A1 (en) * | 2017-08-21 | 2021-05-13 | Indiana University Research And Technology Corporation | Solubility enhancing protein expression systems |
TW201925223A (en) | 2017-10-18 | 2019-07-01 | 美商艾爾潘免疫科學有限公司 | Variant ICOS ligand immunomodulatory proteins and related compositions and methods |
WO2019105972A1 (en) * | 2017-11-30 | 2019-06-06 | Bayer Aktiengesellschaft | Ildr2 antagonists and combinations thereof |
WO2020138868A1 (en) * | 2018-12-24 | 2020-07-02 | 서울대학교산학협력단 | Type 1 interferon neutralizing fc-fusion protein and use thereof |
US11793854B2 (en) * | 2019-03-21 | 2023-10-24 | Op-T Llc | Methods for reducing symptoms of multiple sclerosis using a six-amino acid long peptide that inhibits CD40-CD150 interaction |
Family Cites Families (192)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5623A (en) | 1848-06-06 | Improvement in propellers | ||
US70A (en) | 1836-10-27 | Apparatus for preserving and exhibiting maps | ||
US3687808A (en) | 1969-08-14 | 1972-08-29 | Univ Leland Stanford Junior | Synthetic polynucleotides |
US4634665A (en) | 1980-02-25 | 1987-01-06 | The Trustees Of Columbia University In The City Of New York | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
US5179017A (en) | 1980-02-25 | 1993-01-12 | The Trustees Of Columbia University In The City Of New York | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
US4399216A (en) | 1980-02-25 | 1983-08-16 | The Trustees Of Columbia University | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
US4376110A (en) | 1980-08-04 | 1983-03-08 | Hybritech, Incorporated | Immunometric assays using monoclonal antibodies |
US4366241A (en) | 1980-08-07 | 1982-12-28 | Syva Company | Concentrating zone method in heterogeneous immunoassays |
US4469863A (en) | 1980-11-12 | 1984-09-04 | Ts O Paul O P | Nonionic nucleic acid alkyl and aryl phosphonates and processes for manufacture and use thereof |
US4517288A (en) | 1981-01-23 | 1985-05-14 | American Hospital Supply Corp. | Solid phase system for ligand assay |
US4475196A (en) | 1981-03-06 | 1984-10-02 | Zor Clair G | Instrument for locating faults in aircraft passenger reading light and attendant call control system |
US4447233A (en) | 1981-04-10 | 1984-05-08 | Parker-Hannifin Corporation | Medication infusion pump |
US5023243A (en) | 1981-10-23 | 1991-06-11 | Molecular Biosystems, Inc. | Oligonucleotide therapeutic agent and method of making same |
US4439196A (en) | 1982-03-18 | 1984-03-27 | Merck & Co., Inc. | Osmotic drug delivery system |
US4476301A (en) | 1982-04-29 | 1984-10-09 | Centre National De La Recherche Scientifique | Oligonucleotides, a process for preparing the same and their application as mediators of the action of interferon |
US4522811A (en) | 1982-07-08 | 1985-06-11 | Syntex (U.S.A.) Inc. | Serial injection of muramyldipeptides and liposomes enhances the anti-infective activity of muramyldipeptides |
US4447224A (en) | 1982-09-20 | 1984-05-08 | Infusaid Corporation | Variable flow implantable infusion apparatus |
US4487603A (en) | 1982-11-26 | 1984-12-11 | Cordis Corporation | Implantable microinfusion pump system |
US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
US4486194A (en) | 1983-06-08 | 1984-12-04 | James Ferrara | Therapeutic device for administering medicaments through the skin |
EP0154316B1 (en) | 1984-03-06 | 1989-09-13 | Takeda Chemical Industries, Ltd. | Chemically modified lymphokine and production thereof |
US5550111A (en) | 1984-07-11 | 1996-08-27 | Temple University-Of The Commonwealth System Of Higher Education | Dual action 2',5'-oligoadenylate antiviral derivatives and uses thereof |
US4837306A (en) | 1985-02-25 | 1989-06-06 | The Ontario Cancer Institute | Method for selecting hybridomas producing antibodies specific to the P-glycoprotein cell suface antigen and a cDNA clone encoding the C-terminal portion of the antigen |
US5185444A (en) | 1985-03-15 | 1993-02-09 | Anti-Gene Deveopment Group | Uncharged morpolino-based polymers having phosphorous containing chiral intersubunit linkages |
US5166315A (en) | 1989-12-20 | 1992-11-24 | Anti-Gene Development Group | Sequence-specific binding polymers for duplex nucleic acids |
US5235033A (en) | 1985-03-15 | 1993-08-10 | Anti-Gene Development Group | Alpha-morpholino ribonucleoside derivatives and polymers thereof |
US5405938A (en) | 1989-12-20 | 1995-04-11 | Anti-Gene Development Group | Sequence-specific binding polymers for duplex nucleic acids |
US5034506A (en) | 1985-03-15 | 1991-07-23 | Anti-Gene Development Group | Uncharged morpholino-based polymers having achiral intersubunit linkages |
US4596556A (en) | 1985-03-25 | 1986-06-24 | Bioject, Inc. | Hypodermic injection apparatus |
US5374548A (en) | 1986-05-02 | 1994-12-20 | Genentech, Inc. | Methods and compositions for the attachment of proteins to liposomes using a glycophospholipid anchor |
MX9203291A (en) | 1985-06-26 | 1992-08-01 | Liposome Co Inc | LIPOSOMAS COUPLING METHOD. |
CA1291031C (en) | 1985-12-23 | 1991-10-22 | Nikolaas C.J. De Jaeger | Method for the detection of specific binding agents and their correspondingbindable substances |
GB8601597D0 (en) | 1986-01-23 | 1986-02-26 | Wilson R H | Nucleotide sequences |
EP0272253A4 (en) | 1986-03-07 | 1990-02-05 | Massachusetts Inst Technology | Method for enhancing glycoprotein stability. |
US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
DE122007000007I1 (en) | 1986-04-09 | 2007-05-16 | Genzyme Corp | Genetically transformed animals secreting a desired protein in milk |
US4954617A (en) | 1986-07-07 | 1990-09-04 | Trustees Of Dartmouth College | Monoclonal antibodies to FC receptors for immunoglobulin G on human mononuclear phagocytes |
US5260203A (en) | 1986-09-02 | 1993-11-09 | Enzon, Inc. | Single polypeptide chain binding molecules |
US4881175A (en) | 1986-09-02 | 1989-11-14 | Genex Corporation | Computer based system and method for determining and displaying possible chemical structures for converting double- or multiple-chain polypeptides to single-chain polypeptides |
US4946778A (en) | 1987-09-21 | 1990-08-07 | Genex Corporation | Single polypeptide chain binding molecules |
DE3883899T3 (en) | 1987-03-18 | 1999-04-22 | Sb2 Inc | CHANGED ANTIBODIES. |
US5013653A (en) | 1987-03-20 | 1991-05-07 | Creative Biomolecules, Inc. | Product and process for introduction of a hinge region into a fusion protein to facilitate cleavage |
US5264423A (en) | 1987-03-25 | 1993-11-23 | The United States Of America As Represented By The Department Of Health And Human Services | Inhibitors for replication of retroviruses and for the expression of oncogene products |
US5276019A (en) | 1987-03-25 | 1994-01-04 | The United States Of America As Represented By The Department Of Health And Human Services | Inhibitors for replication of retroviruses and for the expression of oncogene products |
US5258498A (en) | 1987-05-21 | 1993-11-02 | Creative Biomolecules, Inc. | Polypeptide linkers for production of biosynthetic proteins |
US5091513A (en) | 1987-05-21 | 1992-02-25 | Creative Biomolecules, Inc. | Biosynthetic antibody binding sites |
US5132405A (en) | 1987-05-21 | 1992-07-21 | Creative Biomolecules, Inc. | Biosynthetic antibody binding sites |
JPH02500329A (en) | 1987-05-21 | 1990-02-08 | クリエイテイブ・バイオマリキユールズ・インコーポレーテツド | Targeted multifunctional protein |
US4790824A (en) | 1987-06-19 | 1988-12-13 | Bioject, Inc. | Non-invasive hypodermic injection device |
US4941880A (en) | 1987-06-19 | 1990-07-17 | Bioject, Inc. | Pre-filled ampule and non-invasive hypodermic injection device assembly |
US4873316A (en) | 1987-06-23 | 1989-10-10 | Biogen, Inc. | Isolation of exogenous recombinant proteins from the milk of transgenic mammals |
GB8717430D0 (en) | 1987-07-23 | 1987-08-26 | Celltech Ltd | Recombinant dna product |
US5677425A (en) | 1987-09-04 | 1997-10-14 | Celltech Therapeutics Limited | Recombinant antibody |
US5188897A (en) | 1987-10-22 | 1993-02-23 | Temple University Of The Commonwealth System Of Higher Education | Encapsulated 2',5'-phosphorothioate oligoadenylates |
US4924624A (en) | 1987-10-22 | 1990-05-15 | Temple University-Of The Commonwealth System Of Higher Education | 2,',5'-phosphorothioate oligoadenylates and plant antiviral uses thereof |
JPH03503894A (en) | 1988-03-25 | 1991-08-29 | ユニバーシィティ オブ バージニア アランミ パテンツ ファウンデイション | Oligonucleotide N-alkylphosphoramidate |
GB8809129D0 (en) | 1988-04-18 | 1988-05-18 | Celltech Ltd | Recombinant dna methods vectors and host cells |
US5278302A (en) | 1988-05-26 | 1994-01-11 | University Patents, Inc. | Polynucleotide phosphorodithioates |
US5216141A (en) | 1988-06-06 | 1993-06-01 | Benner Steven A | Oligonucleotide analogs containing sulfur linkages |
US5476996A (en) | 1988-06-14 | 1995-12-19 | Lidak Pharmaceuticals | Human immune system in non-human animal |
US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
GB8823869D0 (en) | 1988-10-12 | 1988-11-16 | Medical Res Council | Production of antibodies |
CA2006596C (en) | 1988-12-22 | 2000-09-05 | Rika Ishikawa | Chemically-modified g-csf |
US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
US5225538A (en) | 1989-02-23 | 1993-07-06 | Genentech, Inc. | Lymphocyte homing receptor/immunoglobulin fusion proteins |
US5108921A (en) | 1989-04-03 | 1992-04-28 | Purdue Research Foundation | Method for enhanced transmembrane transport of exogenous molecules |
US5399676A (en) | 1989-10-23 | 1995-03-21 | Gilead Sciences | Oligonucleotides with inverted polarity |
US5264564A (en) | 1989-10-24 | 1993-11-23 | Gilead Sciences | Oligonucleotide analogs with novel linkages |
US5264562A (en) | 1989-10-24 | 1993-11-23 | Gilead Sciences, Inc. | Oligonucleotide analogs with novel linkages |
US5064413A (en) | 1989-11-09 | 1991-11-12 | Bioject, Inc. | Needleless hypodermic injection device |
US5312335A (en) | 1989-11-09 | 1994-05-17 | Bioject Inc. | Needleless hypodermic injection device |
US5177198A (en) | 1989-11-30 | 1993-01-05 | University Of N.C. At Chapel Hill | Process for preparing oligoribonucleoside and oligodeoxyribonucleoside boranophosphates |
US5587361A (en) | 1991-10-15 | 1996-12-24 | Isis Pharmaceuticals, Inc. | Oligonucleotides having phosphorothioate linkages of high chiral purity |
CA2050918A1 (en) | 1990-01-12 | 1991-07-13 | Raju Kucherlapati | Generation of xenogeneic antibodies |
US6673986B1 (en) | 1990-01-12 | 2004-01-06 | Abgenix, Inc. | Generation of xenogeneic antibodies |
US6075181A (en) | 1990-01-12 | 2000-06-13 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
US6150584A (en) | 1990-01-12 | 2000-11-21 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
US5283173A (en) | 1990-01-24 | 1994-02-01 | The Research Foundation Of State University Of New York | System to detect protein-protein interactions |
US5321131A (en) | 1990-03-08 | 1994-06-14 | Hybridon, Inc. | Site-specific functionalization of oligodeoxynucleotides for non-radioactive labelling |
US5470967A (en) | 1990-04-10 | 1995-11-28 | The Dupont Merck Pharmaceutical Company | Oligonucleotide analogs with sulfamate linkages |
US5427908A (en) | 1990-05-01 | 1995-06-27 | Affymax Technologies N.V. | Recombinant library screening methods |
US6172197B1 (en) | 1991-07-10 | 2001-01-09 | Medical Research Council | Methods for producing members of specific binding pairs |
GB9015198D0 (en) | 1990-07-10 | 1990-08-29 | Brien Caroline J O | Binding substance |
US5618704A (en) | 1990-07-27 | 1997-04-08 | Isis Pharmacueticals, Inc. | Backbone-modified oligonucleotide analogs and preparation thereof through radical coupling |
US5610289A (en) | 1990-07-27 | 1997-03-11 | Isis Pharmaceuticals, Inc. | Backbone modified oligonucleotide analogues |
US5489677A (en) | 1990-07-27 | 1996-02-06 | Isis Pharmaceuticals, Inc. | Oligonucleoside linkages containing adjacent oxygen and nitrogen atoms |
US5623070A (en) | 1990-07-27 | 1997-04-22 | Isis Pharmaceuticals, Inc. | Heteroatomic oligonucleoside linkages |
US5677437A (en) | 1990-07-27 | 1997-10-14 | Isis Pharmaceuticals, Inc. | Heteroatomic oligonucleoside linkages |
US5608046A (en) | 1990-07-27 | 1997-03-04 | Isis Pharmaceuticals, Inc. | Conjugated 4'-desmethyl nucleoside analog compounds |
US5602240A (en) | 1990-07-27 | 1997-02-11 | Ciba Geigy Ag. | Backbone modified oligonucleotide analogs |
US5541307A (en) | 1990-07-27 | 1996-07-30 | Isis Pharmaceuticals, Inc. | Backbone modified oligonucleotide analogs and solid phase synthesis thereof |
MY107332A (en) | 1990-08-03 | 1995-11-30 | Sterling Drug Inc | Compounds and methods for inhibiting gene expression. |
US5177196A (en) | 1990-08-16 | 1993-01-05 | Microprobe Corporation | Oligo (α-arabinofuranosyl nucleotides) and α-arabinofuranosyl precursors thereof |
US6255458B1 (en) | 1990-08-29 | 2001-07-03 | Genpharm International | High affinity human antibodies and human antibodies against digoxin |
US5877397A (en) | 1990-08-29 | 1999-03-02 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
US5661016A (en) | 1990-08-29 | 1997-08-26 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
ES2108048T3 (en) | 1990-08-29 | 1997-12-16 | Genpharm Int | PRODUCTION AND USE OF LOWER TRANSGENIC ANIMALS CAPABLE OF PRODUCING HETEROLOGICAL ANTIBODIES. |
US5874299A (en) | 1990-08-29 | 1999-02-23 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
US5633425A (en) | 1990-08-29 | 1997-05-27 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
WO1994025585A1 (en) | 1993-04-26 | 1994-11-10 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
US5625126A (en) | 1990-08-29 | 1997-04-29 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
US5770429A (en) | 1990-08-29 | 1998-06-23 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
US6300129B1 (en) | 1990-08-29 | 2001-10-09 | Genpharm International | Transgenic non-human animals for producing heterologous antibodies |
US5814318A (en) | 1990-08-29 | 1998-09-29 | Genpharm International Inc. | Transgenic non-human animals for producing heterologous antibodies |
US5789650A (en) | 1990-08-29 | 1998-08-04 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
US5214134A (en) | 1990-09-12 | 1993-05-25 | Sterling Winthrop Inc. | Process of linking nucleosides with a siloxane bridge |
US5561225A (en) | 1990-09-19 | 1996-10-01 | Southern Research Institute | Polynucleotide analogs containing sulfonate and sulfonamide internucleoside linkages |
US5596086A (en) | 1990-09-20 | 1997-01-21 | Gilead Sciences, Inc. | Modified internucleoside linkages having one nitrogen and two carbon atoms |
WO1992016622A1 (en) | 1991-03-12 | 1992-10-01 | Biogen, Inc. | Cd2-binding domain of lymphocyte function associated antigen 3 |
US5714331A (en) | 1991-05-24 | 1998-02-03 | Buchardt, Deceased; Ole | Peptide nucleic acids having enhanced binding affinity, sequence specificity and solubility |
US5719262A (en) | 1993-11-22 | 1998-02-17 | Buchardt, Deceased; Ole | Peptide nucleic acids having amino acid side chains |
US5539082A (en) | 1993-04-26 | 1996-07-23 | Nielsen; Peter E. | Peptide nucleic acids |
US5851795A (en) | 1991-06-27 | 1998-12-22 | Bristol-Myers Squibb Company | Soluble CTLA4 molecules and uses thereof |
US5571799A (en) | 1991-08-12 | 1996-11-05 | Basco, Ltd. | (2'-5') oligoadenylate analogues useful as inhibitors of host-v5.-graft response |
US5932448A (en) | 1991-11-29 | 1999-08-03 | Protein Design Labs., Inc. | Bispecific antibody heterodimers |
WO1993011236A1 (en) | 1991-12-02 | 1993-06-10 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
EP0746609A4 (en) | 1991-12-17 | 1997-12-17 | Genpharm Int | Transgenic non-human animals capable of producing heterologous antibodies |
US5714350A (en) | 1992-03-09 | 1998-02-03 | Protein Design Labs, Inc. | Increasing antibody affinity by altering glycosylation in the immunoglobulin variable region |
US5633360A (en) | 1992-04-14 | 1997-05-27 | Gilead Sciences, Inc. | Oligonucleotide analogs capable of passive cell membrane permeation |
EP0640094A1 (en) | 1992-04-24 | 1995-03-01 | The Board Of Regents, The University Of Texas System | Recombinant production of immunoglobulin-like domains in prokaryotic cells |
US5434257A (en) | 1992-06-01 | 1995-07-18 | Gilead Sciences, Inc. | Binding compentent oligomers containing unsaturated 3',5' and 2',5' linkages |
US5383851A (en) | 1992-07-24 | 1995-01-24 | Bioject Inc. | Needleless hypodermic injection device |
GB9223377D0 (en) | 1992-11-04 | 1992-12-23 | Medarex Inc | Humanized antibodies to fc receptors for immunoglobulin on human mononuclear phagocytes |
US5476925A (en) | 1993-02-01 | 1995-12-19 | Northwestern University | Oligodeoxyribonucleotides including 3'-aminonucleoside-phosphoramidate linkages and terminal 3'-amino groups |
GB9304618D0 (en) | 1993-03-06 | 1993-04-21 | Ciba Geigy Ag | Chemical compounds |
JPH08508491A (en) | 1993-03-31 | 1996-09-10 | スターリング ウインスロップ インコーポレイティド | Oligonucleotides with phosphodiester bonds replaced by amide bonds |
EP0714409A1 (en) | 1993-06-16 | 1996-06-05 | Celltech Therapeutics Limited | Antibodies |
US5625825A (en) | 1993-10-21 | 1997-04-29 | Lsi Logic Corporation | Random number generating apparatus for an interface unit of a carrier sense with multiple access and collision detect (CSMA/CD) ethernet data network |
US5625050A (en) | 1994-03-31 | 1997-04-29 | Amgen Inc. | Modified oligonucleotides and intermediates useful in nucleic acid therapeutics |
US5731168A (en) | 1995-03-01 | 1998-03-24 | Genentech, Inc. | Method for making heteromultimeric polypeptides |
US5869046A (en) | 1995-04-14 | 1999-02-09 | Genentech, Inc. | Altered polypeptides with increased half-life |
US6121022A (en) | 1995-04-14 | 2000-09-19 | Genentech, Inc. | Altered polypeptides with increased half-life |
US6113898A (en) | 1995-06-07 | 2000-09-05 | Idec Pharmaceuticals Corporation | Human B7.1-specific primatized antibodies and transfectomas expressing said antibodies |
US20020193567A1 (en) | 1995-08-11 | 2002-12-19 | Genetics Institute, Inc. | Secreted proteins and polynucleotides encoding them |
US6312921B1 (en) | 1996-07-26 | 2001-11-06 | Genetics Institute, Inc. | Secreted proteins and polynucleotides encoding them |
US6277375B1 (en) | 1997-03-03 | 2001-08-21 | Board Of Regents, The University Of Texas System | Immunoglobulin-like domains with increased half-lives |
US6982323B1 (en) | 1997-12-23 | 2006-01-03 | Alexion Pharmaceuticals, Inc. | Chimeric proteins for diagnosis and treatment of diabetes |
US6194551B1 (en) | 1998-04-02 | 2001-02-27 | Genentech, Inc. | Polypeptide variants |
DE69942021D1 (en) | 1998-04-20 | 2010-04-01 | Glycart Biotechnology Ag | GLYCOSYLATION ENGINEERING OF ANTIBODIES TO IMPROVE ANTIBODY-DEPENDENT CELL-EMITTED CYTOTOXICITY |
EP1080106A1 (en) | 1998-05-18 | 2001-03-07 | Genetics Institute, Inc. | Secreted proteins and polynucleotides encoding them |
GB9814640D0 (en) | 1998-07-06 | 1998-09-02 | Fujisawa Pharmaceutical Co | New use |
EP2386574A3 (en) | 1999-01-15 | 2012-06-27 | Genentech, Inc. | Polypeptide variants with altered effector function |
DK2270147T4 (en) | 1999-04-09 | 2020-08-31 | Kyowa Kirin Co Ltd | METHOD OF MONITORING THE ACTIVITY OF IMMUNOLOGICAL FUNCTIONAL MOLECULE |
WO2001000814A2 (en) | 1999-06-25 | 2001-01-04 | Universität Zürich | Hetero-associating coiled-coil peptides and screenign method therefor |
AU6058500A (en) | 1999-06-30 | 2001-01-31 | Center For Blood Research, The | Fusion protein and uses thereof |
EP1210372B1 (en) | 1999-07-29 | 2008-01-23 | Medarex, Inc. | Human monoclonal antibodies to her2/neu |
WO2001014424A2 (en) | 1999-08-24 | 2001-03-01 | Medarex, Inc. | Human ctla-4 antibodies and their uses |
US6303374B1 (en) | 2000-01-18 | 2001-10-16 | Isis Pharmaceuticals Inc. | Antisense modulation of caspase 3 expression |
AU2001253104A1 (en) | 2000-04-03 | 2001-10-15 | Gesellschaft Fur Biotechnologische Forschung Gmbh | Methods for altering t cell and macrophage activation |
WO2002026930A2 (en) | 2000-09-26 | 2002-04-04 | Human Genome Sciences, Inc. | Nucleic acids, proteins, and antibodies |
JP3523245B1 (en) | 2000-11-30 | 2004-04-26 | メダレックス,インコーポレーテッド | Transgenic chromosome-introduced rodents for the production of human antibodies |
US6551786B2 (en) | 2001-01-04 | 2003-04-22 | Myriad Genetics, Inc. | Screen assay for selecting protein-protein interaction modulators |
US7829084B2 (en) | 2001-01-17 | 2010-11-09 | Trubion Pharmaceuticals, Inc. | Binding constructs and methods for use thereof |
JP2004532038A (en) | 2001-05-17 | 2004-10-21 | ディヴァーサ コーポレイション | Application of novel antigen-binding molecules to therapeutic, diagnostic, prophylactic, enzymatic, industrial and agricultural fields, and methods for producing and screening novel antigen-binding molecules therefor |
CA2448123C (en) | 2001-05-24 | 2012-09-11 | Zymogenetics, Inc. | Taci-immunoglobulin fusion proteins |
US7189507B2 (en) | 2001-06-18 | 2007-03-13 | Pdl Biopharma, Inc. | Methods of diagnosis of ovarian cancer, compositions and methods of screening for modulators of ovarian cancer |
WO2003000012A2 (en) | 2001-06-21 | 2003-01-03 | Millennium Pharmaceuticals, Inc. | Compositions, kits, and methods for identification, assessment, prevention, and therapy of breast and ovarian cancer |
EP1537138A2 (en) | 2001-07-17 | 2005-06-08 | Incyte Genomics, Inc. | Receptors and membrane-associated proteins |
US20040142325A1 (en) | 2001-09-14 | 2004-07-22 | Liat Mintz | Methods and systems for annotating biomolecular sequences |
KR100988949B1 (en) | 2001-10-25 | 2010-10-20 | 제넨테크, 인크. | Glycoprotein compositions |
WO2003074679A2 (en) | 2002-03-01 | 2003-09-12 | Xencor | Antibody optimization |
WO2003085107A1 (en) | 2002-04-09 | 2003-10-16 | Kyowa Hakko Kogyo Co., Ltd. | Cells with modified genome |
AU2003240495A1 (en) | 2002-06-04 | 2003-12-19 | Incyte Corporation | Diagnostics markers for lung cancer |
US7521543B2 (en) | 2002-10-23 | 2009-04-21 | Ludwig Institute For Cancer Research | A34 and A33-like 3 DNA, proteins, antibodies thereto and methods of treatment using same |
AU2003302234A1 (en) | 2002-11-26 | 2004-06-18 | Incyte Corporation | Immune response associated proteins |
WO2004100774A2 (en) | 2003-05-07 | 2004-11-25 | Incyte Corporation | Receptors and membrane-associated proteins |
US20050197292A1 (en) | 2004-01-30 | 2005-09-08 | Glennda Smithson | Compositions and methods for treating T-cell mediated pathological conditions |
WO2005108415A2 (en) | 2004-04-30 | 2005-11-17 | Biogen Idec Ma Inc. | Membrane associated molecules |
JP2008537874A (en) | 2004-09-27 | 2008-10-02 | セントカー・インコーポレーテツド | sRAGE mimetibody, compositions, methods and uses |
EP3061461A1 (en) | 2004-10-29 | 2016-08-31 | ratiopharm GmbH | Remodeling and glycopegylation of fibroblast growth factor (fgf) |
DK1812031T3 (en) | 2004-11-01 | 2015-09-14 | Univ California | Compositions and methods for the modification of biomolecules |
ATE450615T1 (en) | 2005-07-22 | 2009-12-15 | Five Prime Therapeutics Inc | COMPOSITIONS AND METHODS FOR TREATING DISEASES WITH FGFR FUSION PROTEINS |
US20070249533A1 (en) | 2005-09-28 | 2007-10-25 | Levin Steven D | Il-17a and il-17f antagonists and methods of using the same |
PT1981909T (en) | 2006-02-08 | 2017-01-18 | Morphotek Inc | Antigenic gm-csf peptides and antibodies to gm-csf |
EP2064237A2 (en) | 2006-10-18 | 2009-06-03 | ZymoGenetics, Inc. | Il-17c antagonists and methods of using the same |
RS52345B (en) | 2007-02-23 | 2012-12-31 | Schering Corporation | Engineered anti-il-23p19 antibodies |
WO2008131242A1 (en) | 2007-04-18 | 2008-10-30 | Zymogenetics, Inc. | Single chain fc, methods of making and methods of treatment |
SI2769729T1 (en) * | 2007-09-04 | 2019-06-28 | Compugen Ltd. | Polypeptides and polynucleotides, and uses thereof as a drug target for producing drugs and biologics |
WO2009055074A2 (en) | 2007-10-25 | 2009-04-30 | Wyeth | Erbb2 binding proteins and use thereof |
EP2220125A4 (en) | 2007-11-13 | 2010-12-29 | Sapphire Energy Inc | Production of fc-fusion polypeptides in eukaryotic algae |
US20130160150A1 (en) | 2007-12-12 | 2013-06-20 | The Trustees Of Columbia University In The City Of New York | Methods for identifying compounds that modulate lisch-like protein or c1orf32 protein activity and methods of use |
EP2245063B1 (en) | 2007-12-18 | 2015-08-26 | BioAlliance C.V. | Antibodies recognizing a carbohydrate containing epitope on cd-43 and cea expressed on cancer cells and methods using same |
RU2509774C2 (en) | 2008-08-04 | 2014-03-20 | Файв Прайм Терапьютикс, Инк. | Fibroblast growth factor receptor extracellular domain acidic region muteins |
WO2010062401A2 (en) | 2008-11-26 | 2010-06-03 | Five Prime Therapeutics, Inc. | Treatment of osteolytic disorders and cancer using csf1r extracellular domain fusion molecules |
WO2010062399A2 (en) | 2008-11-26 | 2010-06-03 | Five Prime Therapeutics, Inc. | Csf1r extracellular domain fusion molecules and treatments using same |
SI2376116T1 (en) | 2008-12-12 | 2016-03-31 | Boehringer Ingelheim International Gmbh | Anti-igf antibodies |
JP5883384B2 (en) | 2009-08-13 | 2016-03-15 | ザ ジョンズ ホプキンス ユニバーシティー | How to regulate immune function |
DK2585098T3 (en) | 2010-06-28 | 2014-11-03 | Five Prime Therapeutics Inc | Extracellular FZD8 domains and fusion molecules from extracellular FZD8 domains for use in the treatment of obesity and obesity-related disorders |
CN107441480A (en) * | 2010-06-30 | 2017-12-08 | 卡姆普根有限公司 | Polypeptide and its purposes as the medicine for treating multiple sclerosis, rheumatoid arthritis and other autoimmune disorders |
US8481038B2 (en) | 2010-11-15 | 2013-07-09 | Five Prime Therapeutics, Inc. | Treatment of cancer with elevated dosages of soluble FGFR1 fusion proteins |
EP2646007B1 (en) | 2010-12-02 | 2016-12-21 | Neurotech USA, Inc. | Cell lines that secrete anti-angiogenic antibody-scaffolds and soluble receptors and uses thereof |
-
2012
- 2012-07-01 AU AU2012277376A patent/AU2012277376B2/en not_active Ceased
- 2012-07-01 US US14/129,974 patent/US9428574B2/en active Active
- 2012-07-01 CA CA2836855A patent/CA2836855C/en active Active
- 2012-07-01 WO PCT/IB2012/053342 patent/WO2013001517A1/en active Application Filing
- 2012-07-01 EP EP12804342.9A patent/EP2726503B1/en active Active
-
2013
- 2013-12-08 IL IL229858A patent/IL229858B/en active IP Right Grant
-
2016
- 2016-02-29 US US15/055,960 patent/US20160304579A1/en not_active Abandoned
-
2018
- 2018-04-30 US US15/966,694 patent/US20190248866A1/en not_active Abandoned
-
2020
- 2020-11-18 US US16/951,130 patent/US20220315641A9/en not_active Abandoned
Also Published As
Publication number | Publication date |
---|---|
CA2836855C (en) | 2020-07-14 |
US20190248866A1 (en) | 2019-08-15 |
US20220315641A9 (en) | 2022-10-06 |
AU2012277376B2 (en) | 2016-11-24 |
US20140170141A1 (en) | 2014-06-19 |
EP2726503A1 (en) | 2014-05-07 |
EP2726503A4 (en) | 2015-04-15 |
US20160304579A1 (en) | 2016-10-20 |
EP2726503B1 (en) | 2019-09-04 |
US9428574B2 (en) | 2016-08-30 |
IL229858B (en) | 2019-01-31 |
AU2012277376A1 (en) | 2013-12-12 |
CA2836855A1 (en) | 2013-01-03 |
WO2013001517A1 (en) | 2013-01-03 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20210253667A1 (en) | Polypeptides and uses thereof for treatment of autoimmune disorders and infection | |
US20190231848A1 (en) | Polypeptides and uses thereof as a drug for treatment of multiple sclerosis, rheumatoid arthritis and other autoimmune disorders | |
US20160347814A1 (en) | Vstm5 polypeptides and uses thereof as a drug for treatment of cancer, infectious diseases and immune related diseases | |
EP3185885B1 (en) | Polypeptides and uses thereof as a drug for treatment of autoimmune disorders | |
US20160272707A1 (en) | Vstm5 antibodies, and uses thereof for treatment of cancer, infectious diseases and immune related diseases | |
RU2757394C2 (en) | Compositions and methods for modulating the transmission of a lair signal | |
CN110799206A (en) | Methods of treating immune-related adverse events in cancer therapy using soluble CD24 | |
US20200237822A1 (en) | Compositions and methods for stimulating natural killer cells | |
US20170232062A1 (en) | Polypeptides and uses thereof as a drug for treatment of multiple sclerosis, rheumatoid arthritis and other autoimmune disorders | |
US20190309044A1 (en) | Polypeptides and uses thereof as a drug for treatment of autoimmune disorders | |
AU2016291846B2 (en) | HIDE1 Compositions and Methods | |
IL256261A (en) | Hide1 compositions and methods |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |