US20180340009A1 - Peptidomimetic macrocycles as modulators of mcl-1 - Google Patents

Peptidomimetic macrocycles as modulators of mcl-1 Download PDF

Info

Publication number
US20180340009A1
US20180340009A1 US15/982,700 US201815982700A US2018340009A1 US 20180340009 A1 US20180340009 A1 US 20180340009A1 US 201815982700 A US201815982700 A US 201815982700A US 2018340009 A1 US2018340009 A1 US 2018340009A1
Authority
US
United States
Prior art keywords
igd
independently
fnayyarr
alkyl
optionally substituted
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Abandoned
Application number
US15/982,700
Inventor
Vincent Guerlavais
Eric Feyfant
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Aileron Therapeutics Inc
Original Assignee
Aileron Therapeutics Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Aileron Therapeutics Inc filed Critical Aileron Therapeutics Inc
Priority to US15/982,700 priority Critical patent/US20180340009A1/en
Assigned to AILERON THERAPEUTICS, INC. reassignment AILERON THERAPEUTICS, INC. ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: GUERLAVAIS, VINCENT, FEYFANT, ERIC
Publication of US20180340009A1 publication Critical patent/US20180340009A1/en
Abandoned legal-status Critical Current

Links

Images

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
    • C07K7/04—Linear peptides containing only normal peptide links
    • C07K7/06—Linear peptides containing only normal peptide links having 5 to 11 amino acids
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
    • C07K14/4702—Regulators; Modulating activity
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides

Definitions

  • MCL-1 Myeloid cell leukemia 1
  • BIM BCL-2 interacting mediator
  • the invention provides a peptidomimetic macrocycle of Formula (Ic):
  • peptidomimetic macrocycle binds MCL-1 selectively over another protein that has a BH3 domain, wherein:
  • each A, C, D, and E is independently a natural or non-natural amino acid
  • each B is independently a natural or non-natural amino acid, amino acid analog
  • each L is independently a macrocycle-forming linker
  • each L′ is independently alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, arylene, or heteroarylene, each being optionally substituted with R 5 , or a bond, or together with R 1 and the atom to which both R 1 and L′ are bound forms a ring;
  • each L′′ is independently alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, arylene, or heteroarylene, each being optionally substituted with R 5 , or a bond, or together with R 2 and the atom to which both R 2 and L′′ are bound forms a ring;
  • each R 1 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, cycloalkylalkyl, heteroalkyl, or heterocycloalkyl, unsubstituted or substituted with halo-, or together with L′ and the atom to which both R 1 and L′ are bound forms a ring;
  • each R 2 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, cycloalkylalkyl, heteroalkyl, or heterocycloalkyl, unsubstituted or substituted with halo-, or together with L′′ and the atom to which both R 2 and L′′ are bound forms a ring;
  • each R 3 is independently hydrogen, alkyl, alkenyl, alkynyl, arylalkyl, heteroalkyl, cycloalkyl, heterocycloalkyl, cycloalkylalkyl, aryl, or heteroaryl, optionally substituted with R 5 ;
  • each L 3 is independently alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, arylene, heteroarylene, or [—R 4 —K—R 4 —] n , each being optionally substituted with R 5 ;
  • each R 4 is independently alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, arylene, or heteroarylene;
  • each K is independently O, S, SO, SO 2 , CO, CO 2 , or CONR 3 ;
  • each n is independently an integer from 1-5;
  • each R 5 is independently halogen, alkyl, —OR 6 , —N(R 6 ) 2 , —SR 6 , —SOR 6 , —SO 2 R 6 , —CO 2 R 6 , a fluorescent moiety, a radioisotope, or a therapeutic agent;
  • each R 6 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkylalkyl, heterocycloalkyl, a fluorescent moiety, a radioisotope, or a therapeutic agent;
  • each R 7 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, aryl, or heteroaryl, optionally substituted with R 5 , or part of a cyclic structure with a D residue;
  • each R 8 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, aryl, or heteroaryl, optionally substituted with R 5 , or part of a cyclic structure with an E residue;
  • each v and w is independently an integer from 1-1000;
  • u is an integer from 1-10;
  • each x, y and z is independently an integer from 0-10, or a pharmaceutically-acceptable salt thereof.
  • the invention provides a peptidomimetic macrocycle having the formula:
  • each D and E is independently an amino acid residue
  • R 1 and R 2 are independently alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, cycloalkylalkyl, heteroalkyl, or heterocycloalkyl, each being optionally substituted with halo-; —H, or at least one of R 1 and R 2 forms a macrocycle-forming linker L′ connected to the alpha position of one of the D or E amino acid residues;
  • L is a macrocycle-forming linker of the formula -L 1 -L 2 -or -L 1 -L 2 -L 3 -;
  • each L 1 , L 2 , and L 3 is independently alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, arylene, heteroarylene, or [—R 4 —K—R 4 —] n , each being optionally substituted with R 5 ;
  • each R 3 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, aryl, or heteroaryl, each being optionally substituted with R 5 ;
  • each R 4 is independently alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, arylene, or heteroarylene, each being optionally substituted with R 5 ;
  • each K is independently O, S, SO, SO 2 , CO, CO 2 , or CONR 3 ;
  • each R 5 is independently halogen, alkyl, —OR 6 , —N(R 6 ) 2 , —SR 6 , —SOR 6 , —SO 2 R 6 , —CO 2 R 6 , a fluorescent moiety, a radioisotope, or a therapeutic agent;
  • each R 6 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkylalkyl, heterocycloalkyl, a fluorescent moiety, a radioisotope, or a therapeutic agent;
  • R 7 is —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, aryl, or heteroaryl, each being optionally substituted with R 5 , or part of a cyclic structure with a D residue;
  • R 8 is —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, aryl, or heteroaryl, each being optionally substituted with R 5 , or part of a cyclic structure with an E residue;
  • each of Xaa 1 and Xaa 2 is independently an amino acid residue or absent;
  • Xaa 3 is Ala, Aib, Asp, Asn, Cys, Glu, Gln, His, Ile, Lys, Leu, Met, Arg, Ser, Thr, Val, Trp, Tyr, or an analog of any of the foregoing;
  • v is an integer from 1-1000;
  • w is an integer from 0-1000;
  • n is an integer from 1-5, or
  • the invention provides a peptidomimetic macrocycle of the formula (SEQ ID NO: 1783):
  • each D and E is independently an amino acid residue
  • R 1 and R 2 are independently alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, cycloalkylalkyl, heteroalkyl, or heterocycloalkyl, each being optionally substituted with halo-; —H, or at least one of R 1 and R 2 forms a macrocycle-forming linker L′ connected to the alpha position of one of the D or E amino acid residues;
  • each L or L′ is independently a macrocycle-forming linker of the formula -L 1 -L 2 -or -L 1 -L 2 -L 3 -;
  • each L 1 , L 2 , and L 3 is independently alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, arylene, heteroarylene, or [—R 4 —K—R 4 —] n , each being optionally substituted with R 5 ;
  • each R 3 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, aryl, or heteroaryl, each being optionally substituted with R 5 ;
  • each R 4 is independently alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, arylene, or heteroarylene, each being optionally substituted with R 5 ;
  • each K is independently O, S, SO, SO 2 , CO, CO 2 , or CONR 3 ;
  • each R 5 is independently halogen, alkyl, —OR 6 , —N(R 6 ) 2 , —SR 6 , —SOR 6 , —SO 2 R 6 , —CO 2 R 6 , a fluorescent moiety, a radioisotope, or a therapeutic agent;
  • each R 6 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkylalkyl, heterocycloalkyl, a fluorescent moiety, a radioisotope, or a therapeutic agent;
  • R 7 is —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, aryl, or heteroaryl, each being optionally substituted with R 5 , or part of a cyclic structure with a D residue;
  • R 8 is —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, aryl, or heteroaryl, each being optionally substituted with R 5 , or part of a cyclic structure with an E residue;
  • each of Xaa 1 and Xaa 2 is independently an amino acid residue or absent;
  • v is an integer from 1-1000;
  • w is an integer from 0-1000;
  • n is an integer from 1-5, or
  • the invention provides a peptidomimetic macrocycle comprising an amino acid sequence of formula:
  • X1 is Ile, Arg, Ala, Lys, Pro, Leu, Asp, Glu, His, Ser, Gln, Phe, an analog thereof, or absent;
  • X2 is Trp, Arg, Ala, Asn, Phe, Pro, Leu, Ser, Lys, Tyr, His, Cou, Cou2, Cou4, Cou7, an analog thereof, a crosslinked amino acid, or absent;
  • X3 is Ile, Ala, Leu, Phe, Tyr, Val, Asp, Trp, Pro, Gln, Chg, Ac5c, Ac6c, Tba, Bip, Cha, Adm, hCha, an analog thereof, or absent;
  • X4 is Ala, Gln, Asp, Val, Gly, Ser, Leu, Phe, Cha, A4, an analog, thereof, a crosslinked amino acid, or absent;
  • X5 is Gln, Ala, Leu, Phe, Tyr, Gly, Ile, Val, Arg, Glu, Pro, Asp, MO, MO2, an analog thereof, a crosslinked amino acid, or absent;
  • X6 is Glu, Gln, His, Ala, Ser, Arg, Ile, Leu, Thr, Phe, Val, Tyr, Gly, Nle, St, an analog thereof, or absent;
  • X7 is Ala, Leu, Phe, Ile, 2Nal, 1Nal, 3cf, Chg, Cha, Adm, hCha, Igl, Bip, an analog thereof, or absent;
  • X8 is Arg, Ala, Asp, Glu, Thr, His, Gln, Gly, Asn, Phe, Cit, St, an analog thereof, a crosslinked amino acid, or absent;
  • X9 is Arg, Ala, Asp, Lys, Asn, Gly, Ser, Gln, Cys, Nle, St, an analog thereof, or a crosslinked amino acid;
  • X10 is Ile, Val, Ala, Asp, Asn, Phe, Tba, hL, hhL, Nle, Chg, Cha, an analog thereof, or a crosslinked amino acid;
  • X11 is Gly, Val, Ala, Leu, Ile, Asp, Glu, Cha, Aib, Abu, an analog thereof, or a crosslinked amino acid;
  • X12 is Asp, Ala, Asn, Gly, Arg, Glu, Lys, Leu, Nle, an analog thereof, or a crosslinked amino acid;
  • X13 is Ala, Glu, Gln, Leu, Lys, Asp, Tyr, Ile, Ser, Cys, St, Sta5, Aib, Nle, an analog thereof, or a crosslinked amino acid;
  • X14 is Phe, Ala, Leu, Val, Tyr, Glu, His, Ile, Nle, 1Nal, 2Nal, Chg, Cha, BiP, an analog thereof, or a crosslinked amino acid;
  • X15 is Asn, Gln, Ser, His, Glu, Asp, Ala, Leu, Ile, St, Nle, Aib, an analog thereof, a crosslinked amino acid, or absent;
  • X16 is Ala, Glu, Asp, Arg, Lys, Phe, Gly, Gln, Aib, Cha, St, an analog thereof, a crosslinked amino acid, or absent;
  • X17 is Phe, Tyr, Ala, Leu, Asn, Ser, Gln, Arg, His, Thr, Cou2, Cou3, Cou7, Dpr, Amf, Damf, Amye, an analog thereof, a crosslinked amino acid, or absent;
  • X18 is Tyr, Ala, Ile, Phe, His, Arg, Lys, Trp, Orn, Amf, Amye, Cha, 2Nal, an analog thereof, or absent;
  • X19 is Ala, Lys, Arg, His, Ser, Gln, Glu, Asp, Thr, Aib, Cha, an analog thereof, a crosslinked amino acid, or absent;
  • X20 is Arg, His, Ala, Thr, Lys, Amr, an analog thereof, a crosslinked amino acid, or absent;
  • X21 is Arg, His, Ala, Amr, an analog thereof, or absent, or
  • the invention provides a peptidomimetic macrocycle comprising an amino acid sequence with C-terminal amino acid residues that are -His-His, wherein the peptidomimetic macrocycle comprises a crosslink connecting at least two amino acid residues, or a pharmaceutically-acceptable salt thereof.
  • the invention provides a peptidomimetic macrocycle that comprises an amino acid sequence that has at least 60% identity to any one of SEQ ID NOs.: 1-1625.
  • FIG. 1 illustrates cell viability over time after treatment with a peptidomimetic macrocycle.
  • FIG. 2 illustrates cell viability over time after treatment with a peptidomimetic macrocycle.
  • FIG. 3 illustrates cell viability over time after treatment with a peptidomimetic macrocycle.
  • FIG. 4 illustrates cell viability over time after treatment with a peptidomimetic macrocycle.
  • FIG. 5 illustrates normalized fluorescence resonance energy transfer (FRET) signal after treatment with vehicle, a peptidomimetic macrocycle, or a BH3 mimetic.
  • FRET fluorescence resonance energy transfer
  • FIG. 6 illustrates concentration of a peptidomimetic macrocycle in tissue over time after treatment.
  • FIG. 7 illustrates percentage remaining of a peptidomimetic macrocycle in plasma over time after treatment.
  • the term “about” or “approximately” can mean within an acceptable error range for the particular value as determined by one of ordinary skill in the art, which will depend in part on how the value is measured or determined, i.e., the limitations of the measurement system. For example, “about” can mean within 1 or more than 1 standard deviation, per the practice in the art. Alternatively, “about” can mean a range of up to 20%, up to 10%, up to 5%, or up to 1% of a given value. Alternatively, particularly with respect to biological systems or processes, the term can mean within an order of magnitude, within 5-fold, and more preferably within 2-fold, of a value.
  • microcycle refers to a molecule having a chemical structure including a ring or cycle formed by at least 9 covalently bonded atoms.
  • peptidomimetic macrocycle or “crosslinked polypeptide” refers to a compound comprising a plurality of amino acid residues joined by a plurality of peptide bonds and at least one macrocycle-forming linker which forms a macrocycle between a first naturally-occurring or non-naturally-occurring amino acid residue (or analog) and a second naturally-occurring or non-naturally-occurring amino acid residue (or analog) within the same molecule.
  • Peptidomimetic macrocycles include embodiments where the macrocycle-forming linker connects the ⁇ carbon of the first amino acid residue (or analog) to the ⁇ carbon of the second amino acid residue (or analog).
  • the peptidomimetic macrocycles optionally include one or more non-peptide bonds between one or more amino acid residues or amino acid analog residues, and optionally include one or more non-naturally-occurring amino acid residues or amino acid analog residues in addition to any which form the macrocycle.
  • a “corresponding uncrosslinked polypeptide” when referred to in the context of a peptidomimetic macrocycle is understood to relate to a polypeptide of the same length as the macrocycle and comprising the equivalent natural amino acids of the wild-type sequence corresponding to the macrocycle.
  • the term “stability” refers to the maintenance of a defined secondary structure in solution by a peptidomimetic macrocycle of the invention as measured by circular dichroism, NMR or another biophysical measure, or resistance to proteolytic degradation in vitro or in vivo.
  • Non-limiting examples of secondary structures contemplated in this invention are ⁇ -helices, 3 10 helices, ⁇ -turns, and ⁇ -pleated sheets.
  • helical stability refers to the maintenance of a helical structure by a peptidomimetic macrocycle of the invention as measured by circular dichroism or NMR.
  • the peptidomimetic macrocycles of the invention exhibit at least a 1.25, 1.5, 1.75 or 2-fold increase in ⁇ -helicity as determined by circular dichroism compared to a corresponding uncrosslinked macrocycle.
  • amino acid refers to a molecule containing both an amino group and a carboxyl group. Suitable amino acids include, without limitation, both the D-and L-isomers of the naturally-occurring amino acids, as well as non-naturally occurring amino acids prepared by organic synthesis or other metabolic routes.
  • amino acid as used herein, includes without limitation, ⁇ -amino acids, natural amino acids, non-natural amino acids, and amino acid analogs.
  • ⁇ -amino acid refers to a molecule containing both an amino group and a carboxyl group bound to a carbon which is designated the ⁇ -carbon.
  • ⁇ -amino acid refers to a molecule containing both an amino group and a carboxyl group in a ⁇ configuration.
  • abbreviation “b-” prior to an amino acid represent a beta configuration for the amino acid.
  • naturally occurring amino acid refers to any one of the twenty amino acids commonly found in peptides synthesized in nature, and known by the one letter abbreviations A, R, N, C, D, Q, E, G, H, I, L, K, M, F, P, S, T, W, Y and V.
  • “Hydrophobic amino acids” include small hydrophobic amino acids and large hydrophobic amino acids. “Small hydrophobic amino acids” are glycine, alanine, proline, and analogs thereof. “Large hydrophobic amino acids” are valine, leucine, isoleucine, phenylalanine, methionine, tryptophan, tyrosine, and analogs thereof. “Polar amino acids” are serine, threonine, asparagine, glutamine, cysteine, and analogs thereof. “Charged amino acids” include positively charged amino acids and negatively charged amino acids. “Positively charged amino acids” include lysine, arginine, histidine, and analogs thereof. “Negatively charged amino acids” include aspartate, glutamate, and analogs thereof.
  • amino acid analog refers to a molecule which is structurally similar to an amino acid and which can be substituted for an amino acid in the formation of a peptidomimetic macrocycle.
  • Amino acid analogs include, without limitation, ⁇ -amino acids and amino acids where the amino or carboxy group is substituted by a similarly reactive group (e.g., substitution of the primary amine with a secondary or tertiary amine, or substitution of the carboxy group with an ester).
  • non-natural amino acid refers to an amino acid which is not one of the twenty amino acids commonly found in peptides synthesized in nature, and known by the one letter abbreviations A, R, N, C, D, Q, E, G, H, I, L, K, M, F, P, S, T, W, Y and V.
  • Non-natural amino acids or amino acid analogs include, without limitation, structures according to the following:
  • Amino acid analogs include ⁇ -amino acid analogs.
  • ⁇ -amino acid analogs include, but are not limited to, the following: cyclic ⁇ -amino acid analogs; ⁇ -alanine; (R)- ⁇ -phenylalanine; (R)-1,2,3,4-tetrahydro-isoquinoline-3-acetic acid; (R)-3-amino-4-(1-naphthyl)-butyric acid; (R)-3-amino-4-(2,4-dichlorophenyl)butyric acid; (R)-3-amino-4-(2-chlorophenyl)-butyric acid; (R)-3-amino-4-(2-cyanophenyl)-butyric acid; (R)-3-amino-4-(2-fluorophenyl)-butyric acid; (R)-3-amino-4-(2-furyl)-butyric acid; (R)-3-amino
  • Amino acid analogs include analogs of alanine, valine, glycine or leucine.
  • Examples of amino acid analogs of alanine, valine, glycine, and leucine include, but are not limited to, the following: ⁇ -methoxyglycine; ⁇ -allyl-L-alanine; ⁇ -aminoisobutyric acid; ⁇ -methyl-leucine; ⁇ -(1-naphthyl)-D-alanine; ⁇ -(1-naphthyl)-L-alanine; ⁇ -(2-naphthyl)-D-alanine; ⁇ -(2-naphthyl)-L-alanine; ⁇ -(2-pyridyl)-D-alanine; ⁇ -(2-pyridyl)-L-alanine; ⁇ -(2-thienyl)-D-alanine; ⁇ -(2-thienyl)-L
  • Amino acid analogs include analogs of arginine or lysine.
  • amino acid analogs of arginine and lysine include, but are not limited to, the following: citrulline; L-2-amino-3-guanidinopropionic acid; L-2-amino-3-ureidopropionic acid; L-citrulline; Lys(Me) 2 -OH; Lys(N 3 )—OH; N ⁇ -benzyloxycarbonyl-L-ornithine; N ⁇ -nitro-D-arginine; N ⁇ -nitro-L-arginine; ⁇ -methyl-ornithine; 2,6-diaminoheptanedioic acid; L-ornithine; (N ⁇ -1-(4,4-dimethyl-2,6-dioxo-cyclohex-1-ylidene)ethyl)-D-ornithine; (N ⁇ -1-(4,4-dimethyl-2,6-
  • Amino acid analogs include analogs of aspartic or glutamic acids.
  • Examples of amino acid analogs of aspartic and glutamic acids include, but are not limited to, the following: ⁇ -methyl-D-aspartic acid; ⁇ -methyl-glutamic acid; ⁇ -methyl-L-aspartic acid; ⁇ -methylene-glutamic acid; (N- ⁇ -ethyl)-L-glutamine; [N- ⁇ -(4-aminobenzoyl)]-L-glutamic acid; 2,6-diaminopimelic acid; L- ⁇ -aminosuberic acid; D-2-aminoadipic acid; D- ⁇ -aminosuberic acid; ⁇ -aminopimelic acid; iminodiacetic acid; L-2-amino adipic acid; threo- ⁇ -methyl-aspartic acid; ⁇ -carboxy-D-glutamic acid ⁇ , ⁇ -di-t-butyl ester; ⁇
  • Amino acid analogs include analogs of cysteine and methionine.
  • amino acid analogs of cysteine and methionine include, but are not limited to, Cys(farnesyl)-OH, Cys(farnesyl)-OMe, ⁇ -methyl-methionine, Cys(2-hydroxyethyl)-OH, Cys(3-aminopropyl)-OH, 2-amino-4-(ethylthio)butyric acid, buthionine, buthioninesulfoximine, ethionine, methionine methylsulfonium chloride, selenomethionine, cysteic acid, [2-(4-pyridyl)ethyl]-DL-penicillamine, [2-(4-pyridyl)ethyl]-L-cysteine, 4-methoxybenzyl-D-penicillamine, 4-methoxybenzyl-L-penicillamine, 4-methylbenzy
  • Amino acid analogs include analogs of phenylalanine and tyrosine.
  • amino acid analogs of phenylalanine and tyrosine include ⁇ -methyl-phenylalanine, ⁇ -hydroxyphenylalanine, ⁇ -methyl-3-methoxy-DL-phenylalanine, ⁇ -methyl-D-phenylalanine, ⁇ -methyl-L-phenylalanine, 1,2,3,4-tetrahydroisoquinoline-3-carboxylic acid, 2,4-dichloro-phenylalanine, 2-(trifluoromethyl)-D-phenylalanine, 2-(trifluoromethyl)-L-phenylalanine, 2-bromo-D-phenylalanine, 2-bromo-L-phenylalanine, 2-chloro-D-phenylalanine, 2-chloro-L-phenylalanine, 2-cyano-D-phenylalanine, 2-cyano-L-phenylalanine,
  • Amino acid analogs include analogs of proline.
  • Examples of amino acid analogs of proline include, but are not limited to, 3,4-dehydro-proline, 4-fluoro-proline, cis-4-hydroxy-proline, thiazolidine-2-carboxylic acid, and trans-4-fluoro-proline.
  • Amino acid analogs include analogs of serine and threonine.
  • Examples of amino acid analogs of serine and threonine include, but are not limited to, 3-amino-2-hydroxy-5-methylhexanoic acid, 2-amino-3-hydroxy-4-methylpentanoic acid, 2-amino-3-ethoxybutanoic acid, 2-amino-3-methoxybutanoic acid, 4-amino-3-hydroxy-6-methylheptanoic acid, 2-amino-3-benzyloxypropionic acid, 2-amino-3-benzyloxypropionic acid, 2-amino-3-ethoxypropionic acid, 4-amino-3-hydroxybutanoic acid, and ⁇ -methylserine.
  • Amino acid analogs include analogs of tryptophan.
  • Examples of amino acid analogs of tryptophan include, but are not limited to, the following: ⁇ -methyl-tryptophan; ⁇ -(3-benzothienyl)-D-alanine; ⁇ -(3-benzothienyl)-L-alanine; 1-methyl-tryptophan; 4-methyl-tryptophan; 5-benzyloxy-tryptophan; 5-bromo-tryptophan; 5-chloro-tryptophan; 5-fluoro-tryptophan; 5-hydroxy-tryptophan; 5-hydroxy-L-tryptophan; 5-methoxy-tryptophan; 5-methoxy-L-tryptophan; 5-methyl-tryptophan; 6-bromo-tryptophan; 6-chloro-D-tryptophan; 6-chloro-tryptophan; 6-fluoro-tryptophan; 6-methyl-tryptophan; 7-benzyloxy-trypto
  • amino acid analogs are racemic.
  • the D isomer of the amino acid analog is used.
  • the L isomer of the amino acid analog is used.
  • the amino acid analog comprises chiral centers that are in the R or S configuration.
  • the amino group(s) of a ⁇ -amino acid analog is substituted with a protecting group, e.g., tert-butyloxycarbonyl (BOC group), 9-fluorenylmethyloxycarbonyl (FMOC), tosyl, and the like.
  • the carboxylic acid functional group of a ⁇ -amino acid analog is protected, e.g., as its ester derivative.
  • the salt of the amino acid analog is used.
  • non-essential amino acid residue is a residue that can be altered from the wild-type sequence of a polypeptide without abolishing or substantially abolishing its essential biological or biochemical activity (e.g., receptor binding or activation).
  • essential amino acid residue is a residue that, when altered from the wild-type sequence of the polypeptide, results in abolishing or substantially abolishing the polypeptide's essential biological or biochemical activity.
  • a “conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain.
  • Families of amino acid residues having similar side chains have been defined in the art. These families include amino acids with basic side chains (e.g., K, R, H), acidic side chains (e.g., D, E), uncharged polar side chains (e.g., G, N, Q, S, T, Y, C), nonpolar side chains (e.g., A, V, L, I, P, F, M, W), beta-branched side chains (e.g., T, V, I) and aromatic side chains (e.g., Y, F, W, H).
  • basic side chains e.g., K, R, H
  • acidic side chains e.g., D, E
  • uncharged polar side chains e.g., G, N, Q, S, T, Y, C
  • nonpolar side chains e.g., A, V, L
  • a predicted nonessential amino acid residue in a polypeptide is replaced with another amino acid residue from the same side chain family.
  • Other examples of acceptable substitutions are substitutions based on isosteric considerations (e.g. norleucine for methionine) or other properties (e.g. 2-thienylalanine for phenylalanine).
  • capping group refers to the chemical moiety occurring at either the carboxy or amino terminus of the polypeptide chain of the subject peptidomimetic macrocycle.
  • the capping group of a carboxy terminus includes an unmodified carboxylic acid (ie —COOH) or a carboxylic acid with a substituent.
  • the carboxy terminus can be substituted with an amino group to yield a carboxamide at the C-terminus.
  • substituents include but are not limited to primary and secondary amines, including pegylated secondary amines.
  • Non-limiting representative secondary amine capping groups for the C-terminus include:
  • the capping group of an amino terminus includes an unmodified amine (ie —NH 2 ) or an amine with a substituent.
  • the amino terminus can be substituted with an acyl group to yield a carboxamide at the N-terminus.
  • substituents include but are not limited to substituted acyl groups, including C 1 -C 6 carbonyls, C 7 -C 30 carbonyls, and pegylated carbamates.
  • Non-limiting representative capping groups for the N-terminus include:
  • member refers to the atoms that form or can form the macrocycle, and excludes substituent or side chain atoms.
  • cyclodecane, 1,2-difluoro-decane and 1,3-dimethyl cyclodecane are all considered ten-membered macrocycles as the hydrogen or fluoro substituents or methyl side chains do not participate in forming the macrocycle.
  • amino acid side chain refers to a moiety attached to the ⁇ -carbon (or another backbone atom) in an amino acid.
  • amino acid side chain for alanine is methyl
  • amino acid side chain for phenylalanine is phenylmethyl
  • amino acid side chain for cysteine is thiomethyl
  • amino acid side chain for aspartate is carboxymethyl
  • amino acid side chain for tyrosine is 4-hydroxyphenylmethyl, etc.
  • Other non-naturally occurring amino acid side chains are also included, for example, those that occur in nature (e.g., an amino acid metabolite) or those that are made synthetically (e.g., an ⁇ , ⁇ di-substituted amino acid).
  • ⁇ , ⁇ di-substituted amino acid refers to a molecule or moiety containing both an amino group and a carboxyl group bound to a carbon (the ⁇ -carbon) that is attached to two natural or non-natural amino acid side chains.
  • polypeptide encompasses two or more naturally or non-naturally-occurring amino acids joined by a covalent bond (e.g., an amide bond).
  • Polypeptides as described herein include full length proteins (e.g., fully processed proteins) as well as shorter amino acid sequences (e.g., fragments of naturally-occurring proteins or synthetic polypeptide fragments).
  • microcyclization reagent or “macrocycle-forming reagent” as used herein refers to any reagent which may be used to prepare a peptidomimetic macrocycle of the invention by mediating the reaction between two reactive groups.
  • Reactive groups may be, for example, an azide and alkyne
  • macrocyclization reagents include, without limitation, Cu reagents such as reagents which provide a reactive Cu(I) species, such as CuBr, CuI or CuOTf, as well as Cu(II) salts such as Cu(CO 2 CH 3 ) 2 , CuSO 4 , and CuCl 2 that can be converted in situ to an active Cu(I) reagent by the addition of a reducing agent such as ascorbic acid or sodium ascorbate.
  • Macrocyclization reagents may additionally include, for example, Ru reagents known in the art such as Cp*RuCl(PPh 3 ) 2 , [Cp*RuCl] 4 or other Ru reagents which may provide a reactive Ru(II) species.
  • the reactive groups are terminal olefins.
  • the macrocyclization reagents or macrocycle-forming reagents are metathesis catalysts including, but not limited to, stabilized, late transition metal carbene complex catalysts such as Group VIII transition metal carbene catalysts.
  • such catalysts are Ru and Os metal centers having a +2 oxidation state, an electron count of 16 and pentacoordinated.
  • catalysts have W or Mo centers.
  • the reactive groups are thiol groups.
  • the macrocyclization reagent is, for example, a linker functionalized with two thiol-reactive groups such as halogen groups.
  • halo or halogen refers to fluorine, chlorine, bromine or iodine or a radical thereof.
  • alkyl refers to a hydrocarbon chain that is a straight chain or branched chain, containing the indicated number of carbon atoms. For example, C 1 -C 10 indicates that the group has from 1 to 10 (inclusive) carbon atoms in it. In the absence of any numerical designation, “alkyl” is a chain (straight or branched) having 1 to 20 (inclusive) carbon atoms in it.
  • alkylene refers to a divalent alkyl (i.e., —R—).
  • alkenyl refers to a hydrocarbon chain that is a straight chain or branched chain having one or more carbon-carbon double bonds.
  • the alkenyl moiety contains the indicated number of carbon atoms. For example, C 2 -C 10 indicates that the group has from 2 to 10 (inclusive) carbon atoms in it.
  • lower alkenyl refers to a C 2 -C 6 alkenyl chain. In the absence of any numerical designation, “alkenyl” is a chain (straight or branched) having 2 to 20 (inclusive) carbon atoms in it.
  • alkynyl refers to a hydrocarbon chain that is a straight chain or branched chain having one or more carbon-carbon triple bonds.
  • the alkynyl moiety contains the indicated number of carbon atoms.
  • C 2 -C 10 indicates that the group has from 2 to 10 (inclusive) carbon atoms in it.
  • lower alkynyl refers to a C 2 -C 6 alkynyl chain.
  • alkynyl is a chain (straight or branched) having 2 to 20 (inclusive) carbon atoms in it.
  • aryl refers to a monocyclic or bicyclic aromatic ring system wherein 0, 1, 2, 3, or 4 atoms of each ring are substituted by a substituent.
  • aryl groups include phenyl, biphenyl, naphthyl and the like.
  • arylalkoxy refers to an alkoxy substituted with aryl.
  • Arylalkyl refers to an aryl group, as defined above, wherein one of the aryl group's hydrogen atoms has been replaced with a C 1 -C 5 alkyl group, as defined above.
  • Representative examples of an arylalkyl group include, but are not limited to, 2-methylphenyl, 3-methylphenyl, 4-methylphenyl, 2-ethylphenyl, 3-ethylphenyl, 4-ethylphenyl, 2-propylphenyl, 3-propylphenyl, 4-propylphenyl, 2-butylphenyl, 3-butylphenyl, 4-butylphenyl, 2-pentylphenyl, 3-pentylphenyl, 4-pentylphenyl, 2-isopropylphenyl, 3-isopropylphenyl, 4-isopropylphenyl, 2-isobutylphenyl, 3-isobutylphenyl, 4-isopropylphenyl
  • Arylamido refers to an aryl group, as defined above, wherein one of the aryl group's hydrogen atoms has been replaced with one or more —C(O)NH 2 groups.
  • Representative examples of an arylamido group include 2-C(O)NH2-phenyl, 3-C(O)NH 2 -phenyl, 4-C(O)NH 2 -phenyl, 2-C(O)NH 2 -pyridyl, 3-C(O)NH 2 -pyridyl, and 4-C(O)NH 2 -pyridyl,
  • Alkylheterocycle refers to a C 1 -C 5 alkyl group, as defined above, wherein one of the C 1 -C 5 alkyl group's hydrogen atoms has been replaced with a heterocycle.
  • Representative examples of an alkylheterocycle group include, but are not limited to, —CH 2 CH 2 -morpholine, —CH 2 CH 2 -piperidine, —CH 2 CH 2 CH 2 -morpholine, and —CH 2 CH 2 CH 2 -imidazole.
  • Alkylamido refers to a C 1 -C 5 alkyl group, as defined above, wherein one of the C 1 -C 5 alkyl group's hydrogen atoms has been replaced with a —C(O)NH 2 group.
  • an alkylamido group include, but are not limited to, —CH 2 —C(O)NH 2 , —CH 2 CH 2 —C(O)NH 2 , —CH 2 CH 2 CH 2 C(O)NH 2 , —CH 2 CH 2 CH 2 CH 2 C(O)NH 2 , —CH 2 CH 2 CH 2 CH 2 C(O)NH 2 , —CH 2 CH(C(O)NH 2 )CH 3 , —CH 2 CH(C(O)NH 2 )CH 2 CH 3 , —CH(C(O)NH 2 )CH 2 CH 3 , —C(CH 3 ) 2 CH 2 C(O)NH 2 , —CH 2 —CH 2 —NH—C(O)—CH 3 , —CH 2 —CH 2 —NH—C(O)—CH 3 , —CH 2 —CH 2 —NH—C(O)—CH 3 , —CH 2 —CH 2 —NH—C(O)—CH 3
  • Alkanol refers to a C 1 -C 5 alkyl group, as defined above, wherein one of the C 1 -C 5 alkyl group's hydrogen atoms has been replaced with a hydroxyl group.
  • Representative examples of an alkanol group include, but are not limited to, —CH 2 OH, —CH 2 CH 2 OH, —CH 2 CH 2 CH 2 OH, —CH 2 CH 2 CH 2 CH 2 OH, —CH 2 CH 2 CH 2 CH 2 CH 2 OH, —CH 2 CH(OH)CH 3 , —CH 2 CH(OH)CH 2 CH 3 , —CH(OH)CH 3 and —C(CH 3 ) 2 CH 2 OH.
  • Alkylcarboxy refers to a C 1 -C 5 alkyl group, as defined above, wherein one of the C 1 -C 5 alkyl group's hydrogen atoms has been replaced with a —COOH group.
  • Representative examples of an alkylcarboxy group include, but are not limited to, —CH 2 COOH, —CH 2 CH 2 COOH, —CH 2 CH 2 CH 2 COOH, —CH 2 CH 2 CH 2 CH 2 COOH, —CH 2 CH(COOH)CH 3 , —CH 2 CH 2 CH 2 CH 2 COOH, —CH 2 CH(COOH)CH 2 CH 3 , —CH(COOH)CH 2 CH 3 and —C(CH 3 ) 2 CH 2 COOH.
  • cycloalkyl as employed herein includes saturated and partially unsaturated cyclic hydrocarbon groups having 3 to 12 carbons, preferably 3 to 8 carbons, and more preferably 3 to 6 carbons, wherein the cycloalkyl group additionally is optionally substituted.
  • Some cycloalkyl groups include, without limitation, cyclopropyl, cyclobutyl, cyclopentyl, cyclopentenyl, cyclohexyl, cyclohexenyl, cycloheptyl, and cyclooctyl.
  • heteroaryl refers to an aromatic 5-8 membered monocyclic, 8-12 membered bicyclic, or 11-14 membered tricyclic ring system having 1-3 heteroatoms if monocyclic, 1-6 heteroatoms if bicyclic, or 1-9 heteroatoms if tricyclic, said heteroatoms selected from O, N, or S (e.g., carbon atoms and 1-3, 1-6, or 1-9 heteroatoms of O, N, or S if monocyclic, bicyclic, or tricyclic, respectively), wherein 0, 1, 2, 3, or 4 atoms of each ring are substituted by a substituent.
  • heteroaryl groups include pyridyl, furyl or furanyl, imidazolyl, benzimidazolyl, pyrimidinyl, thiophenyl or thienyl, quinolinyl, indolyl, thiazolyl, and the like.
  • heteroarylalkyl or the term “heteroaralkyl” refers to an alkyl substituted with a heteroaryl.
  • heteroarylalkoxy refers to an alkoxy substituted with heteroaryl.
  • heteroarylalkyl or the term “heteroaralkyl” refers to an alkyl substituted with a heteroaryl.
  • heteroarylalkoxy refers to an alkoxy substituted with heteroaryl.
  • heterocyclyl refers to a nonaromatic 5-8 membered monocyclic, 8-12 membered bicyclic, or 11-14 membered tricyclic ring system having 1-3 heteroatoms if monocyclic, 1-6 heteroatoms if bicyclic, or 1-9 heteroatoms if tricyclic, said heteroatoms selected from O, N, or S (e.g., carbon atoms and 1-3, 1-6, or 1-9 heteroatoms of O, N, or S if monocyclic, bicyclic, or tricyclic, respectively), wherein 0, 1, 2 or 3 atoms of each ring are substituted by a substituent.
  • heterocyclyl groups include piperazinyl, pyrrolidinyl, dioxanyl, morpholinyl, tetrahydrofuranyl, and the like.
  • substituted refers to a group replacing a second atom or group such as a hydrogen atom on any molecule, compound or moiety.
  • Suitable substituents include, without limitation, halo, hydroxy, mercapto, oxo, nitro, haloalkyl, alkyl, alkaryl, aryl, aralkyl, alkoxy, thioalkoxy, aryloxy, amino, alkoxycarbonyl, amido, carboxy, alkanesulfonyl, alkylcarbonyl, and cyano groups.
  • the compounds of this invention contain one or more asymmetric centers and thus occur as racemates and racemic mixtures, single enantiomers, individual diastereomers and diastereomeric mixtures. All such isomeric forms of these compounds are included in the present invention unless expressly provided otherwise.
  • the compounds of this invention are also represented in multiple tautomeric forms, in such instances, the invention includes all tautomeric forms of the compounds described herein (e.g., if alkylation of a ring system results in alkylation at multiple sites, the invention includes all such reaction products). All such isomeric forms of such compounds are included in the present invention unless expressly provided otherwise. All crystal forms of the compounds described herein are included in the present invention unless expressly provided otherwise.
  • the terms “increase” and “decrease” mean, respectively, to cause a statistically significantly (i.e., p ⁇ 0.1) increase or decrease of at least 5%.
  • variable is equal to any of the values within that range.
  • variable is equal to any integer value within the numerical range, including the end-points of the range
  • variable is equal to any real value within the numerical range, including the end-points of the range.
  • a variable which is described as having values between 0 and 2 takes the values 0, 1 or 2 if the variable is inherently discrete, and takes the values 0.0, 0.1, 0.01, 0.001, or any other real values ⁇ 0 and ⁇ 2 if the variable is inherently continuous.
  • on average represents the mean value derived from performing at least three independent replicates for each data point.
  • biological activity encompasses structural and functional properties of a macrocycle of the invention.
  • Biological activity is, for example, structural stability, alpha-helicity, affinity for a target, resistance to proteolytic degradation, cell penetrability, intracellular stability, in vivo stability, or any combination thereof.
  • the present invention provides pharmaceutical formulations comprising an effective amount of peptidomimetic macrocycles or pharmaceutically acceptable salts thereof.
  • the peptidomimetic macrocycles of the invention are cross-linked (e.g., stapled or stitched) and possess improved pharmaceutical properties relative to their corresponding uncross-linked peptidomimetic macrocycles. These improved properties include improved bioavailability, enhanced chemical and in vivo stability, increased potency, and reduced immunogenicity (i.e., fewer or less severe injection site reactions).
  • the peptide sequences are derived from BIM.
  • a peptidomimetic macrocycle peptide derived from a human BIM peptide can be a peptide comprising 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, or 22 amino acids from a BIM peptide sequence.
  • a peptidomimetic macrocycle peptide derived from a human BIM peptide sequence can be a peptide comprising 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, or 22 amino acids that are different from the selected sequences from which the peptide is derived.
  • a peptidomimetic macrocycle peptide derived from a human BIM peptide sequence can be a peptide comprising a mutation at amino acid position 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, or 22.
  • mutations are mutations of non-essential amino acids.
  • mutations are mutations of essential amino acids.
  • mutations are mutations of hydrophobic amino acids. In some embodiments, mutations are mutations of naturally occurring amino acids. In some embodiments, mutations are mutations to a conservative amino acid.
  • a peptidomimetic macrocycle peptide derived from a human BIM peptide sequence can be a peptide comprising 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, or 22 amino acid analogues. In some embodiments, a peptidomimetic macrocycle peptide derived from a human BIM peptide sequence can be a peptide comprising 1 or 2 capping groups.
  • the peptidomimetic macrocycle comprises a C-terminal truncation of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29 or 30 amino acids from an amino acid sequence in Table 1.
  • the peptidomimetic macrocycle comprises a N-terminal truncation of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, or 22 amino acids from the sequence of BIM.
  • BIM macrocycles for use in the present disclosure are given in Table 1.
  • Table 1 at the C-terminus, some peptides possess a carboxamide terminus (shown as —NH 2 ); some peptides possess a hydroxyl terminus (shown as -OH); some peptides possess a 5-carboxyfluorescein terminus (shown as -5-FAM); some peptides possess a isobutylamide terminus (shown as -NHiBu); some peptides possess a cyclohexylamide terminus (shown as -NHChx); some peptides possess a cyclohexylmethylamide terminus (shown as -NHMeChx); some peptides possess a phenethylamide terminus (shown as -NHPe); some peptides possess a n-butylamide terminus (shown as -NHBu); some peptides possess a sec-buty
  • Nle represents norleucine
  • Aib represents 2-aminoisobutyric acid
  • Ac represents acetyl
  • Pr represents propionyl.
  • Amino acids represented as “$” are alpha-Me S5-pentenyl-alanine olefin amino acids connected by an all-carbon crosslinker comprising one double bond.
  • Amino acids represented as “$r5” are alpha-Me R5-pentenyl-alanine olefin amino acids connected by an all-carbon comprising one double bond.
  • Amino acids represented as “$s8” are alpha-Me S8-octenyl-alanine olefin amino acids connected by an all-carbon crosslinker comprising one double bond.
  • Amino acids represented as “$r8” are alpha-Me R8-octenyl-alanine olefin amino acids connected by an all-carbon crosslinker comprising one double bond.
  • Ahx represents an aminocyclohexyl linker.
  • the crosslinkers are linear all-carbon crosslinker comprising eight or eleven carbon atoms between the alpha carbons of each amino acid.
  • Amino acids represented as “$/” are alpha-Me S5-pentenyl-alanine olefin amino acids that are not connected by any crosslinker.
  • Amino acids represented as “$/r5” are alpha-Me R5-pentenyl-alanine olefin amino acids that are not connected by any crosslinker.
  • Amino acids represented as “$/s8” are alpha-Me S8-octenyl-alanine olefin amino acids that are not connected by any crosslinker.
  • Amino acids represented as “$/r8” are alpha-Me R8-octenyl-alanine olefin amino acids that are not connected by any crosslinker.
  • Amino acids represented as “Amw” are alpha-Me tryptophan amino acids.
  • Amino acids represented as “Aml” are alpha-Me leucine amino acids.
  • Amino acids represented as “Amf” are alpha-Me phenylalanine amino acids.
  • Amino acids represented as “2ff” are 2-fluoro-phenylalanine amino acids.
  • Amino acids represented as “3ff” are 3-fluoro-phenylalanine amino acids.
  • Amino acids represented as “St” are amino acids comprising two pentenyl-alanine olefin side chains, each of which is crosslinked to another amino acid as indicated.
  • Amino acids represented as “St//” are amino acids comprising two pentenyl-alanine olefin side chains that are not crosslinked.
  • Amino acids represented as “%St” are amino acids comprising two pentenyl-alanine olefin side chains, each of which is crosslinked to another amino acid as indicated via fully saturated hydrocarbon crosslinks.
  • Amino acids represented as “Ba” are beta-alanine.
  • the lower-case character “e” or “z” within the designation of a crosslinked amino acid (e.g., “$er8” or “$zr8”) represents the configuration of the double bond (E or Z, respectively).
  • lower-case letters such as “a” or “f” represent D amino acids (e.g., D-alanine, or D-phenylalanine , respectively).
  • Amino acids designated as “NmW” represent N-methyltryptophan.
  • Amino acids designated as “NmY” represent N-methyltyrosine.
  • Amino acids designated as “NmA” represent N-methylalanine.
  • Kbio represents a biotin group attached to the side chain amino group of a lysine residue.
  • Amino acids designated as “Sar” represent sarcosine.
  • Amino acids designated as “Cha” represent cyclohexyl alanine.
  • Amino acids designated as “Cpg” represent cyclopentyl glycine.
  • Amino acids designated as “Chg” represent cyclohexyl glycine.
  • Amino acids designated as “Cba” represent cyclobutyl alanine.
  • Amino acids designated as “F 4 I” represent 4-iodo phenylalanine.
  • “7L” represents N15 isotopic leucine.
  • Amino acids designated as “F 3 Cl” represent 3-chloro phenylalanine.
  • Amino acids designated as “F4cooh” represent 4-carboxy phenylalanine.
  • Amino acids designated as “F 3 4F 2 ” represent 3,4-difluoro phenylalanine.
  • Amino acids designated as “6clW” represent 6-chloro tryptophan.
  • Amino acids designated as “$rda6” represent alpha-Me R6-hexynyl-alanine alkynyl amino acids, crosslinked via a dialkyne bond to a second alkynyl amino acid.
  • Amino acids designated as “$da5” represent alpha-Me S5-pentynyl-alanine alkynyl amino acids, wherein the alkyne forms one half of a dialkyne bond with a second alkynyl amino acid.
  • Amino acids designated as “$ra9” represent alpha-Me R9-nonynyl-alanine alkynyl amino acids, crosslinked via an alkyne metathesis reaction with a second alkynyl amino acid.
  • Amino acids designated as “$a6” represent alpha-Me S6-hexynyl-alanine alkynyl amino acids, crosslinked via an alkyne metathesis reaction with a second alkynyl amino acid.
  • the designation “iso1” or “iso2” indicates that the peptidomimetic macrocycle is a single isomer.
  • Amino acids designated as “Cit” represent citrulline.
  • Amino acids which are used in the formation of triazole crosslinkers are represented according to the legend indicated below. Stereochemistry at the alpha position of each amino acid is S unless otherwise indicated.
  • azide amino acids the number of carbon atoms indicated refers to the number of methylene units between the alpha carbon and the terminal azide.
  • alkyne amino acids the number of carbon atoms indicated is the number of methylene units between the alpha position and the triazole moiety plus the two carbon atoms within the triazole group derived from the alkyne.
  • peptidomimetic macrocycles are provided which are derived from BIM.
  • the present invention provides a peptidomimetic macrocycle comprising an amino acid sequence which is at least about 60% identical to BIM, further comprising at least two macrocycle-forming linkers, wherein the first of said two macrocycle-forming linkers connects a first amino acid to a second amino acid, and the second of said two macrocycle-forming linkers connects a third amino acid to a fourth amino acid.
  • Two or more peptides can share a degree of homology.
  • the pair of peptides is a peptidomimetic macrocycle of the present disclosure and a peptide identical to BIM.
  • a pair of peptides can have, for example, up to about 20% pairwise homology, up to about 25% pairwise homology, up to about 30% pairwise homology, up to about 35% pairwise homology, up to about 40% pairwise homology, up to about 45% pairwise homology, up to about 50% pairwise homology, up to about 55% pairwise homology, up to about 60% pairwise homology, up to about 65% pairwise homology, up to about 70% pairwise homology, up to about 75% pairwise homology, up to about 80% pairwise homology, up to about 85% pairwise homology, up to about 90% pairwise homology, up to about 95% pairwise homology, up to about 96% pairwise homology, up to about 97% pairwise homology, up to about 98% pairwise homology, up to about 99% pair
  • a pair of peptides can have, for example, at least about 20% pairwise homology, at least about 25% pairwise homology, at least about 30% pairwise homology, at least about 35% pairwise homology, at least about 40% pairwise homology, at least about 45% pairwise homology, at least about 50% pairwise homology, at least about 55% pairwise homology, at least about 60% pairwise homology, at least about 65% pairwise homology, at least about 70% pairwise homology, at least about 75% pairwise homology, at least about 80% pairwise homology, at least about 85% pairwise homology, at least about 90% pairwise homology, at least about 95% pairwise homology, at least about 96% pairwise homology, at least about 97% pairwise homology, at least about 98% pairwise homology, at least about 99% pairwise homology, at least about 99.5% pairwise homology, at least about 99.9% pairwise homology.
  • Various methods and software programs can be used to determine the homology between two or more peptides, such as NCBI BLAST, Clustal W, MAFFT, Clustal Omega, AlignMe, Praline, or another suitable method or algorithm.
  • a peptidomimetic macrocycle of the invention comprises a helix, for example an ⁇ -helix.
  • a peptidomimetic macrocycle of the invention comprises an ⁇ , ⁇ -disubstituted amino acid.
  • each amino acid connected by the macrocycle-forming linker is an ⁇ , ⁇ -disubstituted amino acid.
  • a peptidomimetic macrocycle of the invention has the Formula (I):
  • each A, C, D, and E is independently an amino acid (including natural or non-natural amino acids and amino acid analogs) and the terminal D and E independently optionally include a capping group;
  • each B is independently an amino acid (including natural or non-natural amino acids and amino acid analogs),
  • each R 1 and R 2 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, cycloalkylalkyl, heteroalkyl, or heterocycloalkyl, unsubstituted or substituted with halo-; or at least one of R 1 and R 2 forms a macrocycle-forming linker L′ connected to the alpha position of one of said D or E amino acids;
  • each R 3 is independently hydrogen, alkyl, alkenyl, alkynyl, arylalkyl, heteroalkyl, cycloalkyl, heterocycloalkyl, cycloalkylalkyl, cycloaryl, or heterocycloaryl, optionally substituted with R 5 ;
  • each L and L′ is independently a macrocycle-forming linker of the formula -L 1 -L 2 -,
  • each L 1 , L 2 and L 3 is independently alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, cycloarylene, heterocycloarylene, or [—R 4 —K—R 4 —] n , each being optionally substituted with R 5 ; when L is not
  • L 1 and L 2 are alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, cycloarylene, or heterocycloarylene;
  • each R 4 is independently alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, arylene, or heteroarylene;
  • each K is independently O, S, SO, SO 2 , CO, CO 2 , or CONR 3 ;
  • each R 5 is independently halogen, alkyl, —OR 6 , —N(R 6 ) 2 , —SR 6 , —SOR 6 , —SO 2 R 6 , —CO 2 R 6 , a fluorescent moiety, a radioisotope or a therapeutic agent;
  • each R 6 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkylalkyl, heterocycloalkyl, a fluorescent moiety, a radioisotope or a therapeutic agent;
  • each R 7 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, cycloaryl, or heterocycloaryl, optionally substituted with R 5 , or part of a cyclic structure with a D residue;
  • each R 8 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, cycloaryl, or heterocycloaryl, optionally substituted with R 5 , or part of a cyclic structure with an E residue;
  • each R 9 is independently absent, hydrogen, alkyl, alkenyl, alkynyl, aryl, cycloalkyl, cycloalkenyl, heteroaryl, or heterocyclyl group, unsubstituted or optionally substituted with R a or R b ;
  • each R a and R b is independently alkyl, OCH 3 , CF 3 , NH 2 , CH 2 NH 2 , F, Br, I,
  • each v and w is independently an integer from 0-1000, for example 0-500, 0-200, 0-100, 0-50, 0-30, 0-20, or 0-10;
  • u is an integer from 1-10, for example 1-5, 1-3 or 1-2;
  • each x, y and z is independently an integer from 0-10, for example the sum of x+y+z is 2, 3, or 6;
  • each n is independently an integer from 1-5;
  • u is 1.
  • the sum of x+y+z is 2, 3, 6, or 10, for example 2, 3 or 6, for example 3 or 6.
  • the sum of x+y+z is 3.
  • each of v and w is independently an integer from 1 to 10, 1 to 15, 1 to 20, or 1 to 25.
  • each of v and w is independently an integer from 1 to 15.
  • v and w are integers from 1-30. In some embodiments, w is an integer from 3-1000, for example 3-500, 3-200, 3-100, 3-50, 3-30, 3-20, or 3-10. In some embodiments, the sum of x+y+z is 3 or 6. In some embodiments, the sum of x+y+z is 3. In other embodiments, the sum of x+y+z is 6.
  • w is an integer from 3-10, for example 3-6, 3-8, 6-8, or 6-10. In some embodiments, w is 3. In other embodiments, w is 6. In some embodiments, v is an integer from 1-1000, for example 1-500, 1-200, 1-100, 1-50, 1-30, 1-20, or 1-10. In some embodiments, v is 2.
  • L 1 and L 2 are independently alkylene, alkenylene or alkynylene.
  • L 1 and L 2 are independently C 3 -C 10 alkylene or alkenylene.
  • L 1 and L 2 are independently C 3 -C 6 alkylene or alkenylene.
  • L or L′ is:
  • L or L′ is
  • L or L′ is
  • R 1 and R 2 are H.
  • R 1 and R 2 are independently alkyl.
  • R 1 and R 2 are methyl.
  • the present invention provides a peptidomimetic macrocycle having the Formula (Ia):
  • R 8 ′ is —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, cycloaryl, or heterocycloaryl, optionally substituted with R 5 , or part of a cyclic structure with a E residue;
  • v′ and w′ are independently integers from 0-100;
  • x′, y′ and z′ are independently integers from 0-10, for example, x′+y′+z′ is 2, 3, 6 or 10.
  • u is 2.
  • the peptidomimetic macrocycle of Formula (I) has the Formula (Ib):
  • R 7 ′ is —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, cycloaryl, or heterocycloaryl, optionally substituted with R 5 , or part of a cyclic structure with a D residue;
  • R 8 ′ is —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, cycloaryl, or heterocycloaryl, optionally substituted with R 5 , or part of a cyclic structure with an E residue;
  • v′ and w′ are independently integers from 0-100;
  • x′, y′ and z′ are independently integers from 0-10.
  • the sum of x+y+z is 2, 3 or 6, for example 3 or 6.
  • the sum of x′+y′+z′ is 2, 3 or 6, for example 3 or 6.
  • each of v and w is independently an integer from 1 to 10, 1 to 15, 1 to 20, or 1 to 25.
  • v and w are integers from 1-30. In some embodiments, w is an integer from 3-1000, for example 3-500, 3-200, 3-100, 3-50, 3-30, 3-20, or 3-10. In some embodiments, the sum of x+y+z is 3 or 6. In some embodiments, the sum of x+y+z is 3. In other embodiments, the sum of x+y+z is 6.
  • w is an integer from 3-10, for example 3-6, 3-8, 6-8, or 6-10. In some embodiments, w is 3. In other embodiments, w is 6. In some embodiments, v is an integer from 1-1000, for example 1-500, 1-200, 1-100, 1-50, 1-30, 1-20, or 1-10. In some embodiments, v is 2.
  • a peptidomimetic macrocycle of the invention comprises an amino acid sequence which is at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to an amino acid sequence of Table 1, and comprising at least one macrocycle-forming linker, wherein the macrocycle-forming linker connects amino acids 14 and 18.
  • a peptidomimetic macrocycle of Formula (I) has Formula (Ic):
  • each A, C, D, and E is independently a natural or non-natural amino acid
  • each B is independently a natural or non-natural amino acid, amino acid analog
  • each L is independently a macrocycle-forming linker
  • each L′ is independently alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, arylene, or heteroarylene, each being optionally substituted with R 5 , or a bond, or together with R 1 and the atom to which both R 1 and L′ are bound forms a ring;
  • each L′′ is independently alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, arylene, or heteroarylene, each being optionally substituted with R 5 , or a bond, or together with R 2 and the atom to which both R 2 and L′′ are bound forms a ring;
  • each R 1 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, cycloalkylalkyl, heteroalkyl, or heterocycloalkyl, unsubstituted or substituted with halo-, or together with L′ and the atom to which both R 1 and L′ are bound forms a ring;
  • each R 2 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, cycloalkylalkyl, heteroalkyl, or heterocycloalkyl, unsubstituted or substituted with halo-, or together with L′′ and the atom to which both R 2 and L′′ are bound forms a ring;
  • each R 3 is independently hydrogen, alkyl, alkenyl, alkynyl, arylalkyl, heteroalkyl, cycloalkyl, heterocycloalkyl, cycloalkylalkyl, aryl, or heteroaryl, optionally substituted with R 5 ;
  • each L 3 is independently alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, arylene, heteroarylene, or [—R 4 —K—R 4 —] n , each being optionally substituted with R 5 ;
  • each R 4 is independently alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, arylene, or heteroarylene;
  • each K is independently O, S, SO, SO 2 , CO, CO 2 , or CONR 3 ;
  • n is an integer from 1-5;
  • each R 5 is independently halogen, alkyl, —OR 6 , —N(R 6 ) 2 , —SR 6 , —SOR 6 , —SO 2 R 6 , —CO 2 R 6 , a fluorescent moiety, a radioisotope or a therapeutic agent;
  • each R 6 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkylalkyl, heterocycloalkyl, a fluorescent moiety, a radioisotope or a therapeutic agent;
  • each R 7 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, aryl, or heteroaryl, optionally substituted with R 5 , or part of a cyclic structure with a D residue;
  • each R 8 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, aryl, or heteroaryl, optionally substituted with R 5 , or part of a cyclic structure with an E residue;
  • each v and w is independently an integer from 1-1000, for example 1-500, 1-200, 1-100, 1-50, 1-40, 1-25, 1-20, 1-15, or 1-10;
  • u is an integer from 1-10;
  • each x, y and z is independently an integer from 0-10.
  • the peptidomimetic macrocycle comprises two crosslinks, wherein a first crosslink is of a first pair of amino acid residues, and a second crosslink is of a second pair of amino acid residues. In some embodiments, the first pair of amino acid residues and the second pair of amino acid residues do not share a common amino acid residue. In some embodiments, the first pair of amino acid residues and the second pair of amino acid residues share one common amino acid residue.
  • w is at least about 1, at least about 2, at least about 3, at least about 4, at least about 5, at least about 6, at least about 7, at least about 8, at least about 9, or at least about 10. In some embodiments, w is from about 1 to about 2, from about 2 to about 3, from about 3 to about 4, from about 4 to about 5, from about 5 to about 6, from about 6 to about 7, from about 7 to about 8, from about 8 to about 9, or from about 9 to about 10.
  • w is at least 2 and at least one of the last two E residues is a His residue. In some embodiments, w is at least 2 and at least one of the last two E residues is an Arg residue. In some embodiments, w is at least 2 and both of the last two E residues are His residues. In some embodiments, w is at least 2 and both of the last two E residues are Arg residues.
  • the number of His residues at the peptide C-terminus, or at the E variable can be 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10.
  • the His residues can be contiguous, or interrupted by a gap of i, i+1, i+2, i+3, or i+4.
  • the peptidomimetic macrocycle comprises a helix. In some embodiments, the peptidomimetic macrocycle comprises an ⁇ -helix. In some embodiments, each of v and w is independently an integer from 1 to 15. In some embodiments, each of v and w is independently an integer from 3 to 10. In some embodiments, v is 8. In some embodiments, w is 6. In some embodiments, the crosslinked amino acid residues are at positions 9 and 13 of the peptidomimetic macrocycle.
  • L is N
  • R 1 and R 2 are H. In some embodiments, R 1 and R 2 are independently alkyl. In some embodiments, R 1 and R 2 are methyl.
  • the peptidomimetic macrocycles have the Formula (I):
  • each A, C, D, and E is independently a natural or non-natural amino acid
  • each B is independently a natural or non-natural amino acid, amino acid analog
  • each R 1 and R 2 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, cycloalkylalkyl, heteroalkyl, or heterocycloalkyl, unsubstituted or substituted with halo-;
  • each R 3 is independently hydrogen, alkyl, alkenyl, alkynyl, arylalkyl, heteroalkyl, cycloalkyl, heterocycloalkyl, cycloalkylalkyl, aryl, or heteroaryl, optionally substituted with R 5 ;
  • each L is independently a macrocycle-forming linker of the formula
  • each L 1 , L 2 and L 3 is independently alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, arylene, heteroarylene, or [—R 4 —K—R 4 —] n , each being optionally substituted with R 5 ;
  • each R 4 is independently alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, arylene, or heteroarylene;
  • each K is independently O, S, SO, SO 2 , CO, CO 2 , or CONR 3 ; each R 5 is independently halogen, alkyl, —OR 6 , —N(R 6 ) 2 , —SR 6 , —SOR 6 , —SO 2 R 6 , —CO 2 R 6 , a fluorescent moiety, a radioisotope or a therapeutic agent;
  • each R 6 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkylalkyl, heterocycloalkyl, a fluorescent moiety, a radioisotope or a therapeutic agent;
  • each R 7 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, aryl, or heteroaryl, optionally substituted with R 5 , or part of a cyclic structure with a D residue;
  • each R 8 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, aryl, or heteroaryl, optionally substituted with R 5 , or part of a cyclic structure with an E residue;
  • each v and w is independently an integer from 1-1000;
  • u is an integer from 1-10;
  • each x, y and z is independently an integer from 0-10;
  • n is an integer from 1-5.
  • peptidomimetic macrocycles comprising Formula (II) or (IIa):
  • each A, C, D, and E is independently a natural or non-natural amino acid, and the terminal D and E independently optionally include a capping group;
  • each B is independently a natural or non-natural amino acid, amino acid analog
  • each R 1 and R 2 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, cycloalkylalkyl, heteroalkyl, or heterocycloalkyl, unsubstituted or substituted with halo-; or at least one of R 1 and R 2 forms a macrocycle-forming linker L′ connected to the alpha position of one of said D or E amino acids;
  • each R 3 is independently hydrogen, alkyl, alkenyl, alkynyl, arylalkyl, heteroalkyl, cycloalkyl, heterocycloalkyl, cycloalkylalkyl, cycloaryl, or heterocycloaryl, optionally substituted with R 5 ;
  • each L 1 , L 2 , and L 3 is independently alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, cycloarylene, heterocycloarylene, or [—R 4 —K—R 4 —] n , each being optionally substituted with R 5 ;
  • each R 4 is independently alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, arylene, or heteroarylene;
  • each K is independently O, S, SO, SO 2 , CO, CO 2 , or CONR 3 ; each R 5 is independently halogen, alkyl, —OR 6 , —N(R 6 ) 2 , —SR 6 , —SOR 6 , —SO 2 R 6 , —CO 2 R 6 , a fluorescent moiety, a radioisotope or a therapeutic agent;
  • each R 6 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkylalkyl, heterocycloalkyl, a fluorescent moiety, a radioisotope or a therapeutic agent;
  • each R 7 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, cycloaryl, or heterocycloaryl, optionally substituted with R 5 ;
  • each v and w is independently an integer from 0-100;
  • u is an integer from 1-10;
  • each x, y and z is independently an integer from 0-10;
  • n is an integer from 1-5;
  • a peptidomimetic macrocycle comprises Formula (IIIa) or (IIIb):
  • each A, C, D and E is independently an amino acid, and the terminal D and E independently optionally include a capping group;
  • each B is independently an amino acid
  • each R 1 ′ and R 2 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, cycloalkylalkyl, heteroalkyl, or heterocycloalkyl, unsubstituted or substituted with halo-; or R 2 forms a macrocycle-forming linker L′ connected to the alpha position of one of said E amino acids;
  • each R 3 is independently hydrogen, alkyl, alkenyl, alkynyl, arylalkyl, heteroalkyl, cycloalkyl, heterocycloalkyl, cycloalkylalkyl, cycloaryl, or heterocycloaryl, optionally substituted with R 5 ;
  • each L and L′ is independently a macrocycle-forming linker of the formula -L 1 -L 2 -,
  • each L 1 , L 2 and L 3 is independently alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, cycloarylene, heterocycloarylene, or [—R 4 -K-R 4 —] n , each being optionally substituted with R 5 ;
  • each R 4 is independently alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, arylene, or heteroarylene;
  • each K is independently O, S, SO, SO 2 , CO, CO 2 , or CONR 3 ; each R 5 is independently halogen, alkyl, —OR 6 , —N(R 6 ) 2 , —SR 6 , —SOR 6 , —SO 2 R 6 , —CO 2 R 6 , a fluorescent moiety, a radioisotope or a therapeutic agent;
  • each R 6 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkylalkyl, heterocycloalkyl, a fluorescent moiety, a radioisotope or a therapeutic agent;
  • each R 7 or R 7 ′ is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, cycloaryl, or heterocycloaryl, optionally substituted with R 5 , or part of a cyclic structure with a D residue;
  • each R 8 or R 8 ′ is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, cycloaryl, or heterocycloaryl, optionally substituted with R 5 , or part of a cyclic structure with an E residue;
  • each R 9 is independently absent, hydrogen, alkyl, alkenyl, alkynyl, aryl, cycloalkyl, cycloalkenyl, heteroaryl, or heterocyclyl group, unsubstituted or optionally substituted with R a or R b ;
  • each R a and R b is independently alkyl, OCH 3 , CF 3 , NH 2 , CH 2 NH 2 , F, Br, I,
  • each v′ and w is independently an integer from 0-1000, for example 0-500, 0-200, 0-100, 0-50, 0-30, 0-20, or 0-10;
  • u is an integer from 1-10, for example 1-5, 1-3 or 1-2;
  • each x, y, z, x′, y′ and z′ is independently an integer from 0-10, for example the sum of x+y+z is 2, 3, 6 or 10, or the sum of x′+y′+z′ is 2, 3, 6, or 10;
  • n is an integer from 1-5;
  • X is C ⁇ O, CHR c , or C ⁇ S;
  • R c is alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, cycloalkylalkyl, heteroalkyl, or heterocycloalkyl;
  • the peptidomimetic macrocycle has the Formula:
  • each R 1 ′ or R 2 ′ is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, cycloalkylalkyl, heteroalkyl, or heterocycloalkyl, unsubstituted or substituted with halo-; and
  • each v, w, v′ or w′ is independently an integer from 0-100.
  • Hep is used for a macrocycle of Formula Ma, which represents an N-terminal heptenoic capping group of the following formula:
  • AA 1 , AA 2 , AA 3 and AA 4 are amino acids.
  • a C-terminal macrocycle of Formula IIIb forms the structure:
  • the peptidomimetic macrocycle has the Formula IV:
  • each A, C, D, and E is independently an amino acid
  • each B is independently an amino acid
  • each R 1 and R 2 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, cycloalkylalkyl, heteroalkyl, or heterocycloalkyl, unsubstituted or substituted with halo-; or at least one of R 1 and R 2 forms a macrocycle-forming linker L′ connected to the alpha position of one of said D or E amino acids;
  • each R 3 is independently hydrogen, alkyl, alkenyl, alkynyl, arylalkyl, heteroalkyl, cycloalkyl, heterocycloalkyl, cycloalkylalkyl, cycloaryl, or heterocycloaryl, optionally substituted with R 5 ;
  • each L 1 , L 2 , L 3 and L 4 is independently alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, cycloarylene, heterocycloarylene or [—R 4 —K—R 4 —]n, each being unsubstituted or substituted with R 5 ;
  • each K is independently O, S, SO, SO 2 , CO, CO 2 , or CONR 3 ;
  • each R 4 is independently alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, arylene, or heteroarylene;
  • each R 5 is independently halogen, alkyl, —OR 6 , —N(R 6 ) 2 , —SR 6 , —SOR 6 , —SO 2 R 6 , —CO 2 R 6 , a fluorescent moiety, a radioisotope or a therapeutic agent;
  • each R 6 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkylalkyl, heterocycloalkyl, a fluorescent moiety, a radioisotope or a therapeutic agent;
  • each R 7 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, cycloaryl, or heterocycloaryl, optionally substituted with R 5 , or part of a cyclic structure with a D residue;
  • each R 8 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, cycloaryl, or heterocycloaryl, optionally substituted with R 5 , or part of a cyclic structure with an E residue;
  • each v and w is independently an integer from 1-1000, for example 1-500, 1-200, 1-100, 1-50, 1-30, 1-20 or 1-10;
  • u is an integer from 1-10, for example 1-5, 1-3 or 1-2;
  • each x, y and z is independently an integer from 0-10, for example the sum of x+y+z is 2, 3, 6 or 10, for example sum of x+y+z is 2, 3or 6;
  • n is an integer from 1-5.
  • the peptidomimetic macrocycle has the Formula (V):
  • each D and E is independently an amino acid residue
  • R 1 and R 2 are independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, cycloalkylalkyl, heteroalkyl, or heterocycloalkyl, each being optionally substituted with halo-; or at least one of R 1 and R 2 forms a macrocycle-forming linker L′ connected to the alpha position of one of the D or E amino acid residues;
  • each L or L′ is independently a macrocycle-forming linker of the formula -L 1 -L 2 -or -L 1 -L 2 -L 3 -;
  • each L 1 , L 2 , and L 3 is independently alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, arylene, heteroarylene, or [—R 4 —K—R 4 —] n , each being optionally substituted with R 5 ;
  • each R 3 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, aryl, or heteroaryl, each being optionally substituted with R 5 ;
  • each R 4 is independently alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, arylene, or heteroarylene, each being optionally substituted with R 5 ;
  • each K is independently O, S, SO, SO 2 , CO, CO 2 , or CONR 3 ; each R 5 is independently halogen, alkyl, —OR 6 , —N(R 6 ) 2 , —SR 6 , —SOR 6 , —SO 2 R 6 , —CO 2 R 6 , a fluorescent moiety, a radioisotope, or a therapeutic agent;
  • each R 6 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkylalkyl, heterocycloalkyl, a fluorescent moiety, a radioisotope, or a therapeutic agent;
  • R 7 is —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, aryl, or heteroaryl, each being optionally substituted with R 5 , or part of a cyclic structure with a D residue;
  • R 8 is —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, aryl, or heteroaryl, each being optionally substituted with R 5 , or part of a cyclic structure with an E residue;
  • each of Xaa 1 and Xaa 2 is independently an amino acid residue or absent;
  • Xaa 3 is Ala, Aib, Asp, Asn, Cys, Glu, Gln, His, Ile, Lys, Leu, Met, Arg, Ser, Thr, Val, Trp, Tyr, or an analogue of any of the foregoing;
  • v is an integer from 1-1000;
  • w is an integer from 0-1000;
  • n is an integer from 1-5.
  • the peptidomimetic macrocycle of Formula (V) comprises two crosslinks, wherein a first crosslink is of a first pair of amino acid residues, and a second crosslink is of a second pair of amino acid residues.
  • the first pair of amino acid residues and the second pair of amino acid residues do not share a common amino acid residue.
  • the first pair of amino acid residues and the second pair of amino acid residues share one common amino acid residue.
  • one of Xaa 1 and Xaa 2 is His.
  • both of Xaa 1 and Xaa 2 are His.
  • one of Xaa 1 and Xaa 2 is Arg.
  • both of Xaa 1 and Xaa 2 are Arg. In some embodiments, one of Xaa 1 and Xaa 2 is absent. In some embodiments, both of Xaa 1 and Xaa 2 are absent.
  • the peptidomimetic macrocycle comprises a helix. In some embodiments, the peptidomimetic macrocycle comprises an ⁇ -helix. In some embodiments, v is an integer from 1 to 15. In some embodiments, v is an integer from 3 to 10. In some embodiments, v is 8. In some embodiments, w is an integer from 0 to 15. In some embodiments, w is an integer from 0 to 5. In some embodiments, w is an integer from 0 to 3. In some embodiments, wherein w is 0.
  • v and w are integers from 1-30. In some embodiments, w is an integer from 3-1000, for example 3-500, 3-200, 3-100, 3-50, 3-30, 3-20, or 3-10. In some embodiments, the sum of x+y+z is 3 or 6. In some embodiments, the sum of x+y+z is 3. In other embodiments, the sum of x+y+z is 6.
  • w is an integer from 3-10, for example 3-6, 3-8, 6-8, or 6-10. In some embodiments, w is 3. In other embodiments, w is 6. In some embodiments, v is an integer from 1-1000, for example 1-500, 1-200, 1-100, 1-50, 1-30, 1-20, or 1-10. In some embodiments, v is 2.
  • L is the formula -L 1 -L 2 -, and L 1 and L 2 are independently alkylene, alkenylene, or alkynylene. In some embodiments, wherein L is the formula -L 1 -L 2 -, and L 1 and L 2 are independently C 3 -C 10 alkylene or C 3 -C 10 alkenylene. In some embodiments, wherein L is the formula -L 1 -L 2 -, and L 1 and L 2 are independently C 3 -C 6 alkylene or C 3 -C 6 alkenylene. In some embodiments, L is
  • L is the formula -L 1 -L 2 -L 3 -, and L 1 and L 3 are independently alkylene, alkenylene, or alkynylene, and L 2 is arylene or heteroarylene. In some embodiments, L is the formula -L 1 -L 2 -L 3 -, and L 1 and L 3 are independently C 3 -C 10 alkylene, and L 2 is heteroarylene. In some embodiments, L is the formula -L 1 -L 2 -L 3 -, and L 1 and L 3 are independently C 3 -C 6 alkylene, and L 2 is heteroarylene.
  • R 1 and R 2 are H. In some embodiments, R 1 and R 2 are independently alkyl. In some embodiments, R 1 and R 2 are methyl.
  • the peptidomimetic macrocycle has the Formula (VI) (SEQ ID NO: 1783):
  • each D and E is independently an amino acid residue
  • R 1 and R 2 are independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, cycloalkylalkyl, heteroalkyl, or heterocycloalkyl, each being optionally substituted with halo-; or at least one of R 1 and R 2 forms a macrocycle-forming linker L′ connected to the alpha position of one of the D or E amino acid residues;
  • each L or L′ is independently a macrocycle-forming linker of the formula -L 1 -L 2 -or -L 1 -L 2 -L 3 -;
  • each L 1 , L 2 , and L 3 is independently alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, arylene, heteroarylene, or [—R 4 —K—R 4 —] n , each being optionally substituted with R 5 ;
  • each R 3 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, aryl, or heteroaryl, each being optionally substituted with R 5 ;
  • each R 4 is independently alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, arylene, or heteroarylene, each being optionally substituted with R 5 ;
  • each K is independently O, S, SO, SO 2 , CO, CO 2 , or CONR 3 ; each R 5 is independently halogen, alkyl, —OR 6 , —N(R 6 ) 2 , —SR 6 , —SOR 6 , —SO 2 R 6 , —CO 2 R 6 , a fluorescent moiety, a radioisotope, or a therapeutic agent;
  • each R 6 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkylalkyl, heterocycloalkyl, a fluorescent moiety, a radioisotope, or a therapeutic agent;
  • R 7 is —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, aryl, or heteroaryl, each being optionally substituted with R 5 , or part of a cyclic structure with a D residue;
  • R 8 is —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, aryl, or heteroaryl, each being optionally substituted with R 5 , or part of a cyclic structure with an E residue;
  • each of Xaa 1 and Xaa 2 is independently an amino acid residue or absent;
  • v is an integer from 1-1000;
  • w is an integer from 0-1000;
  • n is an integer from 1-5.
  • the peptidomimetic macrocycle of Formula (VI) comprises two crosslinks, wherein a first crosslink is of a first pair of amino acid residues, and a second crosslink is of a second pair of amino acid residues.
  • the first pair of amino acid residues and the second pair of amino acid residues do not share a common amino acid residue.
  • the first pair of amino acid residues and the second pair of amino acid residues share one common amino acid residue.
  • one of Xaa 1 and Xaa 2 is His.
  • both of Xaa 1 and Xaa 2 are His.
  • one of Xaa 1 and Xaa 2 is Arg.
  • both of Xaa 1 and Xaa 2 are Arg. In some embodiments, one of Xaa 1 and Xaa 2 is absent. In some embodiments, both of Xaa 1 and Xaa 2 are absent.
  • the peptidomimetic macrocycle comprises a helix. In some embodiments, the peptidomimetic macrocycle comprises an ⁇ -helix. In some embodiments, v is an integer from 1 to 15. In some embodiments, v is an integer from 3 to 10. In some embodiments, v is 8. In some embodiments, w is an integer from 0 to 15. In some embodiments, w is an integer from 0 to 5. In some embodiments, w is an integer from 0 to 3. In some embodiments, wherein w is 0.
  • v and w are integers from 1-30. In some embodiments, w is an integer from 3-1000, for example 3-500, 3-200, 3-100, 3-50, 3-30, 3-20, or 3-10. In some embodiments, the sum of x+y+z is 3 or 6. In some embodiments, the sum of x+y+z is 3. In other embodiments, the sum of x+y+z is 6.
  • w is an integer from 3-10, for example 3-6, 3-8, 6-8, or 6-10. In some embodiments, w is 3. In other embodiments, w is 6. In some embodiments, v is an integer from 1-1000, for example 1-500, 1-200, 1-100, 1-50, 1-30, 1-20, or 1-10. In some embodiments, v is 2.
  • L is the formula -L 1 -L 2 -, and L 1 and L 2 are independently alkylene, alkenylene, or alkynylene. In some embodiments, wherein L is the formula -L 1 -L 2 -, and L 1 and L 2 are independently C 3 -C 10 alkylene or C 3 -C 10 alkenylene. In some embodiments, wherein L is the formula -L 1 -L 2 -, and L 1 and L 2 are independently C 3 -C 6 alkylene or C 3 -C 6 alkenylene. In some embodiments, L is
  • L is the formula -L 1 -L 2 -L 3 -, and L 1 and L 3 are independently alkylene, alkenylene, or alkynylene, and L 2 is arylene or heteroarylene. In some embodiments, L is the formula -L 1 -L 2 -L 3 -, and L 1 and L 3 are independently C 3 -C 10 alkylene, and L 2 is heteroarylene. In some embodiments, L is the formula -L 1 -L 2 -L 3 -, and L 1 and L 3 are independently C 3 -C 6 alkylene, and L 2 is heteroarylene.
  • R 1 and R 2 are H. In some embodiments, R 1 and R 2 are independently alkyl. In some embodiments, R 1 and R 2 are methyl.
  • At least one of R 1 and R 2 is alkyl, unsubstituted or substituted with halo-. In another example, both R 1 and R 2 are independently alkyl, unsubstituted or substituted with halo-. In some embodiments, at least one of R 1 and R 2 is methyl. In other embodiments, R 1 and R 2 are methyl.
  • the sum of the sum of x+y+z is at least 3, or the sum of x′+y′+z′ is at least 3. In other embodiments of the invention, the sum of the sum of x+y+z is 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 (for example 2, 3 or 6) or the sum of x′+y′+z′ is 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 (for example 2, 3 or 6).
  • each occurrence of A, B, C, D or E in a macrocycle or macrocycle precursor of the invention is independently selected.
  • a sequence represented by the formula [A] x when x is 3, encompasses embodiments where the amino acids are not identical, e.g. Gln-Asp-Ala as well as embodiments where the amino acids are identical, e.g. Gln-Gln-Gln. This applies for any value of x, y, or z in the indicated ranges
  • each compound of the invention may encompass peptidomimetic macrocycles which are the same or different.
  • a compound of the invention may comprise peptidomimetic macrocycles comprising different linker lengths or chemical compositions.
  • the peptidomimetic macrocycle of the invention comprises a secondary structure which is an ⁇ -helix and R 8 is —H, allowing intrahelical hydrogen bonding.
  • at least one of A, B, C, D or E is an ⁇ , ⁇ -disubstituted amino acid.
  • B is an ⁇ , ⁇ -disubstituted amino acid.
  • at least one of A, B, C, D or E is 2-aminoisobutyric acid.
  • at least one of A, B, C, D or E is
  • the length of the macrocycle-forming linker L as measured from a first C ⁇ to a second C ⁇ is selected to stabilize a desired secondary peptide structure, such as an cc-helix formed by residues of the peptidomimetic macrocycle including, but not necessarily limited to, those between the first C ⁇ to a second C ⁇ .
  • the peptidomimetic macrocycle of Formula (I) is:
  • each R 1 and R 2 is independently independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, cycloalkylalkyl, heteroalkyl, or heterocycloalkyl, unsubstituted or substituted with halo-.
  • the peptidomimetic macrocycle comprises a structure of Formula (I) which is:
  • the peptidomimetic macrocycle of Formula (I) is a compound of any of the formulas shown below:
  • AA represents any natural or non-natural amino acid side chain and “ ” is [D] v , [E] w as defined above, and n is an integer between 0 and 20, 50, 100, 200, 300, 400 or 500.
  • the substituent “n” shown in the preceding paragraph is 0. In other embodiments, the substituent “n” shown in the preceding paragraph is less than 50, 40, 30, 20, 10, or 5.
  • D or E in the compound of Formula I are further modified in order to facilitate cellular uptake.
  • lipidating or PEGylating a peptidomimetic macrocycle facilitates cellular uptake, increases bioavailability, increases blood circulation, alters pharmacokinetics, decreases immunogenicity or decreases the needed frequency of administration.
  • At least one of [D] and [E] in the compound of Formula I represents a moiety comprising an additional macrocycle-forming linker such that the peptidomimetic macrocycle comprises at least two macrocycle-forming linkers.
  • a peptidomimetic macrocycle comprises two macrocycle-forming linkers.
  • any of the macrocycle-forming linkers described herein may be used in any combination with any of the sequences shown in Tables 1-2 and also with any of the R— substituents indicated herein.
  • the peptidomimetic macrocycle comprises at least one ⁇ -helix motif.
  • A, B or C in the compound of Formula I include one or more ⁇ -helices.
  • ⁇ -helices include between 3 and 4 amino acid residues per turn.
  • the ⁇ -helix of the peptidomimetic macrocycle includes 1 to 5 turns and, therefore, 3 to 20 amino acid residues.
  • the ⁇ -helix includes 1 turn, 2 turns, 3 turns, 4 turns, or 5 turns.
  • the macrocycle-forming linker stabilizes an ⁇ -helix motif included within the peptidomimetic macrocycle.
  • the length of the macrocycle-forming linker L from a first C ⁇ to a second C ⁇ is selected to increase the stability of an ⁇ -helix.
  • the macrocycle-forming linker spans from 1 turn to 5 turns of the ⁇ -helix. In some embodiments, the macrocycle-forming linker spans approximately 1 turn, 2 turns, 3 turns, 4 turns, or 5 turns of the ⁇ -helix. In some embodiments, the length of the macrocycle-forming linker is approximately 5 ⁇ to 9 ⁇ per turn of the ⁇ -helix, or approximately 6 ⁇ to 8 ⁇ per turn of the ⁇ -helix.
  • the length is equal to approximately 5 carbon-carbon bonds to 13 carbon-carbon bonds, approximately 7 carbon-carbon bonds to 11 carbon-carbon bonds, or approximately 9 carbon-carbon bonds.
  • the length is equal to approximately 8 carbon-carbon bonds to 16 carbon-carbon bonds, approximately 10 carbon-carbon bonds to 14 carbon-carbon bonds, or approximately 12 carbon-carbon bonds.
  • the macrocycle-forming linker spans approximately 3 turns of an ⁇ -helix, the length is equal to approximately 14 carbon-carbon bonds to 22 carbon-carbon bonds, approximately 16 carbon-carbon bonds to 20 carbon-carbon bonds, or approximately 18 carbon-carbon bonds.
  • the length is equal to approximately 20 carbon-carbon bonds to 28 carbon-carbon bonds, approximately 22 carbon-carbon bonds to 26 carbon-carbon bonds, or approximately 24 carbon-carbon bonds.
  • the macrocycle-forming linker spans approximately 5 turns of an ⁇ -helix, the length is equal to approximately 26 carbon-carbon bonds to 34 carbon-carbon bonds, approximately 28 carbon-carbon bonds to 32 carbon-carbon bonds, or approximately 30 carbon-carbon bonds.
  • the linkage contains approximately 4 atoms to 12 atoms, approximately 6 atoms to 10 atoms, or approximately 8 atoms.
  • the linkage contains approximately 7 atoms to 15 atoms, approximately 9 atoms to 13 atoms, or approximately 11 atoms.
  • the linkage contains approximately 13 atoms to 21 atoms, approximately 15 atoms to 19 atoms, or approximately 17 atoms.
  • the linkage contains approximately 19 atoms to 27 atoms, approximately 21 atoms to 25 atoms, or approximately 23 atoms.
  • the linkage contains approximately 25 atoms to 33 atoms, approximately 27 atoms to 31 atoms, or approximately 29 atoms.
  • the resulting macrocycle forms a ring containing approximately 17 members to 25 members, approximately 19 members to 23 members, or approximately 21 members.
  • the macrocycle-forming linker spans approximately 2 turns of the ⁇ -helix, the resulting macrocycle forms a ring containing approximately 29 members to 37 members, approximately 31 members to 35 members, or approximately 33 members.
  • the resulting macrocycle forms a ring containing approximately 44 members to 52 members, approximately 46 members to 50 members, or approximately 48 members.
  • the resulting macrocycle forms a ring containing approximately 59 members to 67 members, approximately 61 members to 65 members, or approximately 63 members.
  • the macrocycle-forming linker spans approximately 5 turns of the ⁇ -helix, the resulting macrocycle forms a ring containing approximately 74 members to 82 members, approximately 76 members to 80 members, or approximately 78 members.
  • L is a macrocycle-forming linker of the formula
  • the peptidomimetic macrocycle comprises an amino acid sequence of formula:
  • X1 is Ile, Arg, Ala, Lys, Pro, Leu, Asp, Glu, His, Ser, Gln, Phe, an analog thereof, or absent.
  • X2 is Trp, Arg, Ala, Asn, Phe, Pro, Leu, Ser, Lys, Tyr, His, Cou, Cou2, Cou4, Cou7, an analog thereof, a crosslinked amino acid, or absent.
  • X3 is Ile, Ala, Leu, Phe, Tyr,Val, Asp, Trp, Pro, Gln, Chg, Ac5c, Ac6c, Tba, Bip, Cha, Adm, hCha, an analog thereof, or absent.
  • X4 is Ala, Gln, Asp, Val, Gly, Ser, Leu, Phe, Cha, A4, an analog, thereof, a crosslinked amino acid, or absent.
  • X5 is Gln, Ala, Leu, Phe, Tyr, Gly, Ile, Val, Arg, Glu, Pro, Asp, MO, M02, an analog thereof, a crosslinked amino acid, or absent.
  • X6 is Glu, Gln, His, Ala, Ser, Arg, Ile, Leu, Thr, Phe, Val, Tyr, Gly, Nle, St, an analog thereof, or absent.
  • X7 is Ala, Leu, Phe, Ile, 2Nal, 1Nal, 3cf, Chg, Cha, Adm, hCha, Igl, Bip, an analog thereof, or absent.
  • X8 is Arg, Ala, Asp, Glu, Thr, His, Gln, Gly, Asn, Phe, Cit, St, an analog thereof, a crosslinked amino acid, or absent.
  • X9 is Arg, Ala, Asp, Lys, Asn, Gly, Ser, Gln, Cys, Nle, St, an analog thereof, or a crosslinked amino acid.
  • X10 is Ile, Val, Ala, Asp, Asn, Phe, Tba, hL, hhL, Nle, Chg, Cha, an analog thereof, or a crosslinked amino acid.
  • X11 is Gly, Val, Ala, Leu, Ile, Asp, Glu, Cha, Aib, Abu, an analog thereof, or a crosslinked amino acid.
  • X12 is Asp, Ala, Asn, Gly, Arg, Glu, Lys, Leu, Nle, an analog thereof, or a crosslinked amino acid.
  • X13 is Ala, Glu, Gln, Leu, Lys, Asp, Tyr, Ile, Ser, Cys, St, Sta5, Aib, Nle, an analog thereof, or a crosslinked amino acid.
  • X14 is Phe, Ala, Leu, Val, Tyr, Glu, His, Ile, Nle, 1Nal, 2Nal, Chg, Cha, BiP, an analog thereof, or a crosslinked amino acid.
  • X15 is Asn, Gln, Ser, His, Glu, Asp, Ala, Leu, Ile, St, Nle, Aib, an analog thereof, a crosslinked amino acid, or absent.
  • X16 is Ala, Glu, Asp, Arg, Lys, Phe, Gly, Gln, Aib, Cha, St, an analog thereof, a crosslinked amino acid, or absent.
  • X17 is Phe, Tyr, Ala, Leu, Asn, Ser, Gln, Arg, His, Thr, Cou2, Cou3, Cou7, Dpr, Amf, Damf, Amye, an analog thereof, a crosslinked amino acid, or absent.
  • X18 is Tyr, Ala, Ile, Phe, His, Arg, Lys, Trp, Orn, Amf, Amye, Cha, 2Nal, an analog thereof, or absent.
  • X19 is Ala, Lys, Arg, His, Ser, Gln, Glu, Asp, Thr, Aib, Cha, an analog thereof, a crosslinked amino acid, or absent.
  • X20 is Arg, His, Ala, Thr, Lys, Amr, an analog thereof, a crosslinked amino acid, or absent.
  • X21 is Arg, His, Ala, Amr, an analog thereof, or absent.
  • the peptidomimetic macrocycle comprises a helix.
  • the peptidomimetic macrocycle comprises an ⁇ -helix.
  • the peptidomimetic macrocycle comprises an ⁇ , ⁇ -disubstituted amino acid.
  • each amino acid connected by the macrocycle-forming linker is an ⁇ , ⁇ -disubstituted amino acid.
  • Peptidomimetic macrocycles of the invention may be prepared by any of a variety of methods known in the art.
  • any of the residues indicated by “X”, “Z” or “XX” in Tables 1 or 2 may be substituted with a residue capable of forming a crosslinker with a second residue in the same molecule or a precursor of such a residue.
  • the “S5-olefin amino acid” is (S)- ⁇ -(2′-pentenyl) alanine and the “R8 olefin amino acid” is (R)- ⁇ -(2′-octenyl) alanine.
  • the terminal olefins are reacted with a metathesis catalyst, leading to the formation of the peptidomimetic macrocycle.
  • the following amino acids may be employed in the synthesis of the peptidomimetic macrocycle:
  • x+y+z is 3, and A, B and C are independently natural or non-natural amino acids. In other embodiments, x+y+z is 6, and A, B and C are independently natural or non-natural amino acids.
  • the contacting step is performed in a solvent selected from the group consisting of protic solvent, aqueous solvent, organic solvent, and mixtures thereof.
  • the solvent may be chosen from the group consisting of H 2 O, THF, THF/H 2 O, tBuOH/H 2 O, DMF, DIPEA, CH 3 CN or CH 2 Cl 2 , ClCH 2 CH 2 Cl or a mixture thereof.
  • the solvent may be a solvent which favors helix formation.
  • peptidomimetic macrocycles disclosed herein are made, for example, by chemical synthesis methods, such as described in Fields et al., Chapter 3 in Synthetic Peptides: A User's Guide, ed. Grant, W. H. Freeman & Co., New York, N. Y., 1992, p. 77.
  • peptides are synthesized using the automated Merrifield techniques of solid phase synthesis with the amine protected by either tBoc or Fmoc chemistry using side chain protected amino acids on, for example, an automated peptide synthesizer (e.g., Applied Biosystems (Foster City, Calif.), Model 430A, 431, or 433).
  • One manner of producing the peptidomimetic precursors and peptidomimetic macrocycles described herein uses solid phase peptide synthesis (SPPS).
  • SPPS solid phase peptide synthesis
  • the C-terminal amino acid is attached to a cross-linked polystyrene resin via an acid labile bond with a linker molecule.
  • This resin is insoluble in the solvents used for synthesis, making it relatively simple and fast to wash away excess reagents and by-products.
  • the N-terminus is protected with the Fmoc group, which is stable in acid, but removable by base. Side chain functional groups are protected as necessary with base stable, acid labile groups.
  • peptidomimetic precursors are produced, for example, by conjoining individual synthetic peptides using native chemical ligation. Alternatively, the longer synthetic peptides are biosynthesized by well known recombinant DNA and protein expression techniques. Such techniques are provided in well-known standard manuals with detailed protocols.
  • To construct a gene encoding a peptidomimetic precursor of this invention the amino acid sequence is reverse translated to obtain a nucleic acid sequence encoding the amino acid sequence, preferably with codons that are optimum for the organism in which the gene is to be expressed.
  • a synthetic gene is made, typically by synthesizing oligonucleotides which encode the peptide and any regulatory elements, if necessary.
  • the synthetic gene is inserted in a suitable cloning vector and transfected into a host cell. The peptide is then expressed under suitable conditions appropriate for the selected expression system and host.
  • the peptide is purified and characterized by standard methods.
  • the peptidomimetic precursors are made, for example, in a high-throughput, combinatorial fashion using, for example, a high-throughput polychannel combinatorial synthesizer (e.g., Thuramed TETRAS multichannel peptide synthesizer from CreoSalus, Louisville, Ky. or Model Apex 396 multichannel peptide synthesizer from AAPPTEC, Inc., Louisville, Ky.).
  • a high-throughput polychannel combinatorial synthesizer e.g., Thuramed TETRAS multichannel peptide synthesizer from CreoSalus, Louisville, Ky. or Model Apex 396 multichannel peptide synthesizer from AAPPTEC, Inc., Louisville, Ky.
  • the peptidomimetic macrocyles of the invention comprise triazole macrocycle-forming linkers.
  • the synthesis of such peptidomimetic macrocycles involves a multi-step process that features the synthesis of a peptidomimetic precursor containing an azide moiety and an alkyne moiety; followed by contacting the peptidomimetic precursor with a macrocyclization reagent to generate a triazole-linked peptidomimetic macrocycle.
  • a multi-step process that features the synthesis of a peptidomimetic precursor containing an azide moiety and an alkyne moiety
  • a macrocyclization reagent to generate a triazole-linked peptidomimetic macrocycle.
  • Macrocycles or macrocycle precursors are synthesized, for example, by solution phase or solid-phase methods, and can contain both naturally-occurring and non-naturally-occurring amino acids. See, for example, Hunt, “The Non-Protein Amino Acids” in Chemistry and Biochemistry of the Amino Acids, edited by G. C. Barrett, Chapman and Hall, 1985.
  • an azide is linked to the ⁇ -carbon of a residue and an alkyne is attached to the ⁇ -carbon of another residue.
  • the azide moieties are azido-analogs of amino acids L-lysine, D-lysine, alpha-methyl-L-lysine, alpha-methyl-D-lysine, L-ornithine, D-ornithine, alpha-methyl-L-ornithine or alpha-methyl-D-ornithine.
  • the alkyne moiety is L-propargylglycine.
  • the alkyne moiety is an amino acid selected from the group consisting of L-propargylglycine, D-propargylglycine, (S)-2-amino-2-methyl-4-pentynoic acid, (R)-2-amino-2-methyl-4-pentynoic acid, (S)-2-amino-2-methyl-5-hexynoic acid, (R)-2-amino-2-methyl-5-hexynoic acid, (S)-2-amino-2-methyl-6-heptynoic acid, (R)-2-amino-2-methyl-6-heptynoic acid, (S)-2-amino-2-methyl-7-octynoic acid, (R)-2-amino-2-methyl-7-octynoic acid, (S)-2-amino-2-methyl-8-nonynoic acid and (R)-2-amino-2-methyl-8-nonynoic acid.
  • each R 1 , R 2 , R 7 and R 8 is —H; each L 1 is —(CH 2 ) 4 —; and each L 2 is —(CH 2 )—.
  • R 1 , R 2 , R 7 , R 8 , L 1 and L 2 can be independently selected from the various structures disclosed herein.
  • Synthetic Scheme 1 describes the preparation of several compounds of the invention.
  • Ni(II) complexes of Schiff bases derived from the chiral auxiliary (S)-2-[N-(N′-benzylprolyl)amino]benzophenone (BPB) and amino acids such as glycine or alanine are prepared as described in Belokon et al. (1998), Tetrahedron Asymm. 9:4249-4252.
  • the resulting complexes are subsequently reacted with alkylating reagents comprising an azido or alkynyl moiety to yield enantiomerically enriched compounds of the invention. If desired, the resulting compounds can be protected for use in peptide synthesis.
  • the peptidomimetic precursor contains an azide moiety and an alkyne moiety and is synthesized by solution-phase or solid-phase peptide synthesis (SPPS) using the commercially available amino acid N- ⁇ -Fmoc-L-propargylglycine and the N- ⁇ -Fmoc-protected forms of the amino acids (S)-2-amino-2-methyl-4-pentynoic acid, (S)-2-amino-6-heptynoic acid, (S)-2-amino-2-methyl-6-heptynoic acid, N-methyl- ⁇ -azido-L-lysine, and N-methyl- ⁇ -azido-D-lysine.
  • SPPS solution-phase or solid-phase peptide synthesis
  • the peptidomimetic precursor is then deprotected and cleaved from the solid-phase resin by standard conditions (e.g., strong acid such as 95% TFA).
  • the peptidomimetic precursor is reacted as a crude mixture or is purified prior to reaction with a macrocyclization reagent such as a Cu(I) in organic or aqueous solutions (Rostovtsev et al. (2002), Angew. Chem. Int. Ed. 41:2596-2599; Tornoe et al. (2002), J. Org. Chem. 67:3057-3064; Deiters et al. (2003), J. Am. Chem. Soc.
  • the triazole forming reaction is performed under conditions that favor ⁇ -helix formation.
  • the macrocyclization step is performed in a solvent chosen from the group consisting of H 2 O, THF, CH 3 CN, DMF , DIPEA, tBuOH or a mixture thereof.
  • the macrocyclization step is performed in DMF.
  • the macrocyclization step is performed in a buffered aqueous or partially aqueous solvent.
  • the peptidomimetic precursor contains an azide moiety and an alkyne moiety and is synthesized by solid-phase peptide synthesis (SPPS) using the commercially available amino acid N- ⁇ -Fmoc-L-propargylglycine and the N- ⁇ -Fmoc-protected forms of the amino acids (S)-2-amino-2-methyl-4-pentynoic acid, (S)-2-amino-6-heptynoic acid, (S)-2-amino-2-methyl-6-heptynoic acid, N-methyl- ⁇ -azido-L-lysine, and N-methyl- ⁇ -azido-D-lysine.
  • SPPS solid-phase peptide synthesis
  • the peptidomimetic precursor is reacted with a macrocyclization reagent such as a Cu(I) reagent on the resin as a crude mixture
  • a macrocyclization reagent such as a Cu(I) reagent
  • the resultant triazole-containing peptidomimetic macrocycle is then deprotected and cleaved from the solid-phase resin by standard conditions (e.g., strong acid such as 95% TFA).
  • the macrocyclization step is performed in a solvent chosen from the group consisting of CH 2 Cl 2 , ClCH 2 CH 2 Cl, DMF, THF, NMP, DIPEA, 2,6-lutidine, pyridine, DMSO, H 2 O or a mixture thereof.
  • the macrocyclization step is performed in a buffered aqueous or partially aqueous solvent.
  • the peptidomimetic precursor contains an azide moiety and an alkyne moiety and is synthesized by solution-phase or solid-phase peptide synthesis (SPPS) using the commercially available amino acid N- ⁇ -Fmoc-L-propargylglycine and the N- ⁇ -Fmoc-protected forms of the amino acids (S)-2-amino-2-methyl-4-pentynoic acid, (S)-2-amino-6-heptynoic acid, (S)-2-amino-2-methyl-6-heptynoic acid, N-methyl- ⁇ -azido-L-lysine, and N-methyl- ⁇ -azido-D-lysine.
  • SPPS solution-phase or solid-phase peptide synthesis
  • the peptidomimetic precursor is then deprotected and cleaved from the solid-phase resin by standard conditions (e.g., strong acid such as 95% TFA).
  • the peptidomimetic precursor is reacted as a crude mixture or is purified prior to reaction with a macrocyclization reagent such as a Ru(II) reagents, for example Cp*RuCl(PPh 3 ) 2 or [Cp*RuCl] 4 (Rasmussen et al. (2007), Org. Lett. 9:5337-5339; Zhang et al. (2005), J. Am. Chem. Soc. 127:15998-15999).
  • the macrocyclization step is performed in a solvent chosen from the group consisting of DMF, CH 3 CN and THF.
  • the peptidomimetic precursor contains an azide moiety and an alkyne moiety and is synthesized by solid-phase peptide synthesis (SPPS) using the commercially available amino acidN- ⁇ -Fmoc-L-propargylglycine and the N- ⁇ -Fmoc-protected forms of the amino acids (S)-2-amino-2-methyl-4-pentynoic acid, (S)-2-amino-6-heptynoic acid, (S)-2-amino-2-methyl-6-heptynoic acid, N-methyl- ⁇ -azido-L-lysine, and N-methyl- ⁇ -azido-D-lysine.
  • SPPS solid-phase peptide synthesis
  • the peptidomimetic precursor is reacted with a macrocyclization reagent such as a Ru(II) reagent on the resin as a crude mixture.
  • a macrocyclization reagent such as a Ru(II) reagent on the resin as a crude mixture.
  • the reagent can be Cp*RuCl(PPh 3 ) 2 or [Cp*RuCl] 4 (Rasmussen et al. (2007), Org. Lett. 9:5337-5339; Zhang et al. (2005), J. Am. Chem. Soc. 127:15998-15999).
  • the macrocyclization step is performed in a solvent chosen from the group consisting of CH 2 Cl 2 , ClCH 2 CH 2 Cl, CH 3 CN, DMF, and THF.
  • a peptidomimetic macrocycle of Formula I comprises a halogen group substitution on a triazole moiety, for example an iodo substitution.
  • Such peptidomimetic macrocycles may be prepared from a precursor having the partial structure and using the cross-linking methods taught herein. Crosslinkers of any length, as described herein, may be prepared comprising such substitutions.
  • the peptidomimetic macrocycle is prepared according to the scheme shown below. The reaction is peformed, for example, in the presence of CuI and an amine ligand such as TEA or TTTA. See, e.g., Hein et al. Angew. Chem., Int. Ed. 2009, 48, 8018-8021.
  • an iodo-substituted triazole is generated according to the scheme shown below.
  • the second step in the reaction scheme below is performed using, for example, CuI and N-bromosuccinimide (NBS) in the presence of THF (see, e.g. Zhang et al., J. Org. Chem. 2008, 73, 3630-3633).
  • the second step in the reaction scheme shown below is performed, for example, using CuI and an iodinating agent such as ICl (see, e.g. Wu et al., Synthesis 2005, 1314-1318.)
  • an iodo-substituted triazole moiety is used in a cross-coupling reaction, such as a Suzuki or Sonogashira coupling, to afford a peptidomimetic macrocycle comprising a substituted crosslinker.
  • Sonogashira couplings using an alkyne as shown below may be performed, for example, in the presence of a palladium catalyst such as Pd(PPh 3 ) 2 Cl 2 , CuI, and in the presence of a base such as triethylamine.
  • Suzuki couplings using an arylboronic or substituted alkenyl boronic acid as shown below may be performed, for example, in the presence of a catalyst such as Pd(PPh 3 ) 4, and in the presence of a base such as K 2 CO 3 .
  • a catalyst such as Pd(PPh 3 ) 4
  • a base such as K 2 CO 3
  • Cyc is a suitable aryl, cycloalkyl, cycloalkenyl, heteroaryl, or heterocyclyl group, unsubstituted or optionally substituted with an R a or R b group as described below.
  • the substituent is:
  • Cyc is a suitable aryl, cycloalkyl, cycloalkenyl, heteroaryl, or heterocyclyl group, unsubstituted or optionally substituted with an R a or R b group as described below.
  • the triazole substituent is:
  • the Cyc group shown above is further substituted by at least one R a or R b substituent.
  • at least one of R a and R b is independently:
  • the triazole substituent is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl
  • R a and R b is alkyl (including hydrogen, methyl, or ethyl), or:
  • the present invention contemplates the use of non-naturally-occurring amino acids and
  • the present invention contemplates the use of non-naturally-occurring amino acids and amino acid analogs in the synthesis of the peptidomimetic macrocycles described herein.
  • Any amino acid or amino acid analog amenable to the synthetic methods employed for the synthesis of stable triazole containing peptidomimetic macrocycles can be used in the present invention.
  • L-propargylglycine is contemplated as a useful amino acid in the present invention.
  • other alkyne-containing amino acids that contain a different amino acid side chain are also useful in the invention.
  • L-propargylglycine contains one methylene unit between the ⁇ -carbon of the amino acid and the alkyne of the amino acid side chain.
  • the invention also contemplates the use of amino acids with multiple methylene units between the ⁇ -carbon and the alkyne.
  • the azido-analogs of amino acids L-lysine, D-lysine, alpha-methyl-L-lysine, and alpha-methyl-D-lysine are contemplated as useful amino acids in the present invention.
  • other terminal azide amino acids that contain a different amino acid side chain are also useful in the invention.
  • the azido-analog of L-lysine contains four methylene units between the ⁇ -carbon of the amino acid and the terminal azide of the amino acid side chain.
  • the invention also contemplates the use of amino acids with fewer than or greater than four methylene units between the ⁇ -carbon and the terminal azide. Table 2 shows some amino acids useful in the preparation of peptidomimetic macrocycles disclosed herein.
  • the amino acids and amino acid analogs are of the D-configuration. In other embodiments they are of the L-configuration. In some embodiments, some of the amino acids and amino acid analogs contained in the peptidomimetic are of the D-configuration while some of the amino acids and amino acid analogs are of the L-configuration. In some embodiments the amino acid analogs are ⁇ , ⁇ -disubstituted, such as ⁇ -methyl-L-propargylglycine, ⁇ -methyl-D-propargylglycine, ⁇ -azido-alpha-methyl-L-lysine, and ⁇ -azido-alpha-methyl-D-lysine.
  • amino acid analogs are N-alkylated, e.g., N-methyl-L-propargylglycine, N-methyl-D-propargylglycine, N-methyl- ⁇ -azido-L-lysine, and N-methyl- ⁇ -azido-D-lysine.
  • the —NH moiety of the amino acid is protected using a protecting group, including without limitation -Fmoc and -Boc. In other embodiments, the amino acid is not protected prior to synthesis of the peptidomimetic macrocycle.
  • the —NH moiety of the amino acid is protected using a protecting group, including without limitation -Fmoc and -Boc. In other embodiments, the amino acid is not protected prior to synthesis of the peptidomimetic macrocycle.
  • the peptidomimetic precursor contains two —SH moieties and is synthesized by solid-phase peptide synthesis (SPPS) using commercially available N- ⁇ -Fmoc amino acids such as N- ⁇ -Fmoc-S-trityl-L-cysteine or N- ⁇ -Fmoc-S-trityl-D-cysteine.
  • SPPS solid-phase peptide synthesis
  • Alpha-methylated versions of D-cysteine or L-cysteine are generated by known methods (Seebach et al. (1996), Angew. Chem. Int. Ed. Engl.
  • N- ⁇ -Fmoc-S-trityl monomers by known methods (“ Bioorganic Chemistry: Peptides and Proteins ”, Oxford University Press, New York: 1998, the entire contents of which are incorporated herein by reference).
  • the precursor peptidomimetic is then deprotected and cleaved from the solid-phase resin by standard conditions (e.g., strong acid such as 95% TFA).
  • the precursor peptidomimetic is reacted as a crude mixture or is purified prior to reaction with X-L 2 -Y in organic or aqueous solutions.
  • the alkylation reaction is performed under dilute conditions (i.e.
  • the alkylation reaction is performed in organic solutions such as liquid NH 3 (Mosberg et al. (1985), J. Am.Chem. Soc. 107:2986-2987; Szewczuk et al. (1992), Int. J. Peptide Protein Res. 40 :233-242), NH 3 /MeOH, or NH 3 /DMF (Or et al. (1991), J. Org. Chem. 56:3146-3149).
  • the alkylation is performed in an aqueous solution such as 6M guanidinium HCL, pH 8 (Brunel et al. (2005), Chem. Commun. (20):2552-2554).
  • the solvent used for the alkylation reaction is DMF or dichloroethane.
  • the precursor peptidomimetic contains two or more —SH moieties, of which two are specially protected to allow their selective deprotection and subsequent alkylation for macrocycle formation.
  • the precursor peptidomimetic is synthesized by solid-phase peptide synthesis (SPPS) using commercially available N- ⁇ -Fmoc amino acids such as N- ⁇ -Fmoc-S-p-methoxytrityl-L-cysteine or N- ⁇ -Fmoc-S-p-methoxytrityl-D-cysteine.
  • SPPS solid-phase peptide synthesis
  • Alpha-methylated versions of D-cysteine or L-cysteine are generated by known methods (Seebach et al. (1996), Angew. Chem. Int. Ed.
  • the alkylation reaction is performed in organic solutions such as liquid NH 3 (Mosberg et al. (1985), J. Am. Chem. Soc. 107:2986-2987; Szewczuk et al. (1992), Int. J. Peptide Protein Res. 40 :233-242), NH 3 /MeOH or NH 3 /DMF (Or et al. (1991), J. Org. Chem. 56:3146-3149).
  • the alkylation reaction is performed in DMF or dichloroethane.
  • the peptidomimetic macrocycle is then deprotected and cleaved from the solid-phase resin by standard conditions (e.g., strong acid such as 95% TFA).
  • the peptidomimetic precursor contains two or more —SH moieties, of which two are specially protected to allow their selective deprotection and subsequent alkylation for macrocycle formation.
  • the peptidomimetic precursor is synthesized by solid-phase peptide synthesis (SPPS) using commercially available N- ⁇ -Fmoc amino acids such as N- ⁇ -Fmoc-S-p-methoxytrityl-L-cysteine, N- ⁇ -Fmoc-S-p-methoxytrityl-D-cysteine, N- ⁇ -Fmoc-S-S-t-butyl-L-cysteine, and N- ⁇ -Fmoc-S-S-t-butyl-D-cysteine.
  • SPPS solid-phase peptide synthesis
  • Alpha-methylated versions of D-cysteine or L-cysteine are generated by known methods (Seebach et al. (1996), Angew. Chem. Int. Ed. Engl. 35:2708-2748, and references therein) and then converted to the appropriately protected N- ⁇ -Fmoc-S-p-methoxytrityl or N- ⁇ -Fmoc-S-S-t-butyl monomers by known methods ( Bioorganic Chemistry: Peptides and Proteins, Oxford University Press, New York: 1998, the entire contents of which are incorporated herein by reference).
  • the S-S-tButyl protecting group of the peptidomimetic precursor is selectively cleaved by known conditions (e.g., 20% 2-mercaptoethanol in DMF, reference: Gauß et al. (2005), J. Comb. Chem. 7:174-177).
  • the precursor peptidomimetic is then reacted on the resin with a molar excess of X-L 2 -Y in an organic solution.
  • the reaction takes place in the presence of a hindered base such as diisopropylethylamine.
  • the Mmt protecting group of the peptidomimetic precursor is then selectively cleaved by standard conditions (e.g., mild acid such as 1% TFA in DCM).
  • the peptidomimetic precursor is then cyclized on the resin by treatment with a hindered base in organic solutions.
  • the alkylation reaction is performed in organic solutions such as NH 3 /MeOH or NH 3 /DMF (Or et al. (1991), J. Org. Chem. 56:3146-3149).
  • the peptidomimetic macrocycle is then deprotected and cleaved from the solid-phase resin by standard conditions (e.g., strong acid such as 95% TFA).
  • the peptidomimetic precursor contains two L-cysteine moieties.
  • the peptidomimetic precursor is synthesized by known biological expression systems in living cells or by known in vitro, cell-free, expression methods.
  • the precursor peptidomimetic is reacted as a crude mixture or is purified prior to reaction with X-L2-Y in organic or aqueous solutions.
  • the alkylation reaction is performed under dilute conditions (i.e. 0.15 mmol/L) to favor macrocyclization and to avoid polymerization.
  • the alkylation reaction is performed in organic solutions such as liquid NH 3 (Mosberg et al. (1985), J. Am.Chem. Soc.
  • the alkylation is performed in an aqueous solution such as 6M guanidinium HCL, pH 8 (Brunel et al. (2005), Chem. Commun. (20):2552-2554). In other embodiments, the alkylation is performed in DMF or dichloroethane.
  • the alkylation is performed in non-denaturing aqueous solutions, and in yet another embodiment the alkylation is performed under conditions that favor ⁇ -helical structure formation. In yet another embodiment, the alkylation is performed under conditions that favor the binding of the precursor peptidomimetic to another protein, so as to induce the formation of the bound ⁇ -helical conformation during the alkylation.
  • X and Y are envisioned which are suitable for reacting with thiol groups.
  • each X or Y is independently be selected from the general category shown in Table 3.
  • X and Y are halides such as —Cl, —Br or —I.
  • Any of the macrocycle-forming linkers described herein may be used in any combination with any of the sequences shown and also with any of the R— substituents indicated herein.
  • the present invention contemplates the use of both naturally occurring and non-naturally-occurring amino acids and amino acid analogs in the synthesis of the peptidomimetic macrocycles of Formula IV.
  • Any amino acid or amino acid analog amenable to the synthetic methods employed for the synthesis of stable bis-sulfhydryl containing peptidomimetic macrocycles can be used in the present invention.
  • cysteine is contemplated as a useful amino acid in the present invention.
  • sulfur containing amino acids other than cysteine that contain a different amino acid side chain are also useful.
  • cysteine contains one methylene unit between the ⁇ -carbon of the amino acid and the terminal —SH of the amino acid side chain.
  • the invention also contemplates the use of amino acids with multiple methylene units between the ⁇ -carbon and the terminal —SH.
  • Non-limiting examples include ⁇ -methyl-L-homocysteine and ⁇ -methyl-D-homocysteine.
  • the amino acids and amino acid analogs are of the D-configuration. In other embodiments they are of the L-configuration.
  • some of the amino acids and amino acid analogs contained in the peptidomimetic are of the D-configuration while some of the amino acids and amino acid analogs are of the L-configuration.
  • the amino acid analogs are ⁇ , ⁇ -disubstituted, such as ⁇ -methyl-L-cysteine and ⁇ -methyl-D-cysteine.
  • the invention includes macrocycles in which macrocycle-forming linkers are used to link two or more —SH moieties in the peptidomimetic precursors to form the peptidomimetic macrocycles disclosed herein.
  • the macrocycle-forming linkers impart conformational rigidity, increased metabolic stability or increased cell penetrability.
  • the macrocycle-forming linkages stabilize the ⁇ -helical secondary structure of the peptidomimetic macrocyles.
  • the macrocycle-forming linkers are of the formula X-L 2 -Y, wherein both X and Y are the same or different moieties, as defined above.
  • Both X and Y have the chemical characteristics that allow one macrocycle-forming linker -L 2 - to bis alkylate the bis-sulfhydryl containing peptidomimetic precursor.
  • the linker -L 2 - includes alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, cycloarylene, or heterocycloarylene, or —R 4 —K—R 4 —, all of which can be optionally substituted with an R 5 group, as defined above.
  • one to three carbon atoms within the macrocycle-forming linkers -L 2 -, other than the carbons attached to the —SH of the sulfhydryl containing amino acid, are optionally substituted with a heteroatom such as N, S or O.
  • the L 2 component of the macrocycle-forming linker X-L 2 -Y may be varied in length depending on, among other things, the distance between the positions of the two amino acid analogs used to form the peptidomimetic macrocycle. Furthermore, as the lengths of L 1 or L 3 components of the macrocycle-forming linker are varied, the length of L 2 can also be varied in order to create a linker of appropriate overall length for forming a stable peptidomimetic macrocycle. For example, if the amino acid analogs used are varied by adding an additional methylene unit to each of L 1 and L 3 , the length of L 2 are decreased in length by the equivalent of approximately two methylene units to compensate for the increased lengths of L 1 and L 3 .
  • L 2 is an alkylene group of the formula —(CH 2 ) n —, where n is an integer between about 1 and about 15. For example, n is 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10. In other embodiments, L 2 is an alkenylene group. In still other embodiments, L 2 is an aryl group.
  • Table 4 shows additional embodiments of X-L 2 -Y groups.
  • Each X and Y in this Table is, for example, independently Cl—, Br— or I—.
  • peptidomimetic macrocycles which are envisioned as suitable to perform the present invention include those disclosed by Mustapa, M. Firouz Mohd et al., J. Org. Chem (2003), 68, pp. 8193-8198; Yang, Bin et al. Bioorg Med. Chem. Lett. (2004), 14, pp. 1403-1406; U.S. Pat. No. 5,364,851; U.S. Pat. No. 5,446,128; U.S. Pat. No. 5,824,483; U.S. Pat. No. 6,713,280; and U.S. Pat. No. 7,202,332.
  • amino acid precursors are used containing an additional substituent R— at the alpha position.
  • Such amino acids are incorporated into the macrocycle precursor at the desired positions, which may be at the positions where the crosslinker is substituted or, alternatively, elsewhere in the sequence of the macrocycle precursor. Cyclization of the precursor is then performed according to the indicated method.
  • a peptidomimetic macrocycle of Formula (II) is prepared as indicated:
  • each AA1, AA2, AA3 is independently an amino acid side chain.
  • a peptidomimetic macrocycle of Formula (II) is prepared as indicated:
  • each AA1, AA2, AA3 is independently an amino acid side chain.
  • a peptidomimetic macrocycle is obtained in more than one isomer, for example due to the configuration of a double bond within the structure of the crosslinker (E vs Z).
  • Such isomers can or can not be separable by conventional chromatographic methods.
  • one isomer has improved biological properties relative to the other isomer.
  • an E crosslinker olefin isomer of a peptidomimetic macrocycle has better solubility, better target affinity, better in vivo or in vitro efficacy, higher helicity, or improved cell permeability relative to its Z counterpart.
  • a Z crosslinker olefin isomer of a peptidomimetic macrocycle has better solubility, better target affinity, better in vivo or in vitro efficacy, higher helicity, or improved cell permeability relative to its E counterpart.
  • a compound described herein can be at least 1% pure, at least 2% pure, at least 3% pure, at least 4% pure, at least 5% pure, at least 6% pure, at least 7% pure, at least 8% pure, at least 9% pure, at least 10% pure, at least 11% pure, at least 12% pure, at least 13% pure, at least 14% pure, at least 15% pure, at least 16% pure, at least 17% pure, at least 18% pure, at least 19% pure, at least 20% pure, at least 21% pure, at least 22% pure, at least 23% pure, at least 24% pure, at least 25% pure, at least 26% pure, at least 27% pure, at least 28% pure, at least 29% pure, at least 30% pure, at least 31% pure, at least 32% pure, at least 33% pure, at least 34% pure, at least 35% pure, at least 36% pure, at least 37% pure, at least 38% pure, at least 39% pure, at least 40% pure, at least 41% pure, at least 42% pure, at
  • peptidomimetic macrocycles of the invention are assayed, for example, by using the methods described below.
  • a peptidomimetic macrocycle of the invention has improved biological properties relative to a corresponding polypeptide lacking the substituents described herein.
  • a peptidomimetic macrocycle disclosed herein binds MCL-1 selectively over another protein that has a BH3 domain.
  • the selectivity is a ratio of about 2 to about 1, about 3 to about 1, about 4 to about 1, about 5 to about 1, about 6 to about 1, about 7 to about 1, about 8 to about 1, about 9 to about 1, about 10 to about 1, about 20 to about 1, about 30 to about 1, about 40 to about 1, about 50 to about 1, about 60 to about 1, about 70 to about 1, about 80 to about 1, about 90 to about 1, about 100 to about 1, about 200 to about 1, about 300 to about 1, about 400 to about 1, about 500 to about 1, about 600 to about 1, about 700 to about 1, about 800 to about 1, about 900 to about 1, or about 1000 to about 1.
  • a peptidomimetic macrocycle disclosed herein non-selectively binds additional types of proteins that have a BH3 domain.
  • the non-selectivity is at least about 2 types of proteins, at least about 3 types of proteins, at least about 4 types of proteins, at least about 5 types of proteins, at least about 6 types of proteins, at least about 7 types of proteins, at least about 8 types of proteins, at least about 9 types of proteins, at least about 10 types of proteins, at least about 11 types of protein, at least about 12 types of proteins, at least about 13 types of proteins, at least about 14 types of proteins, at least about 15 types of proteins, at least about 16 types of proteins, at least about 17 types of proteins, at least about 18 types of proteins, at least about 19 types of proteins, or at least about 20 types of proteins.
  • the non-selectivity is from about 2 types of protein to about 3 types of protein, from about 3 types of protein to about 4 types of protein, from about 4 types of protein to about 5 types of protein, from about 5 types of protein to about 6 types of protein, from about 6 types of protein to about 7 types of protein, from about 7 types of protein to about 8 types of protein, from about 8 types of protein to about 9 types of protein, from about 9 types of protein to about 10 types of protein, from about 10 types of protein to about 11 types of protein, from about 11 types of protein to about 12 types of protein, from about 12 types of protein to about 13 types of protein, from about 13 types of protein to about 14 types of protein, from about 14 types of protein to about 15 types of protein, from about 15 types of protein to about 16 types of protein, from about 16 types of protein to about 17 types of protein, from about 17 types of protein to about 18 types of protein, from about 18 types of protein to about 19 types of protein, or from about 19 types of protein to about 20 types of protein.
  • polypeptides with ⁇ -helical domains will reach a dynamic equilibrium between random coil structures and ⁇ -helical structures, often expressed as a “percent helicity”.
  • alpha-helical domains are predominantly random coils in solution, with ⁇ -helical content usually under 25%.
  • Peptidomimetic macrocycles with optimized linkers possess, for example, an alpha-helicity that is at least two-fold greater than that of a corresponding uncrosslinked polypeptide.
  • macrocycles of the invention will possess an alpha-helicity of greater than 50%.
  • Circular dichroism (CD) spectra are obtained on a spectropolarimeter (e.g., Jasco J-710) using standard measurement parameters (e.g. temperature, 20° C.; wavelength, 190-260 nm; step resolution, 0.5 nm; speed, 20 nm/sec; accumulations, 10; response, 1 sec; bandwidth, 1 nm; path length, 0.1 cm).
  • standard measurement parameters e.g. temperature, 20° C.; wavelength, 190-260 nm; step resolution, 0.5 nm; speed, 20 nm/sec; accumulations, 10; response, 1 sec; bandwidth, 1 nm; path length, 0.1 cm).
  • the ⁇ -helical content of each peptide is calculated by dividing the mean residue ellipticity (e.g. [ ⁇ ]222obs) by the reported value for a model helical decapeptide (Yang et al. (1986), Methods Enzymol. 130:208)).
  • a peptidomimetic macrocycle of the invention comprising a secondary structure such as an ⁇ -helix exhibits, for example, a higher melting temperature than a corresponding uncrosslinked polypeptide.
  • peptidomimetic macrocycles of the invention exhibit Tm of >60° C. representing a highly stable structure in aqueous solutions.
  • Tm is determined by measuring the change in ellipticity over a temperature range (e.g.
  • spectropolarimeter e.g., Jasco J-710
  • standard parameters e.g. wavelength 222 nm; step resolution, 0.5 nm; speed, 20 nm/sec; accumulations, 10; response, 1 sec; bandwidth, 1 nm; temperature increase rate: 1° C./min; path length, 0.1 cm.
  • the amide bond of the peptide backbone is susceptible to hydrolysis by proteases, thereby rendering peptidic compounds vulnerable to rapid degradation in vivo. Peptide helix formation, however, typically buries the amide backbone and therefore may shield it from proteolytic cleavage.
  • the peptidomimetic macrocycles of the present invention may be subjected to in vitro trypsin proteolysis to assess for any change in degradation rate compared to a corresponding uncrosslinked polypeptide.
  • the peptidomimetic macrocycle and a corresponding uncrosslinked polypeptide are incubated with trypsin agarose and the reactions quenched at various time points by centrifugation and subsequent HPLC injection to quantitate the residual substrate by ultraviolet absorption at 280 nm.
  • the peptidomimetic macrocycle and peptidomimetic precursor (5 mcg) are incubated with trypsin agarose (Pierce) (S/E ⁇ 125) for 0, 10, 20, 90, and 180 minutes. Reactions are quenched by tabletop centrifugation at high speed; remaining substrate in the isolated supernatant is quantified by HPLC-based peak detection at 280 nm.
  • Peptidomimetic macrocycles with optimized linkers possess, for example, an ex vivo half-life that is at least two-fold greater than that of a corresponding uncrosslinked polypeptide, and possess an ex vivo half-life of 12 hours or more.
  • assays may be used. For example, a peptidomimetic macrocycle and a corresponding uncrosslinked polypeptide (2 mcg) are incubated with fresh mouse, rat or human serum (2 mL) at 37° C. for 0, 1, 2, 4, 8, and 24 hours.
  • the samples are extracted by transferring 100 ⁇ l of sera to 2 ml centrifuge tubes followed by the addition of 10 ⁇ L of 50% formic acid and 500 ⁇ L acetonitrile and centrifugation at 14,000 RPM for 10 min at 4 ⁇ 2° C. The supernatants are then transferred to fresh 2 ml tubes and evaporated on Turbovap under N 2 ⁇ 10 psi, 37° C. The samples are reconstituted in 100 ⁇ L of 50:50 acetonitrile:water and submitted to LC-MS/MS analysis.
  • FPA fluorescence polarization assay
  • fluoresceinated peptidomimetic macrocycles (25 nM) are incubated with the acceptor protein (25-1000 nM) in binding buffer (140 mM NaCl, 50 mM Tris-HCL, pH 7.4) for 30 minutes at room temperature. Binding activity is measured, for example, by fluorescence polarization on a luminescence spectrophotometer (e.g. Perkin-Elmer LS50B). Kd values may be determined by nonlinear regression analysis using, for example, Graphpad Prism software (GraphPad Software, Inc., San Diego, Calif.).
  • a peptidomimetic macrocycle of the invention shows, in some instances, similar or lower Kd than a corresponding uncrosslinked polypeptide.
  • a fluorescence polarization assay utilizing a fluoresceinated peptidomimetic macrocycle derived from a peptidomimetic precursor sequence is used, for example.
  • the FPA technique measures the molecular orientation and mobility using polarized light and fluorescent tracer.
  • fluorescent tracers e.g., FITC
  • FITC-labeled peptides bound to a large protein When excited with polarized light, fluorescent tracers (e.g., FITC) attached to molecules with high apparent molecular weights (e.g. FITC-labeled peptides bound to a large protein) emit higher levels of polarized fluorescence due to their slower rates of rotation as compared to fluorescent tracers attached to smaller molecules (e.g. FITC-labeled peptides that are free in solution).
  • a compound that antagonizes the interaction between the fluoresceinated peptidomimetic macrocycle and an acceptor protein will be detected in a competitive binding FPA experiment
  • putative antagonist compounds (1 nM to 1 mM) and a fluoresceinated peptidomimetic macrocycle (25 nM) are incubated with the acceptor protein (50 nM) in binding buffer (140mM NaCl, 50 mM Tris-HCL, pH 7.4) for 30 minutes at room temperature.
  • Antagonist binding activity is measured, for example, by fluorescence polarization on a luminescence spectrophotometer (e.g. Perkin-Elmer LS50B).
  • Kd values may be determined by nonlinear regression analysis using, for example, Graphpad Prism software (GraphPad Software, Inc., San Diego, Calif.).
  • Any class of molecule such as small organic molecules, peptides, oligonucleotides or proteins can be examined as putative antagonists in this assay.
  • an affinity-selection mass spectrometry assay is used, for example.
  • Protein-ligand binding experiments are conducted according to the following representative procedure outlined for a system-wide control experiment using 1 ⁇ M peptidomimetic macrocycle plus 5 ⁇ M target protein.
  • a 1 ⁇ L DMSO aliquot of a 40 ⁇ M stock solution of peptidomimetic macrocycle is dissolved in 19 ⁇ L of PBS (Phosphate-buffered saline: 50 mM, pH 7.5 Phosphate buffer containing 150 mM NaCl).
  • PBS Phosphate-buffered saline: 50 mM, pH 7.5 Phosphate buffer containing 150 mM NaCl.
  • the resulting solution is mixed by repeated pipetting and clarified by centrifugation at 10 000 g for 10 min.
  • the SEC column eluate is monitored using UV detectors to confirm that the early-eluting protein fraction, which elutes in the void volume of the SEC column, is well resolved from unbound components that are retained on the column.
  • the peak containing the protein and protein-ligand complexes elutes from the primary UV detector, it enters a sample loop where it is excised from the flow stream of the SEC stage and transferred directly to the LC-MS via a valving mechanism.
  • the (M+3H) 3+ ion of the peptidomimetic macrocycle is observed by ESI-MS at the expected m/z, confirming the detection of the protein-ligand complex.
  • Protein-ligand K d titrations experiments are conducted as follows: 2 ⁇ L DMSO aliquots of a serially diluted stock solution of titrant peptidomimetic macrocycle (5, 2.5, . . . , 0.098 mM) are prepared then dissolved in 38 ⁇ L of PBS. The resulting solutions are mixed by repeated pipetting and clarified by centrifugation at 10 000 g for 10 min. To 4.0 ⁇ L aliquots of the resulting supernatants is added 4.0 ⁇ L of 10 ⁇ M target protein in PBS.
  • Each 8.0 ⁇ L experimental sample thus contains 40 pmol (1.5 ⁇ g) of protein at 5.0 ⁇ M concentration in PBS, varying concentrations (125, 62.5, . . . , 0.24 ⁇ M) of the titrant peptide, and 2.5% DMSO.
  • Duplicate samples thus prepared for each concentration point are incubated at room temperature for 30 min, then chilled to 4° C. prior to SEC-LC-MS analysis of 2.0 ⁇ L injections.
  • an affinity selection mass spectrometry assay is performed, for example.
  • a mixture of ligands at 40 ⁇ M per component is prepared by combining 2 ⁇ L aliquots of 400 ⁇ M stocks of each of the three compounds with 14 ⁇ L of DMSO. Then, 1 ⁇ L aliquots of this 40 ⁇ M per component mixture are combined with 1 ⁇ L DMSO aliquots of a serially diluted stock solution of titrant peptidomimetic macrocycle (10, 5, 2.5, . . . , 0.078 mM). These 2 ⁇ L samples are dissolved in 38 ⁇ L of PBS.
  • the resulting solutions were mixed by repeated pipetting and clarified by centrifugation at 10 000 g for 10 min.
  • To 4.0 ⁇ L aliquots of the resulting supernatants is added 4.0 ⁇ L of 10 ⁇ M target protein in PBS.
  • Each 8.0 ⁇ L experimental sample thus contains 40 pmol (1.5 ⁇ g) of protein at 5.0 ⁇ M concentration in PBS plus 0.5 ⁇ M ligand, 2.5% DMSO, and varying concentrations (125, 62.5, . . . , 0.98 ⁇ M) of the titrant peptidomimetic macrocycle.
  • Duplicate samples thus prepared for each concentration point are incubated at room temperature for 60 min, then chilled to 4° C.
  • FITC-labeled fluoresceinated compounds
  • lysis buffer 50 mM Tris [pH 7.6], 150 mM NaCl, 1% CHAPS and protease inhibitor cocktail
  • Extracts are centrifuged at 14,000 rpm for 15 minutes and supernatants collected and incubated with 10 ⁇ l goat anti-FITC antibody for 2 hrs, rotating at 4° C. followed by further 2 hrs incubation at 4° C. with protein A/G Sepharose (50 ⁇ l of 50% bead slurry). After quick centrifugation, the pellets are washed in lysis buffer containing increasing salt concentration (e.g., 150, 300, 500 mM). The beads are then re-equilibrated at 150 mM NaCl before addition of SDS-containing sample buffer and boiling.
  • increasing salt concentration e.g. 150, 300, 500 mM
  • the supernatants are optionally electrophoresed using 4%-12% gradient Bis-Tris gels followed by transfer into Immobilon-P membranes. After blocking, blots are optionally incubated with an antibody that detects FITC and also with one or more antibodies that detect proteins that bind to the peptidomimetic macrocycle.
  • peptidomimetic macrocycles and corresponding uncrosslinked macrocycle To measure the cell penetrability of peptidomimetic macrocycles and corresponding uncrosslinked macrocycle, intact cells are incubated with fluoresceinated peptidomimetic macrocycles or corresponding uncrosslinked macrocycle (10 ⁇ M) for 4 hrs in serum free media at 37° C., washed twice with media and incubated with trypsin (0.25%) for 10 min at 37° C. The cells are washed again and resuspended in PBS. Cellular fluorescence is analyzed, for example, by using either a FACSCalibur flow cytometer or Cellomics' KineticScan® HCS Reader.
  • the compounds are, for example, administered to mice or rats by IV, IP, PO or inhalation routes at concentrations ranging from 0.1 to 50 mg/kg and blood specimens withdrawn at 0′, 5′, 15′, 30′, 1 hr, 4 hrs, 8 hrs and 24 hours post-injection. Levels of intact compound in 25 ⁇ L of fresh serum are then measured by LC-MS/MS as above.
  • peptidomimetic macrocycles of the invention are selected and separated in treatment and one or more control groups, wherein the treatment group is administered a peptidomimetic macrocycle of the invention, while the control groups receive a placebo or a known BH3 mimetic.
  • the treatment safety and efficacy of the peptidomimetic macrocycles of the invention can thus be evaluated by performing comparisons of the patient groups with respect to factors such as survival and quality-of-life.
  • the patient group treated with a peptidomimetic macrocycle show improved long-term survival compared to a patient control group treated with a placebo.
  • the present invention provides a pharmaceutical composition comprising a peptidomimetic macrocycle of the invention and a pharmaceutically acceptable carrier.
  • the peptidomimetic macrocycles of the invention also include pharmaceutically acceptable derivatives or prodrugs thereof.
  • a “pharmaceutically acceptable derivative” means any pharmaceutically acceptable salt, ester, salt of an ester, pro-drug or other derivative of a compound of this invention which, upon administration to a recipient, is capable of providing (directly or indirectly) a compound of this invention.
  • Particularly favored pharmaceutically acceptable derivatives are those that increase the bioavailability of the compounds of the invention when administered to a mammal (e.g., by increasing absorption into the blood of an orally administered compound) or which increases delivery of the active compound to a biological compartment (e.g., the brain or lymphatic system) relative to the parent species.
  • Some pharmaceutically acceptable derivatives include a chemical group which increases aqueous solubility or active transport across the gastrointestinal mucosa.
  • the peptidomimetic macrocycles of the invention are modified by covalently or non-covalently joining appropriate functional groups to enhance selective biological properties.
  • modifications include those which increase biological penetration into a given biological compartment (e.g., blood, lymphatic system, central nervous system), increase oral availability, increase solubility to allow administration by injection, alter metabolism, and alter rate of excretion.
  • Pharmaceutically acceptable salts of the compounds of this invention include those derived from pharmaceutically acceptable inorganic and organic acids and bases.
  • suitable acid salts include acetate, adipate, benzoate, benzenesulfonate, butyrate, citrate, digluconate, dodecylsulfate, formate, fumarate, glycolate, hemisulfate, heptanoate, hexanoate, hydrochloride, hydrobromide, hydroiodide, lactate, maleate, malonate, methanesulfonate, 2-naphthalenesulfonate, nicotinate, nitrate, palmoate, phosphate, picrate, pivalate, propionate, salicylate, succinate, sulfate, tartrate, tosylate and undecanoate.
  • Salts derived from appropriate bases include alkali metal (e.g., sodium), alkaline earth metal (e.g., magnesium), ammonium and N
  • pharmaceutically acceptable carriers include either solid or liquid carriers.
  • Solid form preparations include powders, tablets, pills, capsules, cachets, suppositories, and dispersible granules.
  • a solid carrier can be one or more substances, which also acts as diluents, flavoring agents, binders, preservatives, tablet disintegrating agents, or an encapsulating material. Details on techniques for formulation and administration are well described in the scientific and patent literature, see, e.g., the latest edition of Remington's Pharmaceutical Sciences, Maack Publishing Co, Easton Pa.
  • the carrier is a finely divided solid, which is in a mixture with the finely divided active component.
  • the active component is mixed with the carrier having the necessary binding properties in suitable proportions and compacted in the shape and size desired.
  • Suitable solid excipients are carbohydrate or protein fillers include, but are not limited to sugars, including lactose, sucrose, mannitol, or sorbitol; starch from corn, wheat, rice, potato, or other plants; cellulose such as methyl cellulose, hydroxypropylmethyl-cellulose, or sodium carboxymethylcellulose; and gums including arabic and tragacanth; as well as proteins such as gelatin and collagen.
  • disintegrating or solubilizing agents are added, such as the cross-linked polyvinyl pyrrolidone, agar, alginic acid, or a salt thereof, such as sodium alginate.
  • Liquid form preparations include solutions, suspensions, and emulsions, for example, water or water/propylene glycol solutions.
  • liquid preparations can be formulated in solution in aqueous polyethylene glycol solution.
  • the pharmaceutical preparation is preferably in unit dosage form.
  • the preparation is subdivided into unit doses containing appropriate quantities of the active component.
  • the unit dosage form can be a packaged preparation, the package containing discrete quantities of preparation, such as packeted tablets, capsules, and powders in vials or ampoules.
  • the unit dosage form can be a capsule, tablet, cachet, or lozenge itself, or it can be the appropriate number of any of these in packaged form.
  • compositions of this invention comprise a combination of a peptidomimetic macrocycle and one or more additional therapeutic or prophylactic agents
  • both the compound and the additional agent should be present at dosage levels of between about 1 to 100%, and more preferably between about 5 to 95% of the dosage normally administered in a monotherapy regimen.
  • the additional agents are administered separately, as part of a multiple dose regimen, from the compounds of this invention.
  • those agents are part of a single dosage form, mixed together with the compounds of this invention in a single composition.
  • the compositions are present as unit dosage forms that can deliver, for example, from about 0.0001 mg to about 1,000 mg of the peptidomimetic macrocycles, salts thereof, prodrugs thereof, derivatives thereof, or any combination of these.
  • the unit dosage forms can deliver, for example, in some embodiments, from about 1 mg to about 900 mg, from about 1 mg to about 800 mg, from about 1 mg to about 700 mg, from about 1 mg to about 600 mg, from about 1 mg to about 500 mg, from about 1 mg to about 400 mg, from about 1 mg to about 300 mg, from about 1 mg to about 200 mg, from about 1 mg to about 100 mg, from about 1 mg to about 10 mg, from about 1 mg to about 5 mg, from about 0.1 mg to about 10 mg, from about 0.1 mg to about 5 mg, from about 10 mg to about 1,000 mg, from about 50 mg to about 1,000 mg, from about 100 mg to about 1,000 mg, from about 200 mg to about 1,000 mg, from about 300 mg to about 1,000 mg, from about 400 mg to about 1,000 mg, from about
  • compositions are present as unit dosage forms that can deliver, for example, about 1 mg, about 2 mg, about 3 mg, about 4 mg, about 5 mg, about 6 mg, about 7 mg, about 8 mg, about 9 mg, about 10 mg, about 20 mg, about 30 mg, about 40 mg, about 50 mg, about 60 mg, about 70 mg, about 80 mg, about 90 mg, about 100 mg, about 150 mg, about 200 mg, about 250 mg, about 300 mg, about 350 mg, about 400 mg, about 500 mg, about 600 mg, about 700 mg, about 800 mg, or about 1000 mg of peptidomimetic macrocycles, salts thereof, prodrugs thereof, derivatives thereof, or any combination of these.
  • Suitable routes of administration include, but are not limited to, oral, intravenous, rectal, aerosol, parenteral, ophthalmic, pulmonary, transmucosal, transdermal, vaginal, otic, nasal, and topical administration.
  • parenteral delivery includes intramuscular, subcutaneous, intravenous, intramedullary injections, as well as intrathecal, direct intraventricular, intraperitoneal, intralymphatic, and intranasal injections.
  • a composition as described herein is administered in a local rather than systemic manner, for example, via injection of the compound directly into an organ.
  • long acting formulations are administered by implantation (for example subcutaneously or intramuscularly) or by intramuscular injection.
  • the drug is delivered in a targeted drug delivery system, for example, in a liposome coated with organ-specific antibody.
  • the liposomes are targeted to and taken up selectively by the organ.
  • the compound as described herein is provided in the form of a rapid release formulation, in the form of an extended release formulation, or in the form of an intermediate release formulation.
  • the compound described herein is administered topically.
  • compositions described herein are formulated for oral administration.
  • Compositions described herein are formulated by combining a peptidomimetic macrocycle with, e.g., pharmaceutically acceptable carriers or excipients.
  • the compounds described herein are formulated in oral dosage forms that include, by way of example only, tablets, powders, pills, dragees, capsules, liquids, gels, syrups, elixirs, slurries, suspensions and the like.
  • pharmaceutical preparations for oral use are obtained by mixing one or more solid excipient with one or more of the peptidomimetic macrocycles described herein, optionally grinding the resulting mixture, and processing the mixture of granules, after adding suitable auxiliaries, if desired, to obtain tablets or dragee cores.
  • Suitable excipients are, in particular, fillers such as sugars, including lactose, sucrose, mannitol, or sorbitol; cellulose preparations such as: for example, maize starch, wheat starch, rice starch, potato starch, gelatin, gum tragacanth, methylcellulose, microcrystalline cellulose, hydroxypropylmethylcellulose, sodium carboxymethylcellulose; or others such as: polyvinylpyrrolidone (PVP or povidone) or calcium phosphate.
  • disintegrating agents are optionally added. Disintegrating agents include, by way of example only, cross-linked croscarmellose sodium, polyvinylpyrrolidone, agar, or alginic acid or a salt thereof such as sodium alginate.
  • dosage forms such as dragee cores and tablets, are provided with one or more suitable coating.
  • concentrated sugar solutions are used for coating the dosage form.
  • the sugar solutions optionally contain additional components, such as by way of example only, gum arabic, talc, polyvinylpyrrolidone, carbopol gel, polyethylene glycol, or titanium dioxide, lacquer solutions, and suitable organic solvents or solvent mixtures.
  • Dyestuffs or pigments are also optionally added to the coatings for identification purposes. Additionally, the dyestuffs or pigments are optionally utilized to characterize different combinations of active compound doses.
  • Oral dosage forms include push-fit capsules made of gelatin, as well as soft, sealed capsules made of gelatin and a plasticizer, such as glycerol or sorbitol.
  • push-fit capsules contain the active ingredients in admixture with one or more filler.
  • Fillers include, by way of example only, lactose, binders such as starches, or lubricants such as talc or magnesium stearate and, optionally, stabilizers.
  • soft capsules contain one or more active compound that is dissolved or suspended in a suitable liquid. Suitable liquids include, by way of example only, one or more fatty oil, liquid paraffin, or liquid polyethylene glycol.
  • stabilizers are optionally added.
  • therapeutically effective amounts of at least one of the peptidomimetic macrocycles described herein are formulated for buccal or sublingual administration.
  • Formulations suitable for buccal or sublingual administration include, by way of example only, tablets, lozenges, or gels.
  • the peptidomimetic macrocycles described herein are formulated for parenteral injection, including formulations suitable for bolus injection or continuous infusion.
  • formulations for injection are presented in unit dosage form (e.g., in ampoules) or in multi-dose containers. Preservatives are, optionally, added to the injection formulations.
  • compositions are formulated in a form suitable for parenteral injection as a sterile suspensions, solutions or emulsions in oily or aqueous vehicles.
  • Parenteral injection formulations optionally contain formulatory agents such as suspending, stabilizing or dispersing agents.
  • pharmaceutical formulations for parenteral administration include aqueous solutions of the active compounds in water-soluble form.
  • suspensions of the active compounds are prepared as appropriate oily injection suspensions.
  • Suitable lipophilic solvents or vehicles for use in the pharmaceutical compositions described herein include, by way of example only, fatty oils such as sesame oil, or synthetic fatty acid esters, such as ethyl oleate or triglycerides, or liposomes.
  • aqueous injection suspensions contain substances which increase the viscosity of the suspension, such as sodium carboxymethyl cellulose, sorbitol, or dextran.
  • the suspension contains suitable stabilizers or agents which increase the solubility of the compounds to allow for the preparation of highly concentrated solutions.
  • the active ingredient is in powder form for constitution with a suitable vehicle, e.g., sterile pyrogen-free water, before use.
  • compositions herein can be administered, for example, once or twice or three or four or five or six times per day, or once or twice or three or four or five or six times per week, and can be administered, for example, for a day, a week, a month, 3 months, six months, a year, five years, or for example ten years.
  • a pharmaceutical formulation of the invention is administered no more frequently than once daily, no more frequently than every other day, no more frequently than twice weekly, no more frequently than three times weekly, no more frequently than four times weekly, no more frequently than five times weekly, or no more frequently than every other week.
  • a pharmaceutical formulation of the invention is administered no more than once weekly.
  • a pharmaceutical formulation of the invention is administered no more than twice weekly. In some embodiments, a pharmaceutical formulation of the invention is administered no more than three times weekly. In some embodiments, a pharmaceutical formulation of the invention is administered no more than four times weekly. In some embodiments, a pharmaceutical formulation of the invention is administered no more than five times weekly.
  • treatment is defined as the application or administration of a therapeutic agent to a patient, or application or administration of a therapeutic agent to an isolated tissue or cell line from a patient, who has a disease, a symptom of disease or a predisposition toward a disease, with the purpose to cure, heal, alleviate, relieve, alter, remedy, ameliorate, improve or affect the disease, the symptoms of disease or the predisposition toward disease.
  • a peptidomimetic macrocycle disclosed herein is used for treating a disease or condition in a subject in need thereof.
  • a peptidomimetic macrocycle disclosed herein is used for manufacture of a medicament for treating a disease or condition in a subject in need thereof.
  • the present invention provides novel peptidomimetic macrocycles that are useful in competitive binding assays to identify agents which bind to a natural ligand of the proteins or peptides upon which the peptidomimetic macrocycles are modeled.
  • labeled peptidomimetic macrocycles based on BIM can be used in a binding assay along with small molecules that competitively bind to MCL-1.
  • Competitive binding studies allow for rapid in vitro evaluation and determination of drug candidates specific the BIM/MCL-1 interaction. Such binding studies may be performed with any of the peptidomimetic macrocycles disclosed herein and their binding partners.
  • the invention further provides for the generation of antibodies against the peptidomimetic macrocycles.
  • these antibodies specifically bind both the peptidomimetic macrocycle and the precursor peptides, such as BIM, to which the peptidomimetic macrocycles are related.
  • BIM precursor peptides
  • Such antibodies for example, disrupt the native protein-protein interactions, for example, between BIM and MCL-1.
  • the present invention provides methods to inhibit MCL-1, thereby stimulating death of a cell or tissue.
  • a subject suffering from a condition of suppressed cell death, such as B-cell lymphoma is treated using pharmaceutical compositions of the invention.
  • the present invention provides methods for treating a disease driven by over-expression of MCL-1.
  • the disease driven by over-expression is a cancer.
  • the cancer can be a liquid cancer or a solid cancer.
  • Non-limiting examples of a liquid cancer include leukemia, lymphoma, myeloma, and myeloid dysplasia.
  • Non-limiting examples of a solid cancer include lung cancer, breast cancer, colon cancer, brain cancer, liver cancer, soft-tissue sarcoma, pancreatic cancer, and melanoma.
  • the cancer is resistant, non-responsive, or determined unlikely to respond to a BCL-2 inhibitor.
  • the BCL-2 inhibitor is a BH3 mimetic.
  • the BCL-2 inhibitor is navitoclax (ABT-263) or obatoclax (GX15-070).
  • These methods comprise administering an effective amount of a compound of the invention to a warm blooded animal, including a human.
  • a pharmaceutical composition provided herein used in the treatment of an MCL-1 over-expressing cancer is administered no more frequently than once daily, no more frequently than every other day, no more frequently than twice weekly, no more frequently than weekly, or no more frequently than every other week.
  • neurodegenerative disorders are a result of neurodegenerative processes including progressive loss of structure or function of neurons. These methods comprise administering an effective amount of at least one peptidomimetic macrocycles of the invention or a pharmaceutical composition thereof to a warm blooded animal, including a human.
  • Non limiting neurodegenerative disorders that may be treated by the methods of the present invention include Parkinson's disease, Alzheimer's, Amyotrophic lateral sclerosis (ALS) and Huntington's disease.
  • cardiac disorders comprising administering an effective amount of at least one peptidomimetic macrocycles of the invention or a pharmaceutical composition thereof to a warm blooded animal, including a human.
  • cardiac disorders include coronary heart disease (also known as isohaemic heart disease or coronary artery disease), cardiomyopathy (diseases of cardiac muscle), hypertensive heart disease (diseases of the heart secondary to high blood pressure), heart failure, cor pulmonale (failure of the right side of the heart), cardiac dysrhythmias (abnormalities of heart rhythm), inflammatory heart disease, endocarditis (inflammation of the inner layer of the heart, the endocardium), inflammatory cardiomegaly, myocarditis (inflammation of the myocardium, the muscular part of the heart), valvular heart disease, cerebrovascular disease (disease of blood vessels that supplies to the brain such as stroke), peripheral
  • Diabetes is a group of metabolic diseases in which a person has high blood sugar, either because the pancreas does not produce enough insulin, or because cells do not respond to the insulin that is produced.
  • the diabetes may be Type 1 diabetes mellitus, type 2 diabetes, gestational diabetes, congenital diabetes, cystic fibrosis-related diabetes or several forms of monogenic diabetes.
  • Treatment of diabetes may be by islet/beta cell transplantation.
  • the invention provides methods of treating a subject by administering to the subject a beta cell, wherein the beta cell has been treated with an effective amount of a peptidomimetic macrocycle of the invention or a pharmaceutical composition thereof.
  • the invention provides methods of treating a subject by administering to the subject a islet cell, wherein the islet cell has been treated with an effective amount of a peptidomimetic macrocycle of the invention or a pharmaceutical composition thereof.
  • a peptidomimetic macrocycle disclosed herein is administered in combination with an additional therapy to treat a cancer.
  • additional therapy include surgery, radiation therapy, chemotherapy, or immunotherapy.
  • the combination of the peptidomimetic macrocycle and surgery is on an adjuvant basis or a neo-adjuvant basis.
  • Non-limiting examples of chemotherapy include alkylating agents, angiogenesis inhibitors, antimetabolites, Bcr-Abl kinase inhibitors, cyclin-dependent kinase inhibitors, cyclooxygenase-2 inhibitors, epidermal growth factor receptor (EGFR) inhibitors, leukemia viral oncogene homolog (ErbB2) receptor inhibitors, histone deacetylase (HDAC) inhibitors, heat shock protein (HSP)-90 inhibitors, inhibitors of inhibitors of apoptosis proteins (IAPs), antibody drug conjugates, activators of death receptor pathway, kinesin inhibitors, JAK-2 inhibitors, mitogen-activated extracellular signal-regulated kinase (MEK) inhibitors, mammalian target of rapamycin (mTOR) inhibitors, non-steroidal anti-inflammatory drugs (NSAIDs), platelet-derived growth factor receptor (PDGFR) inhibitors, platinum chemotherapeutics, polo-like kinase (Plk) inhibitor
  • alkylating agents include: altretamine, AMD-473, AP-5280, apaziquone, bendamustine, brostallicin, busulfan, carboquone, carmustine, chlorambucil, laromustine, cyclophosphamide, decarbazine, estramustine, fotemustine, glufosfamide, ifosfamide, KW-2170, lomustine, mafosfamide, melphalan, mitobronitol, mitolactol, nimustine, nitrogen mustard N-oxide, ranimustine, temozolomide, thiotepa, bendamustine, treosulfan, and rofosfamide.
  • angiogenesis inhibitors include: endothelial-specific receptor tyrosine kinase (Tie-2) inhibitors, epidermal growth factor receptor (EGFR) inhibitors, insulin growth factor-2 receptor (IGFR-2) inhibitors, matrix metalloproteinase-2 (MMP-2) inhibitors, matrix metalloproteinase-9 (MMP-9) inhibitors, platelet-derived growth factor receptor (PDGFR) inhibitors, thrombospondin analogs, and vascular endothelial growth factor receptor tyrosine kinase (VEGFR) inhibitors.
  • Tie-2 endothelial-specific receptor tyrosine kinase
  • EGFR epidermal growth factor receptor
  • IGFR-2 insulin growth factor-2 receptor
  • MMP-2 matrix metalloproteinase-2
  • MMP-9 matrix metalloproteinase-9
  • PDGFR platelet-derived growth factor receptor
  • VEGFR vascular endothelial growth factor receptor tyrosine kin
  • Non-limiting examples of antimetabolites include: pemetrexed disodium, 5-azacitidine, capecitabine, carmofur, cladribine, clofarabine, cytarabine, cytarabine ocfosfate, cytosine arabinoside, decitabine, deferoxamine, doxifluridine, eflornithine, EICAR, enocitabine, ethnylcytidine, fludarabine, 5-fluorouracil, leucovorin, gemcitabine, hydroxyurea, melphalan, mercaptopurine, 6-mercaptopurine riboside, methotrexate, mycophenolic acid, nelarabine, nolatrexed, ocfosfate, pelitrexol, pentostatin, raltitrexed, Ribavirin, triapine, trimetrexate, S-1, tiazofurin
  • Non-limiting examples of Bcr-Abl kinase inhibitors include: dasatinib, nilotinib, and imatinib.
  • Non-limiting examples of CDK inhibitors include: AZD-5438, BMI-1040, BMS-032, BMS-387, CVT-2584, flavopyridol, GPC-286199, MCS-5A, PD0332991, PHA-690509, seliciclib, and ZK-304709.
  • Non-limiting examples of COX-2. inhibitors include: ABT-963, etoricoxib, valdecoxib, BMS347070, celecoxib, lumiracoxib, CT-3, deracoxib, JTE-522, 4-methyl-2-(3,4-dimethylphenyl)-1-(4-sulfamoylphenyl-1H-pyrrole), etoricoxib, NS-398, parecoxib, RS-57067, SC-58125, SD-8381, SVT-2016, S-2474, T-614, and rofecoxib.
  • Non-limiting examples of EGFR inhibitors include: ABX-EGF, anti-EGFR immunoliposomes, EGF-vaccine, EMD-7200, cauximab, HR3, IgA antibodies, gefitinib, erlotinib, TP-38, EGER fusion protein, and lapatinib.
  • Non-limiting examples of ErbB2 receptor inhibitors include: CP-724-714, canertinib, trastuzumab, lapatinib, petuzumab, TAK-165, ionafarnib, GW-282974, EKB-569, PI-166, dHER2 HER2. vaccine, APC-8024 HER-2 vaccine, anti-HER2/neu bispecific antibody, B7.her21gG3, AS HER2 trifunctional bispecific antibodies, mAB AR-209, and mAB 2B-1.
  • histone deacetylase inhibitors include: depsipeptide, LAQ-824, MS-275, trapoxin, suberoylanilide hydroxamic acid (SAHA), TSA, and valproic acid.
  • HSP-90 inhibitors include: 17-AAG-nab, 17-AAG, CNE-101, CNF-1010, CNF-2024, 17-DMAG, geldanamycin, IPI-504, KOS-953, human recombinant antibody to HSP-90, NCS-683664, PU24FC1, PU-3, radicicol, SNX-2112, or STA-9090 VER49009.
  • Non-limiting examples of inhibitors of inhibitors of apoptosis proteins include: HGS1029, GDC-0145, GDC-0152, LCL-161, and LBW-242.
  • Non-limiting examples of antibody-drug conjugates include: anti-CD22-MC-MMAF, anti-CD22-MC-MMAE, anti-CD22-MCC-DM1, CR-0,1-veMMAE, PSMA-ADC, MEDI-547, SGN-19Am SGN-35, and SGN-75.
  • Non-limiting examples of activators of death receptor pathway include: TRAIL, antibodies or other agents that target TRAIL or death receptors (e.g., DR4 and DRS) such as apomab, conatumumab, ETR2-ST01, GDC0145, lexatumumab, HGS-1029, LBY-135, PRO-1762, and trastuzumab.
  • TRAIL TRAIL
  • DR4 and DRS death receptors
  • Non-limiting examples of kinesin inhibitors include: Eg5 inhibitors such as AZD4877, ARRY-520; and CENPE inhibitors such as GSK923295A.
  • JAK-2 inhibitors include: lesaurtinib, XL019 or INCB018424.
  • Non-limiting examples of MEK inhibitors include: trametmib, ARRY-142886, ARRY-438162 PD-325901, C1-1040, and PD-98059.
  • Non-limiting examples of mTOR inhibitors include: AP-23573, CCI-779, everolimus, RAD-001, rapamycin, temsirolimus, ATP-competitive TORC1/TORC2 inhibitors, comprising PI-103, PP242, PP30, and Torin 1.
  • Non-limiting examples of non-steroidal anti-inflammatory drugs include: salsalate, diflunisal, ibuprofen, ketoprofen, nabumetone, piroxicam, ibuprofen cream, naproxen, diclofenac, indomethacin, sulindac, tolmetin, etodolac, ketorolac, and oxaprozin.
  • Non-limiting examples of PDGFR inhibitors include: C-451, CP-673, and CP-868596.
  • Non-limiting examples of platinum chemotherapeutics include: cisplatin, oxaliplatin, eptaplatin, lobaplatin, nedaplatin, carboplatin, satraplatin, and picoplatin.
  • Non-limiting examples of polo-like kinase inhibitors include: B1-2536.
  • Non-limiting examples of phosphoinositide-3 kinase (PI3K) inhibitors include: wortmannin, LY294002, XL-147, CAL-120, ONC-21, AEZS-127, ETP-45658, PX-866, GDC-0941, BGT226, BEZ235, and XL765.
  • Non-limiting examples of thrombospondin analogs include: ABT-510, ABT-567, ABT-898, and TSP-1.
  • VEGFR inhibitors include: bevacizumab, ABT-869, AEE-788, ANGIOZYMETM (a ribozyme that inhibits angiogenesis, axitinib, AZD-2171, CP-547,632, IM-862, pegaptamib, sorafenib, pazopanib, vatalanib, sunitinib, VEGF trap, and vandetanib.
  • Non-limiting examples of antibiotics include: intercalating antibiotics aclarubicin, actinomycin D, amrubicin, annamycin, adriamycin, bleomycin, daunorubicin, liposomal doxorubicin, doxorubicin, elsamitrucin, epirbucin, glarbuicin, idarubicin, mitomycin C, nemorubicin, neocarzinostatin, peplomycin, pirarubicin, rebeccamycin, stimalamer, streptozocin, valrubicin, and zinostatin.
  • topoisomerase inhibitors include: aclarubicin, 9-aminocamptothecin, amonafide, amsacrine, hecatecarin, belotecan, BN-80915, irinotecan, camptothecin, dexrazoxine, diflomotecan, edotecarin, epirubicin, etoposide, exatecan, 10-hydroxycamptothecin, gimatecan, lurtotecan, mitoxantrone, orathecin, pirarbucin, pixantrone, rubitecan, sobuzoxane, SN-38, tafluposide, and topotecan.
  • Non-limiting examples of antibodies include: bevacizumab, CD40 antibodies, chTNT-1/B, denosumab, cetuximab, zanolimumab, IGF1R antibodies, llintuzumab, edrecolomab, WX G250, rituximab, ticilimumab, trastuzumab, CD20 antibodies types I and II, pembrolizumab, ipilumimab, nivolumab, rituximab, and panituommab.
  • Non-limiting examples of hormonal therapies include: anastrozole, exemestane, arzoxifene, bicalutamide, cetrorelix, degarelix, deslorelin, trilostane, dexamethasone, flutamide, raloxifene, fadrozole, toremifene, fulvestrant, letrozole, formestane, glucocorticoids, doxercalciferol, sevelamer carbonate, lasofoxifene, leuprolide acetate, megesterol, mifepristone, nilutamide, tamoxifen citrate, aharelix, prednisone, finasteride, rilostane, buserelin, luteinizing hormone releasing hormone (LHRH), histrelin implant, trilostane, modrastane, fosrelin, and goserelin.
  • LHRH luteinizing hormone releasing hormone
  • Non-limiting examples of deltoids and retinoids include: seocalcitol, lexacalcitrol, fenretinide, aliretinoin, liposomal tretinoin, bexarotene, and LGD-1550.
  • Non-limiting examples of PARP inhibitors include: ABT-888, olaparib, KU-59436, AZD-2281, AG-014699, BSI-201, BGP-15, INO-1001, and ONO-2231.
  • Non-limiting examples of plant alkaloids include: vincristine, vinblastine, vindesine, and vinorelbine.
  • Non-limiting examples of proteasome inhibitors include: bortezomib, carfilzomib, MG132, and NPI-0052.
  • Non-limiting examples of biological response modifiers include: krestin, lentinan, sizofuran, picibanil, PF-3512676, and ubenimex.
  • Non-limiting examples of pyrimidine analogs include: cytarabine, cytosine arabinoside, doxifluridine, fludarabine, 5-fluorouracil, floxuridine, gemcitabine, ratitrexed, and triacetyluridine troxacitabine.
  • Non-limiting examples of purine analogs include: thioguanine, and mercaptopurine.
  • Non-limiting examples of antimitotic agents include: batabulin, epothilone D, N-(2-((4-hydroxyphenyl)amino)pyridin-3-yl)-4-methoxybenzenesulfonamide, ixabepilone, paclitaxel, docetaxel, PNU100940, patupilone, XRP-9881 larotaxel, vinflunine, and epothilone.
  • Non-limiting examples of ubiquitin ligase inhibitors include paclitaxel and docetaxel.
  • Non-limiting examples of ubiquitin ligase inhibitors include: MDM2 inhibitors, such as nutlins, and NEDD8 inhibitors such as MLN4924.
  • Non-limiting examples of immunotherapies include: interferons or immune-enhancing agents.
  • Interferons comprise interferon alpha, interferon alpha-2a, interferon alpha-2b, interferon beta, interferon gamma-1a, interferon gamma-1b, interferon gamma-n1.
  • immune-enhancing agents comprise oxidized glutathione, tasonermin, tositurnornab, alemtuzumab, CTLA4, decarbazine, denileukin, epratuzumab, lenograstim, lentinan, leukocyte alpha interferon, imiquimod, ipilumimab, melanoma vaccine, niitumomab, molgramostim, nivolumab, pembrolizumab, gemtuzumab ozogamicin, filgrastim, OncoVAC-CL, oregovomab, pemtumomab, sipuleucel-T, sargaramostim, sizofilan, teceleukin, Bacillus Calmette-Guerin, ubenimex, virulizin, Z-100, Tetrachlorodecaoxide (TCDO), aldesleukin, thymalfasin, dacli
  • Peptidomimetic macrocycles were synthesized, purified and analyzed as previously described and as described below (Schafmeister et al., J. Am. Chem. Soc. 122:5891-5892 (2000); Schafffle & Verdin, J. Am. Chem. Soc. 122:5891 (2005); Walensky et al., Science 305:1466-1470 (2004); and U.S. Pat. No. 7,192,713).
  • Peptidomimetic macrocycles were designed by replacing two or more naturally occurring amino acids with the corresponding synthetic amino acids. Substitutions were made at i and i+4, and i and i+7 positions.
  • Peptide synthesis was performed either manually or on an automated peptide synthesizer (Applied Biosystems, model 433A), using solid phase conditions, rink amide AM resin (Novabiochem), and Fmoc main-chain protecting group chemistry.
  • Fmoc-protected amino acids Novabiochem
  • 10 equivalents of amino acid and a 1:1:2 molar ratio of coupling reagents HBTU/HOBt (Novabiochem)/DIEA were employed.
  • Non-natural amino acids (4 equiv) were coupled with a 1:1:2 molar ratio of HATU (Applied Biosystems)/HOBt/DIEA.
  • the N-termini of the synthetic peptides were acetylated, while the C-termini were amidated.
  • Linear peptides and cross-linked peptidomimetic macrocycles are tested for stability to proteolysis by Trypsin (MP Biomedicals, Solon Ohio) by solubilizing each peptide at 10 ⁇ M concentration in 200 ⁇ L 100 mM NH4OAc (pH 7.5).
  • the reaction is initiated by adding 3.5 ⁇ l of Trypsin (12.5 ⁇ g protease per 500 ⁇ L reaction) and shaking continually in sealed vials while incubating in a Room Temperature (22 ⁇ 2° C.).
  • the enzyme/substrate ratio is 1:102 (w/w).
  • the reaction half-life for each peptide is calculated in GraphPad Prism by a non-linear fit of uncalibrated MS response versus enzyme incubation time.
  • BIM peptidomimetic macrocycles were tested for cell killing at various concentrations.
  • Human Raji cells were treated with increasing doses of peptidomimetic macrocycles corresponding to SEQ ID NO. 763 ( FIGS. 1 and 2 ), 1143 ( FIGS. 1-3 ), and 1621 ( FIGS. 3 and 4 ).
  • An % Viable cells was calculated for each dose of the peptidomimetic macrocycle from a non-linear fit of response vs dose (GraphPad Prism).
  • the effect of the peptidomimetic macrocycles corresponding to SEQ ID NO. 763 are presented in FIGS. 1 and 2 .
  • the effect of the peptidomimetic macrocycles corresponding to SEQ ID NO. 1143 are presented in FIGS. 1-3 .
  • the effect of the peptidomimetic macrocycles corresponding to SEQ ID NO. 1621 are presented in FIGS. 3 and 4 .
  • FIG. 5 shows the effect of the compounds on normalized BAK peptide FRET signal.
  • a peptidomimetic macrocycle corresponding to SEQ ID NO. 763 was administered to mice at a 5 mg/kg dose. Mice were sacrificed at specific timepoints both before and after dosing, up to 24 hours post-administration. Blood, liver, and spleen were collected from the mice at the specific time points. Plasma was prepared from the blood using K2EDTA tubes by centrifuging for 20 minutes at 4° C. at 2000G maximum 30 minutes after collection. From each plasma sample, an aliquot was transferred to a fresh tube for PK studies. From each liver and spleen sample, tissue was homogenized and extracts were prepared for biodistribution studies. FIG. 6 shows the PK and biodistribution results for this study by concentration in nanograms of peptidomimetic macrocycle per gram mouse body weight (ng/g) over time.
  • Peptidomimetic macrocycles corresponding to SEQ ID NO. 763 or 1143 were administered to humans. Blood was collected at specific timepoints both before and after dosing, up to 24 hours post-administration. Plasma was prepared from the blood using K2EDTA tubes by centrifuging for 20 minutes at 4° C. at 2000G maximum 30 minutes after collection. From each plasma sample, an aliquot was transferred to a fresh tube for plasma stability studies.
  • FIG. 7 shows the plasma stability results for this study as a percentage of peptidomimetic macrocycle remaining in plasma over time, with the dashed line corresponding to the initial amount of peptidomimetic macrocycle dosed.

Landscapes

  • Chemical & Material Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Molecular Biology (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Toxicology (AREA)
  • Zoology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Peptides Or Proteins (AREA)

Abstract

The disclosed peptidomimetic macrocycles modulate the activity of MCL-1. Myeloid cell leukemia 1 (MCL-1) is a protein that inhibits cell death. Peptidomimetic macrocycles, pharmaceutical compositions, and methods disclosed herein can be used for the treatment of disease in which MCL-1 is over-expressed, such as cancer. In particular, MCL-1-modulating peptidomimetic macrocycles disclosed herein can be applied in the setting of resistance to BCL-2 family inhibitors, which is often engendered by MCL-1 over-expression or hyper-activation.

Description

    CROSS-REFERENCE
  • This application is a continuation of U.S. application Ser. No. 15/259,947, filed Sep. 8, 2016, which claims priority to U.S. Provisional Application No. 62/216,683, filed Sep. 10, 2015, each of which is incorporated herein by reference in their entirety.
    • SEQUENCE LISTING
  • The instant application contains a Sequence Listing, which has been submitted electronically in ASCII format and is hereby incorporated by reference in its entirety. Said ASCII copy, created on May 17, 2018, is named 35224796301_SL.TXT and is 1,592,917 bytes in size.
    • BACKGROUND OF THE INVENTION
  • Myeloid cell leukemia 1 (MCL-1) is a protein that inhibits cell death by binding and inhibiting pro-death factors, such as BCL-2 interacting mediator (BIM). When MCL-1 is over-expressed, the rate of cell death in a cell or tissue is reduced.
    • SUMMARY OF THE INVENTION
  • In some embodiments, the invention provides a peptidomimetic macrocycle of Formula (Ic):
  • Figure US20180340009A1-20181129-C00001
  • wherein the peptidomimetic macrocycle binds MCL-1 selectively over another protein that has a BH3 domain, wherein:
  • each A, C, D, and E is independently a natural or non-natural amino acid;
  • each B is independently a natural or non-natural amino acid, amino acid analog,
  • Figure US20180340009A1-20181129-C00002
  • [—NH-L3-CO—], [—NH-L3-SO2—], or [—NH-L3-];
  • each L is independently a macrocycle-forming linker;
  • each L′ is independently alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, arylene, or heteroarylene, each being optionally substituted with R5, or a bond, or together with R1 and the atom to which both R1 and L′ are bound forms a ring;
  • each L″ is independently alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, arylene, or heteroarylene, each being optionally substituted with R5, or a bond, or together with R2 and the atom to which both R2 and L″ are bound forms a ring;
  • each R1 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, cycloalkylalkyl, heteroalkyl, or heterocycloalkyl, unsubstituted or substituted with halo-, or together with L′ and the atom to which both R1 and L′ are bound forms a ring;
  • each R2 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, cycloalkylalkyl, heteroalkyl, or heterocycloalkyl, unsubstituted or substituted with halo-, or together with L″ and the atom to which both R2 and L″ are bound forms a ring;
  • each R3 is independently hydrogen, alkyl, alkenyl, alkynyl, arylalkyl, heteroalkyl, cycloalkyl, heterocycloalkyl, cycloalkylalkyl, aryl, or heteroaryl, optionally substituted with R5;
  • each L3 is independently alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, arylene, heteroarylene, or [—R4—K—R4—]n, each being optionally substituted with R5;
  • each R4 is independently alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, arylene, or heteroarylene;
  • each K is independently O, S, SO, SO2, CO, CO2, or CONR3;
  • each n is independently an integer from 1-5;
  • each R5 is independently halogen, alkyl, —OR6, —N(R6)2, —SR6, —SOR6, —SO2R6, —CO2R6, a fluorescent moiety, a radioisotope, or a therapeutic agent;
  • each R6 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkylalkyl, heterocycloalkyl, a fluorescent moiety, a radioisotope, or a therapeutic agent;
  • each R7 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, aryl, or heteroaryl, optionally substituted with R5, or part of a cyclic structure with a D residue;
  • each R8 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, aryl, or heteroaryl, optionally substituted with R5, or part of a cyclic structure with an E residue;
  • each v and w is independently an integer from 1-1000;
  • u is an integer from 1-10; and
  • each x, y and z is independently an integer from 0-10, or a pharmaceutically-acceptable salt thereof.
  • In some embodiments, the invention provides a peptidomimetic macrocycle having the formula:
  • Figure US20180340009A1-20181129-C00003
  • wherein:
  • each D and E is independently an amino acid residue;
  • R1 and R2 are independently alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, cycloalkylalkyl, heteroalkyl, or heterocycloalkyl, each being optionally substituted with halo-; —H, or at least one of R1 and R2 forms a macrocycle-forming linker L′ connected to the alpha position of one of the D or E amino acid residues;
  • L is a macrocycle-forming linker of the formula -L1-L2-or -L1-L2-L3-;
  • each L1, L2, and L3 is independently alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, arylene, heteroarylene, or [—R4—K—R4—]n, each being optionally substituted with R5;
  • each R3 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, aryl, or heteroaryl, each being optionally substituted with R5;
  • each R4 is independently alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, arylene, or heteroarylene, each being optionally substituted with R5;
  • each K is independently O, S, SO, SO2, CO, CO2, or CONR3;
  • each R5 is independently halogen, alkyl, —OR6, —N(R6)2, —SR6, —SOR6, —SO2R6, —CO2R6, a fluorescent moiety, a radioisotope, or a therapeutic agent;
  • each R6 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkylalkyl, heterocycloalkyl, a fluorescent moiety, a radioisotope, or a therapeutic agent;
  • R7 is —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, aryl, or heteroaryl, each being optionally substituted with R5, or part of a cyclic structure with a D residue;
  • R8 is —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, aryl, or heteroaryl, each being optionally substituted with R5, or part of a cyclic structure with an E residue;
  • each of Xaa1 and Xaa2 is independently an amino acid residue or absent;
  • Xaa3 is Ala, Aib, Asp, Asn, Cys, Glu, Gln, His, Ile, Lys, Leu, Met, Arg, Ser, Thr, Val, Trp, Tyr, or an analog of any of the foregoing;
  • v is an integer from 1-1000;
  • w is an integer from 0-1000; and
  • n is an integer from 1-5, or
  • a pharmaceutically-acceptable salt thereof.
  • In some embodiments, the invention provides a peptidomimetic macrocycle of the formula (SEQ ID NO: 1783):
  • Figure US20180340009A1-20181129-C00004
  • wherein:
  • each D and E is independently an amino acid residue;
  • R1 and R2 are independently alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, cycloalkylalkyl, heteroalkyl, or heterocycloalkyl, each being optionally substituted with halo-; —H, or at least one of R1 and R2 forms a macrocycle-forming linker L′ connected to the alpha position of one of the D or E amino acid residues;
  • each L or L′ is independently a macrocycle-forming linker of the formula -L1-L2-or -L1-L2-L3-;
  • each L1, L2, and L3 is independently alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, arylene, heteroarylene, or [—R4—K—R4—]n, each being optionally substituted with R5;
  • each R3 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, aryl, or heteroaryl, each being optionally substituted with R5;
  • each R4 is independently alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, arylene, or heteroarylene, each being optionally substituted with R5;
  • each K is independently O, S, SO, SO2, CO, CO2, or CONR3;
  • each R5 is independently halogen, alkyl, —OR6, —N(R6)2, —SR6, —SOR6, —SO2R6, —CO2R6, a fluorescent moiety, a radioisotope, or a therapeutic agent;
  • each R6 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkylalkyl, heterocycloalkyl, a fluorescent moiety, a radioisotope, or a therapeutic agent;
  • R7 is —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, aryl, or heteroaryl, each being optionally substituted with R5, or part of a cyclic structure with a D residue;
  • R8 is —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, aryl, or heteroaryl, each being optionally substituted with R5, or part of a cyclic structure with an E residue;
  • each of Xaa1 and Xaa2 is independently an amino acid residue or absent;
  • v is an integer from 1-1000;
  • w is an integer from 0-1000; and
  • n is an integer from 1-5, or
  • a pharmaceutically-acceptable salt thereof.
  • In some embodiments, the invention provides a peptidomimetic macrocycle comprising an amino acid sequence of formula:

  • X1-X2-X3-X4-X5-X6-X7-X8-X9-X10-X11-X12-X13-X14-X15-X16-X17-X18-X19-X20- X21
  • wherein:
  • X1 is Ile, Arg, Ala, Lys, Pro, Leu, Asp, Glu, His, Ser, Gln, Phe, an analog thereof, or absent;
  • X2 is Trp, Arg, Ala, Asn, Phe, Pro, Leu, Ser, Lys, Tyr, His, Cou, Cou2, Cou4, Cou7, an analog thereof, a crosslinked amino acid, or absent;
  • X3 is Ile, Ala, Leu, Phe, Tyr, Val, Asp, Trp, Pro, Gln, Chg, Ac5c, Ac6c, Tba, Bip, Cha, Adm, hCha, an analog thereof, or absent;
  • X4 is Ala, Gln, Asp, Val, Gly, Ser, Leu, Phe, Cha, A4, an analog, thereof, a crosslinked amino acid, or absent;
  • X5 is Gln, Ala, Leu, Phe, Tyr, Gly, Ile, Val, Arg, Glu, Pro, Asp, MO, MO2, an analog thereof, a crosslinked amino acid, or absent;
  • X6 is Glu, Gln, His, Ala, Ser, Arg, Ile, Leu, Thr, Phe, Val, Tyr, Gly, Nle, St, an analog thereof, or absent;
  • X7 is Ala, Leu, Phe, Ile, 2Nal, 1Nal, 3cf, Chg, Cha, Adm, hCha, Igl, Bip, an analog thereof, or absent;
  • X8 is Arg, Ala, Asp, Glu, Thr, His, Gln, Gly, Asn, Phe, Cit, St, an analog thereof, a crosslinked amino acid, or absent;
  • X9 is Arg, Ala, Asp, Lys, Asn, Gly, Ser, Gln, Cys, Nle, St, an analog thereof, or a crosslinked amino acid;
  • X10 is Ile, Val, Ala, Asp, Asn, Phe, Tba, hL, hhL, Nle, Chg, Cha, an analog thereof, or a crosslinked amino acid;
  • X11 is Gly, Val, Ala, Leu, Ile, Asp, Glu, Cha, Aib, Abu, an analog thereof, or a crosslinked amino acid;
  • X12 is Asp, Ala, Asn, Gly, Arg, Glu, Lys, Leu, Nle, an analog thereof, or a crosslinked amino acid;
  • X13 is Ala, Glu, Gln, Leu, Lys, Asp, Tyr, Ile, Ser, Cys, St, Sta5, Aib, Nle, an analog thereof, or a crosslinked amino acid;
  • X14 is Phe, Ala, Leu, Val, Tyr, Glu, His, Ile, Nle, 1Nal, 2Nal, Chg, Cha, BiP, an analog thereof, or a crosslinked amino acid;
  • X15 is Asn, Gln, Ser, His, Glu, Asp, Ala, Leu, Ile, St, Nle, Aib, an analog thereof, a crosslinked amino acid, or absent;
  • X16 is Ala, Glu, Asp, Arg, Lys, Phe, Gly, Gln, Aib, Cha, St, an analog thereof, a crosslinked amino acid, or absent;
  • X17 is Phe, Tyr, Ala, Leu, Asn, Ser, Gln, Arg, His, Thr, Cou2, Cou3, Cou7, Dpr, Amf, Damf, Amye, an analog thereof, a crosslinked amino acid, or absent;
  • X18 is Tyr, Ala, Ile, Phe, His, Arg, Lys, Trp, Orn, Amf, Amye, Cha, 2Nal, an analog thereof, or absent;
  • X19 is Ala, Lys, Arg, His, Ser, Gln, Glu, Asp, Thr, Aib, Cha, an analog thereof, a crosslinked amino acid, or absent; and
  • X20 is Arg, His, Ala, Thr, Lys, Amr, an analog thereof, a crosslinked amino acid, or absent; and
  • X21 is Arg, His, Ala, Amr, an analog thereof, or absent, or
    • a pharmaceutically-acceptable salt thereof,
    • wherein at least two of the amino acids of the amino acid sequence are a crosslinked amino acid.
  • In some embodiments, the invention provides a peptidomimetic macrocycle comprising an amino acid sequence with C-terminal amino acid residues that are -His-His, wherein the peptidomimetic macrocycle comprises a crosslink connecting at least two amino acid residues, or a pharmaceutically-acceptable salt thereof.
  • In some embodiments, the invention provides a peptidomimetic macrocycle that comprises an amino acid sequence that has at least 60% identity to any one of SEQ ID NOs.: 1-1625.
    • INCORPORATION BY REFERENCE
  • All publications, patents, and patent applications mentioned in this specification are herein incorporated by reference in their entirety for all purposes, to the same extent as if each individual publication, patent, or patent application was specifically and individually indicated to be incorporated by reference.
    • BRIEF DESCRIPTION OF THE DRAWINGS
  • FIG. 1 illustrates cell viability over time after treatment with a peptidomimetic macrocycle.
  • FIG. 2 illustrates cell viability over time after treatment with a peptidomimetic macrocycle.
  • FIG. 3 illustrates cell viability over time after treatment with a peptidomimetic macrocycle.
  • FIG. 4 illustrates cell viability over time after treatment with a peptidomimetic macrocycle.
  • FIG. 5 illustrates normalized fluorescence resonance energy transfer (FRET) signal after treatment with vehicle, a peptidomimetic macrocycle, or a BH3 mimetic.
  • FIG. 6 illustrates concentration of a peptidomimetic macrocycle in tissue over time after treatment.
  • FIG. 7 illustrates percentage remaining of a peptidomimetic macrocycle in plasma over time after treatment.
    •  DETAILED DESCRIPTION OF THE INVENTION
  • The terminology used herein is for the purpose of describing particular cases only and is not intended to be limiting. As used herein, the singular forms “a”, “an” and “the” are intended to include the plural forms as well, unless the context clearly indicates otherwise. Furthermore, to the extent that the terms “including”, “includes”, “having”, “has”, “with”, or variants thereof are used in either the detailed description or the claims, such terms are intended to be inclusive in a manner similar to the term “comprising”.
  • The term “about” or “approximately” can mean within an acceptable error range for the particular value as determined by one of ordinary skill in the art, which will depend in part on how the value is measured or determined, i.e., the limitations of the measurement system. For example, “about” can mean within 1 or more than 1 standard deviation, per the practice in the art. Alternatively, “about” can mean a range of up to 20%, up to 10%, up to 5%, or up to 1% of a given value. Alternatively, particularly with respect to biological systems or processes, the term can mean within an order of magnitude, within 5-fold, and more preferably within 2-fold, of a value. Where particular values are described in the application and claims, unless otherwise stated the term “about” meaning within an acceptable error range for the particular value should be assumed. The term “about” has the meaning as commonly understood by one of ordinary skill in the art. In some embodiments, the term “about” refers to ±10%. In some embodiments, the term “about” refers to ±5%.
  • As used herein, the term “macrocycle” refers to a molecule having a chemical structure including a ring or cycle formed by at least 9 covalently bonded atoms.
  • As used herein, the term “peptidomimetic macrocycle” or “crosslinked polypeptide” refers to a compound comprising a plurality of amino acid residues joined by a plurality of peptide bonds and at least one macrocycle-forming linker which forms a macrocycle between a first naturally-occurring or non-naturally-occurring amino acid residue (or analog) and a second naturally-occurring or non-naturally-occurring amino acid residue (or analog) within the same molecule. Peptidomimetic macrocycles include embodiments where the macrocycle-forming linker connects the α carbon of the first amino acid residue (or analog) to the α carbon of the second amino acid residue (or analog). The peptidomimetic macrocycles optionally include one or more non-peptide bonds between one or more amino acid residues or amino acid analog residues, and optionally include one or more non-naturally-occurring amino acid residues or amino acid analog residues in addition to any which form the macrocycle. A “corresponding uncrosslinked polypeptide” when referred to in the context of a peptidomimetic macrocycle is understood to relate to a polypeptide of the same length as the macrocycle and comprising the equivalent natural amino acids of the wild-type sequence corresponding to the macrocycle.
  • As used herein, the term “stability” refers to the maintenance of a defined secondary structure in solution by a peptidomimetic macrocycle of the invention as measured by circular dichroism, NMR or another biophysical measure, or resistance to proteolytic degradation in vitro or in vivo. Non-limiting examples of secondary structures contemplated in this invention are α-helices, 310 helices, β-turns, and β-pleated sheets.
  • As used herein, the term “helical stability” refers to the maintenance of a helical structure by a peptidomimetic macrocycle of the invention as measured by circular dichroism or NMR. For example, in some embodiments, the peptidomimetic macrocycles of the invention exhibit at least a 1.25, 1.5, 1.75 or 2-fold increase in α-helicity as determined by circular dichroism compared to a corresponding uncrosslinked macrocycle.
  • The term “amino acid” refers to a molecule containing both an amino group and a carboxyl group. Suitable amino acids include, without limitation, both the D-and L-isomers of the naturally-occurring amino acids, as well as non-naturally occurring amino acids prepared by organic synthesis or other metabolic routes. The term amino acid, as used herein, includes without limitation, α-amino acids, natural amino acids, non-natural amino acids, and amino acid analogs.
  • The term “α-amino acid” refers to a molecule containing both an amino group and a carboxyl group bound to a carbon which is designated the α-carbon.
  • The term “β-amino acid” refers to a molecule containing both an amino group and a carboxyl group in a βconfiguration. The abbreviation “b-” prior to an amino acid represent a beta configuration for the amino acid.
  • The term “naturally occurring amino acid” refers to any one of the twenty amino acids commonly found in peptides synthesized in nature, and known by the one letter abbreviations A, R, N, C, D, Q, E, G, H, I, L, K, M, F, P, S, T, W, Y and V.
  • The following Table shows a summary of the properties of natural amino acids:
  • Side-
    3- 1- Side- chain
    Letter Letter chain charge Hydropathy
    Amino Acid Code Code Polarity (pH 7.4) Index
    Alanine Ala A nonpolar neutral 1.8
    Arginine Arg R polar positive −4.5
    Asparagine Asn N polar neutral −3.5
    Aspartic acid Asp D polar negative −3.5
    Cysteine Cys C polar neutral 2.5
    Glutamic acid Glu E polar negative −3.5
    Glutamine Gln Q polar neutral −3.5
    Glycine Gly G nonpolar neutral −0.4
    Histidine His H polar positive(10%) −3.2
    neutral(90%)
    Isoleucine Ile I nonpolar neutral 4.5
    Leucine Leu L nonpolar neutral 3.8
    Lysine Lys K polar positive −3.9
    Methionine Met M nonpolar neutral 1.9
    Phenylalanine Phe F nonpolar neutral 2.8
    Proline Pro P nonpolar neutral −1.6
    Serine Ser S polar neutral −0.8
    Threonine Thr T polar neutral −0.7
    Tryptophan Trp W nonpolar neutral −0.9
    Tyrosine Tyr Y polar neutral −1.3
    Valine Val V nonpolar neutral 4.2
  • “Hydrophobic amino acids” include small hydrophobic amino acids and large hydrophobic amino acids. “Small hydrophobic amino acids” are glycine, alanine, proline, and analogs thereof. “Large hydrophobic amino acids” are valine, leucine, isoleucine, phenylalanine, methionine, tryptophan, tyrosine, and analogs thereof. “Polar amino acids” are serine, threonine, asparagine, glutamine, cysteine, and analogs thereof. “Charged amino acids” include positively charged amino acids and negatively charged amino acids. “Positively charged amino acids” include lysine, arginine, histidine, and analogs thereof. “Negatively charged amino acids” include aspartate, glutamate, and analogs thereof.
  • The term “amino acid analog” refers to a molecule which is structurally similar to an amino acid and which can be substituted for an amino acid in the formation of a peptidomimetic macrocycle. Amino acid analogs include, without limitation, β-amino acids and amino acids where the amino or carboxy group is substituted by a similarly reactive group (e.g., substitution of the primary amine with a secondary or tertiary amine, or substitution of the carboxy group with an ester).
  • The term “non-natural amino acid” refers to an amino acid which is not one of the the twenty amino acids commonly found in peptides synthesized in nature, and known by the one letter abbreviations A, R, N, C, D, Q, E, G, H, I, L, K, M, F, P, S, T, W, Y and V. Non-natural amino acids or amino acid analogs include, without limitation, structures according to the following:
  • Figure US20180340009A1-20181129-C00005
    Figure US20180340009A1-20181129-C00006
    Figure US20180340009A1-20181129-C00007
    Figure US20180340009A1-20181129-C00008
    Figure US20180340009A1-20181129-C00009
    Figure US20180340009A1-20181129-C00010
    Figure US20180340009A1-20181129-C00011
    Figure US20180340009A1-20181129-C00012
    Figure US20180340009A1-20181129-C00013
  • Amino acid analogs include β-amino acid analogs. Examples of β-amino acid analogs include, but are not limited to, the following: cyclic β-amino acid analogs; β-alanine; (R)-β-phenylalanine; (R)-1,2,3,4-tetrahydro-isoquinoline-3-acetic acid; (R)-3-amino-4-(1-naphthyl)-butyric acid; (R)-3-amino-4-(2,4-dichlorophenyl)butyric acid; (R)-3-amino-4-(2-chlorophenyl)-butyric acid; (R)-3-amino-4-(2-cyanophenyl)-butyric acid; (R)-3-amino-4-(2-fluorophenyl)-butyric acid; (R)-3-amino-4-(2-furyl)-butyric acid; (R)-3-amino-4-(2-methylphenyl)-butyric acid; (R)-3-amino-4-(2-naphthyl)-butyric acid; (R)-3-amino-4-(2-thienyl)-butyric acid; (R)-3-amino-4-(2-trifluoromethylphenyl)-butyric acid; (R)-3-amino-4-(3,4-dichlorophenyl)butyric acid; (R)-3-amino-4-(3,4-difluorophenyl)butyric acid; (R)-3-amino-4-(3-benzothienyl)-butyric acid; (R)-3-amino-4-(3-chlorophenyl)-butyric acid; (R)-3-amino-4-(3-cyanophenyl)-butyric acid; (R)-3-amino-4-(3-fluorophenyl)-butyric acid; (R)-3-amino-4-(3-methylphenyl)-butyric acid; (R)-3-amino-4-(3-pyridyl)-butyric acid; (R)-3-amino-4-(3-thienyl)-butyric acid; (R)-3-amino-4-(3-trifluoromethylphenyl)-butyric acid; (R)-3-amino-4-(4-bromophenyl)-butyric acid; (R)-3-amino-4-(4-chlorophenyl)-butyric acid; (R)-3-amino-4-(4-cyanophenyl)-butyric acid; (R)-3-amino-4-(4-fluorophenyl)-butyric acid; (R)-3-amino-4-(4-iodophenyl)-butyric acid; (R)-3-amino-4-(4-methylphenyl)-butyric acid; (R)-3-amino-4-(4-nitrophenyl)-butyric acid; (R)-3-amino-4-(4-pyridyl)-butyric acid; (R)-3-amino-4-(4-trifluoromethylphenyl)-butyric acid; (R)-3-amino-4-pentafluoro-phenylbutyric acid; (R)-3-amino-5-hexenoic acid; (R)-3-amino-5-hexynoic acid; (R)-3-amino-5-phenylpentanoic acid; (R)-3-amino-6-phenyl-5-hexenoic acid; (S)-1,2,3,4-tetrahydro-isoquinoline-3-acetic acid; (S)-3-amino-4-(1-naphthyl)-butyric acid; (S)-3-amino-4-(2,4-dichlorophenyl)butyric acid; (S)-3-amino-4-(2-chlorophenyl)-butyric acid; (S)-3-amino-4-(2-cyanophenyl)-butyric acid; (S)-3-amino-4-(2-fluorophenyl)-butyric acid; (S)-3-amino-4-(2-furyl)-butyric acid; (S)-3-amino-4-(2-methylphenyl)-butyric acid; (S)-3-amino-4-(2-naphthyl)-butyric acid; (S)-3-amino-4-(2-thienyl)-butyric acid; (S)-3-amino-4-(2-trifluoromethylphenyl)-butyric acid; (S)-3-amino-4-(3,4-dichlorophenyl)butyric acid; (S)-3-amino-4-(3,4-difluorophenyl)butyric acid; (S)-3-amino-4-(3-benzothienyl)-butyric acid; (S)-3-amino-4-(3-chlorophenyl)-butyric acid; (S)-3-amino-4-(3-cyanophenyl)-butyric acid; (S)-3-amino-4-(3-fluorophenyl)-butyric acid; (S)-3-amino-4-(3-methylphenyl)-butyric acid; (S)-3-amino-4-(3-pyridyl)-butyric acid; (S)-3-amino-4-(3-thienyl)-butyric acid; (S)-3-amino-4-(3-trifluoromethylphenyl)-butyric acid; (S)-3-amino-4-(4-bromophenyl)-butyric acid; (S)-3-amino-4-(4-chlorophenyl)-butyric acid; (S)-3-amino-4-(4-cyanophenyl)-butyric acid; (S)-3-amino-4-(4-fluorophenyl)-butyric acid; (S)-3-amino-4-(4-iodophenyl)-butyric acid; (S)-3-amino-4-(4-methylphenyl)-butyric acid; (S)-3-amino-4-(4-nitrophenyl)-butyric acid; (S)-3-amino-4-(4-pyridyl)-butyric acid; (S)-3-amino-4-(4-trifluoromethylphenyl)-butyric acid; (S)-3-amino-4-pentafluoro-phenylbutyric acid; (S)-3-amino-5-hexenoic acid; (S)-3-amino-5-hexynoic acid; (S)-3-amino-5-phenylpentanoic acid; (S)-3-amino-6-phenyl-5-hexenoic acid; 1,2,5,6-tetrahydropyridine-3-carboxylic acid; 1,2,5,6-tetrahydropyridine-4-carboxylic acid; 3-amino-3-(2-chlorophenyl)-propionic acid; 3-amino-3-(2-thienyl)-propionic acid; 3-amino-3-(3-bromophenyl)-propionic acid; 3-amino-3-(4-chlorophenyl)-propionic acid; 3-amino-3-(4-methoxyphenyl)-propionic acid; 3-amino-4,4,4-trifluoro-butyric acid; 3-aminoadipic acid; D-β-phenylalanine; β-leucine; L-β-homoalanine; L-β-homoaspartic acid γ-benzyl ester; L-β-homoglutamic acid δ-benzyl ester; L-β-homoisoleucine; L-β-homoleucine; L-β-homomethionine; L-β-homophenylalanine; L-β-homoproline; L-β-homotryptophan; L-β-homovaline; L-Nω-benzyloxycarbonyl-βhomolysine; Nω-L-β-homoarginine; O-benzyl-L-β-homohydroxyproline; O-benzyl-L-β-homoserine; O-benzyl-L-β-homothreonine; O-benzyl-L-β-homotyrosine; γ-trityl-L-β-homoasparagine; (R)-β-phenylalanine; L-β-homoaspartic acid γ-t-butyl ester; L-β-homoglutamic acid δ-t-butyl ester; L-Nω-β-homolysine; Nδ-trityl-L-β-homoglutamine; Nω-2,2,4,6,7-pentamethyl -dihydrobenzofuran-5-sulfonyl-L-β-homoarginine; O-t-butyl-L-β-homohydroxy-proline; O-t-butyl-L-β-homoserine; O-t-butyl-L-β-homothreonine; O-t-butyl-L-β-homotyrosine; 2-aminocyclopentane carboxylic acid; and 2-aminocyclohexane carboxylic acid.
  • Amino acid analogs include analogs of alanine, valine, glycine or leucine. Examples of amino acid analogs of alanine, valine, glycine, and leucine include, but are not limited to, the following: α-methoxyglycine; α-allyl-L-alanine; α-aminoisobutyric acid; α-methyl-leucine; β-(1-naphthyl)-D-alanine; β-(1-naphthyl)-L-alanine; β-(2-naphthyl)-D-alanine; β-(2-naphthyl)-L-alanine; β-(2-pyridyl)-D-alanine; β-(2-pyridyl)-L-alanine; β-(2-thienyl)-D-alanine; β-(2-thienyl)-L-alanine; β-(3-benzothienyl)-D-alanine; β-(3-benzothienyl)-L-alanine; β-(3-pyridyl)-D-alanine; β-(3-pyridyl)-L-alanine; β-(4-pyridyl)-D-alanine; β-(4-pyridyl)-L-alanine; β-chloro-L-alanine; β-cyano-L-alanin; β-cyclohexyl-D-alanine; β-cyclohexyl-L-alanine; β-cyclopenten-1-yl-alanine; β-cyclopentyl-alanine; β-cyclopropyl-L-Ala-OH•dicyclohexylammonium salt; β-t-butyl-D-alanine; β-t-butyl-L-alanine; γ-aminobutyric acid; L-α,β-diaminopropionic acid; 2,4-dinitro-phenylglycine; 2,5-dihydro-D-phenylglycine; 2-amino-4,4,4-trifluorobutyric acid; 2-fluoro-phenylglycine; 3-amino-4,4,4-trifluoro -butyric acid; 3-fluoro-valine; 4,4,4-trifluoro-valine; 4,5-dehydro-L-leu-OH•dicyclohexylammonium salt; 4-fluoro-D-phenylglycine; 4-fluoro-L-phenylglycine; 4-hydroxy-D-phenylglycine; 5,5,5-trifluoro-leucine; 6-aminohexanoic acid; cyclopentyl-D-Gly-OH•dicyclohexylammonium salt; cyclopentyl-Gly-OH•dicyclohexylammonium salt; D-α,β-diaminopropionic acid; D-α-aminobutyric acid; D-α-t-butylglycine; D-(2-thienyl)glycine; D-(3-thienyl)glycine; D-2-aminocaproic acid; D-2-indanylglycine; D-allylglycine•dicyclohexylammonium salt; D-cyclohexylglycine; D-norvaline; D-phenylglycine; β-aminobutyric acid; β-aminoisobutyric acid; (2-bromophenyl)glycine; (2-methoxyphenyl)glycine; (2-methylphenyl)glycine; (2-thiazoyl)glycine; (2-thienyl)glycine; 2-amino-3-(dimethylamino)-propionic acid; L-α,β-diaminopropionic acid; L-α-aminobutyric acid; L-α-t-butylglycine; L-(3-thienyl)glycine; L-2-amino-3-(dimethylamino)-propionic acid; L-2-aminocaproic acid dicyclohexyl-ammonium salt; L-2-indanylglycine; L-allylglycine•dicyclohexyl ammonium salt; L-cyclohexylglycine; L-phenylglycine; L-propargylglycine; L-norvaline; N-α-aminomethyl-L-alanine; D-α,γ-diaminobutyric acid; L-α,γ-diaminobutyric acid; β-cyclopropyl-L-alanine; (N-β-(2,4-dinitrophenyl))-L-α,β-diaminopropionic acid; (N-β-1-(4,4-dimethyl-2,6-dioxocyclohex-1-ylidene)ethyl)-D-α,β-diaminopropionic acid; (N-β-1-(4,4-dimethyl -2,6-dioxocyclohex-1-ylidene)ethyl)-L-α,β-diaminopropionic acid; (N-β-4-methyltrityl)-L-α,β-diaminopropionic acid; (N-β-allyloxycarbonyl)-L-α,β-diaminopropionic acid; (N-γ-1-(4,4-dimethyl-2,6-dioxocyclohex-1-ylidene)ethyl)-D-α,γ-diaminobutyric acid; (N-γ-1-(4,4-dimethyl-2,6-dioxocyclohex-1-ylidene)ethyl)-L-α,γ-diaminobutyric acid; (N-γ-4-methyltrityl)-D-α,γ-diaminobutyric acid; (N-γ-4-methyltrityl)-L-α,γ-diaminobutyric acid; (N-γ-allyloxycarbonyl)-L-α,γ-diaminobutyric acid; D-α,γ-diaminobutyric acid; 4,5-dehydro-L-leucine; cyclopentyl-D-Gly-OH; cyclopentyl-Gly-OH; D-allylglycine; D-homocyclohexylalanine; L-1-pyrenylalanine; L-2-aminocaproic acid; L-allylglycine; L-homocyclohexylalanine; and N-(2-hydroxy-4-methoxy-Bzl)-Gly-OH.
  • Amino acid analogs include analogs of arginine or lysine. Examples of amino acid analogs of arginine and lysine include, but are not limited to, the following: citrulline; L-2-amino-3-guanidinopropionic acid; L-2-amino-3-ureidopropionic acid; L-citrulline; Lys(Me)2-OH; Lys(N3)—OH; Nδ-benzyloxycarbonyl-L-ornithine; Nω-nitro-D-arginine; Nω-nitro-L-arginine; α-methyl-ornithine; 2,6-diaminoheptanedioic acid; L-ornithine; (Nδ-1-(4,4-dimethyl-2,6-dioxo-cyclohex-1-ylidene)ethyl)-D-ornithine; (Nδ-1-(4,4-dimethyl-2,6-dioxo-cyclohex-1-ylidene)ethyl)-L-ornithine; (Nδ-4-methyltrityl)-D-ornithine; (Nδ-4-methyltrityl)-L-ornithine; D-ornithine; L-ornithine; Arg(Me)(Pbf)-OH; Arg(Me)2-OH (asymmetrical); Arg(Me)2-OH (symmetrical); Lys(ivDde)-OH; Lys(Me)2-OH•HCl; Lys(Me3)-OH chloride; Nω-nitro-D-arginine; and Nω-nitro-L-arginine.
  • Amino acid analogs include analogs of aspartic or glutamic acids. Examples of amino acid analogs of aspartic and glutamic acids include, but are not limited to, the following: α-methyl-D-aspartic acid; α-methyl-glutamic acid; α-methyl-L-aspartic acid; γ-methylene-glutamic acid; (N-γ-ethyl)-L-glutamine; [N-α-(4-aminobenzoyl)]-L-glutamic acid; 2,6-diaminopimelic acid; L-α-aminosuberic acid; D-2-aminoadipic acid; D-α-aminosuberic acid; α-aminopimelic acid; iminodiacetic acid; L-2-amino adipic acid; threo-β-methyl-aspartic acid; γ-carboxy-D-glutamic acid γ,γ-di-t-butyl ester; γ-carboxy-L-glutamic acid γ,γ-di-t-butyl ester; Glu(OAll)-OH; L-Asu(OtBu)-OH; and pyroglutamic acid.
  • Amino acid analogs include analogs of cysteine and methionine. Examples of amino acid analogs of cysteine and methionine include, but are not limited to, Cys(farnesyl)-OH, Cys(farnesyl)-OMe, α-methyl-methionine, Cys(2-hydroxyethyl)-OH, Cys(3-aminopropyl)-OH, 2-amino-4-(ethylthio)butyric acid, buthionine, buthioninesulfoximine, ethionine, methionine methylsulfonium chloride, selenomethionine, cysteic acid, [2-(4-pyridyl)ethyl]-DL-penicillamine, [2-(4-pyridyl)ethyl]-L-cysteine, 4-methoxybenzyl-D-penicillamine, 4-methoxybenzyl-L-penicillamine, 4-methylbenzyl-D-penicillamine, 4-methylbenzyl-L-penicillamine, benzyl-D-cysteine, benzyl-L-cysteine, benzyl-DL-homocysteine, carbamoyl-L-cysteine, carboxyethyl-L-cysteine, carboxymethyl-L-cysteine, diphenylmethyl-L-cysteine, ethyl-L-cysteine, methyl-L-cysteine, t-butyl-D-cysteine, trityl-L-homocysteine, trityl-D-penicillamine, cystathionine, homocystine, L-homocystine, (2-aminoethyl)-L-cysteine, seleno-L-cystine, cystathionine, Cys(StBu)-OH, and acetamidomethyl-D-penicillamine.
  • Amino acid analogs include analogs of phenylalanine and tyrosine. Examples of amino acid analogs of phenylalanine and tyrosine include β-methyl-phenylalanine, β-hydroxyphenylalanine, α-methyl-3-methoxy-DL-phenylalanine, α-methyl-D-phenylalanine, α-methyl-L-phenylalanine, 1,2,3,4-tetrahydroisoquinoline-3-carboxylic acid, 2,4-dichloro-phenylalanine, 2-(trifluoromethyl)-D-phenylalanine, 2-(trifluoromethyl)-L-phenylalanine, 2-bromo-D-phenylalanine, 2-bromo-L-phenylalanine, 2-chloro-D-phenylalanine, 2-chloro-L-phenylalanine, 2-cyano-D-phenylalanine, 2-cyano-L-phenylalanine, 2-fluoro-D-phenylalanine, 2-fluoro-L-phenylalanine, 2-methyl-D-phenylalanine, 2-methyl-L-phenylalanine, 2-nitro-D-phenylalanine, 2-nitro-L-phenylalanine, 2;4;5-trihydroxy-phenylalanine, 3,4,5-trifluoro-D-phenylalanine, 3,4,5-trifluoro-L-phenylalanine, 3,4-dichloro-D-phenylalanine, 3,4-dichloro-L-phenylalanine, 3,4-difluoro-D-phenylalanine, 3,4-difluoro-L-phenylalanine, 3,4-dihydroxy-L-phenylalanine, 3,4-dimethoxy-L-phenylalanine, 3,5,3′-triiodo-L-thyronine, 3,5-diiodo-D-tyrosine, 3,5-diiodo-L-tyrosine, 3,5-diiodo-L-thyronine, 3-(trifluoromethyl)-D-phenylalanine, 3-(trifluoromethyl)-L-phenylalanine, 3-amino-L-tyrosine, 3-bromo-D-phenylalanine, 3-bromo-L-phenylalanine, 3-chloro-D-phenylalanine, 3-chloro-L-phenylalanine, 3-chloro-L-tyrosine, 3-cyano-D-phenylalanine, 3-cyano-L-phenylalanine, 3-fluoro-D-phenylalanine, 3-fluoro-L-phenylalanine, 3-fluoro-tyrosine, 3-iodo-D-phenylalanine, 3-iodo-L-phenylalanine, 3-iodo-L-tyrosine, 3-methoxy-L-tyrosine, 3-methyl-D-phenylalanine, 3-methyl-L-phenylalanine, 3-nitro-D-phenylalanine, 3-nitro-L-phenylalanine, 3-nitro-L-tyrosine, 4-(trifluoromethyl)-D-phenylalanine, 4-(trifluoromethyl)-L-phenylalanine, 4-amino-D-phenylalanine, 4-amino-L-phenylalanine, 4-benzoyl-D-phenylalanine, 4-benzoyl-L-phenylalanine, 4-bis(2-chloroethyl)amino-L-phenylalanine, 4-bromo-D-phenylalanine, 4-bromo-L-phenylalanine, 4-chloro-D-phenylalanine, 4-chloro-L-phenylalanine, 4-cyano-D-phenylalanine, 4-cyano-L-phenylalanine, 4-fluoro-D-phenylalanine, 4-fluoro-L-phenylalanine, 4-iodo-D-phenylalanine, 4-iodo-L-phenylalanine, homophenylalanine, thyroxine, 3,3-diphenylalanine, thyronine, ethyl-tyrosine, and methyl-tyrosine.
  • Amino acid analogs include analogs of proline. Examples of amino acid analogs of proline include, but are not limited to, 3,4-dehydro-proline, 4-fluoro-proline, cis-4-hydroxy-proline, thiazolidine-2-carboxylic acid, and trans-4-fluoro-proline.
  • Amino acid analogs include analogs of serine and threonine. Examples of amino acid analogs of serine and threonine include, but are not limited to, 3-amino-2-hydroxy-5-methylhexanoic acid, 2-amino-3-hydroxy-4-methylpentanoic acid, 2-amino-3-ethoxybutanoic acid, 2-amino-3-methoxybutanoic acid, 4-amino-3-hydroxy-6-methylheptanoic acid, 2-amino-3-benzyloxypropionic acid, 2-amino-3-benzyloxypropionic acid, 2-amino-3-ethoxypropionic acid, 4-amino-3-hydroxybutanoic acid, and α-methylserine.
  • Amino acid analogs include analogs of tryptophan. Examples of amino acid analogs of tryptophan include, but are not limited to, the following: α-methyl-tryptophan; β-(3-benzothienyl)-D-alanine; β-(3-benzothienyl)-L-alanine; 1-methyl-tryptophan; 4-methyl-tryptophan; 5-benzyloxy-tryptophan; 5-bromo-tryptophan; 5-chloro-tryptophan; 5-fluoro-tryptophan; 5-hydroxy-tryptophan; 5-hydroxy-L-tryptophan; 5-methoxy-tryptophan; 5-methoxy-L-tryptophan; 5-methyl-tryptophan; 6-bromo-tryptophan; 6-chloro-D-tryptophan; 6-chloro-tryptophan; 6-fluoro-tryptophan; 6-methyl-tryptophan; 7-benzyloxy-tryptophan; 7-bromo-tryptophan; 7-methyl-tryptophan; D-1,2,3,4-tetrahydro-norharman-3-carboxylic acid; 6-methoxy-1,2,3,4-tetrahydronorharman-1-carboxylic acid; 7-azatryptophan; L-1,2,3,4-tetrahydro-norharman-3-carboxylic acid; 5-methoxy-2-methyl-tryptophan; and 6-chloro-L-tryptophan.
  • In some embodiments, amino acid analogs are racemic. In some embodiments, the D isomer of the amino acid analog is used. In some embodiments, the L isomer of the amino acid analog is used. In other embodiments, the amino acid analog comprises chiral centers that are in the R or S configuration. In still other embodiments, the amino group(s) of a β-amino acid analog is substituted with a protecting group, e.g., tert-butyloxycarbonyl (BOC group), 9-fluorenylmethyloxycarbonyl (FMOC), tosyl, and the like. In yet other embodiments, the carboxylic acid functional group of a β-amino acid analog is protected, e.g., as its ester derivative. In some embodiments the salt of the amino acid analog is used.
  • A “non-essential” amino acid residue is a residue that can be altered from the wild-type sequence of a polypeptide without abolishing or substantially abolishing its essential biological or biochemical activity (e.g., receptor binding or activation). An “essential” amino acid residue is a residue that, when altered from the wild-type sequence of the polypeptide, results in abolishing or substantially abolishing the polypeptide's essential biological or biochemical activity.
  • A “conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art. These families include amino acids with basic side chains (e.g., K, R, H), acidic side chains (e.g., D, E), uncharged polar side chains (e.g., G, N, Q, S, T, Y, C), nonpolar side chains (e.g., A, V, L, I, P, F, M, W), beta-branched side chains (e.g., T, V, I) and aromatic side chains (e.g., Y, F, W, H). Thus, a predicted nonessential amino acid residue in a polypeptide, for example, is replaced with another amino acid residue from the same side chain family. Other examples of acceptable substitutions are substitutions based on isosteric considerations (e.g. norleucine for methionine) or other properties (e.g. 2-thienylalanine for phenylalanine).
  • The term “capping group” refers to the chemical moiety occurring at either the carboxy or amino terminus of the polypeptide chain of the subject peptidomimetic macrocycle. The capping group of a carboxy terminus includes an unmodified carboxylic acid (ie —COOH) or a carboxylic acid with a substituent. For example, the carboxy terminus can be substituted with an amino group to yield a carboxamide at the C-terminus. Various substituents include but are not limited to primary and secondary amines, including pegylated secondary amines. Non-limiting representative secondary amine capping groups for the C-terminus include:
  • Figure US20180340009A1-20181129-C00014
    Figure US20180340009A1-20181129-C00015
  • The capping group of an amino terminus includes an unmodified amine (ie —NH2) or an amine with a substituent. For example, the amino terminus can be substituted with an acyl group to yield a carboxamide at the N-terminus. Various substituents include but are not limited to substituted acyl groups, including C1-C6 carbonyls, C7-C30 carbonyls, and pegylated carbamates. Non-limiting representative capping groups for the N-terminus include:
  • Figure US20180340009A1-20181129-C00016
    Figure US20180340009A1-20181129-C00017
  • The term “member” as used herein in conjunction with macrocycles or macrocycle-forming linkers refers to the atoms that form or can form the macrocycle, and excludes substituent or side chain atoms. By analogy, cyclodecane, 1,2-difluoro-decane and 1,3-dimethyl cyclodecane are all considered ten-membered macrocycles as the hydrogen or fluoro substituents or methyl side chains do not participate in forming the macrocycle.
  • The symbol “
    Figure US20180340009A1-20181129-P00001
    ” when used as part of a molecular structure refers to a single bond or a trans or cis double bond.
  • The term “amino acid side chain” refers to a moiety attached to the α-carbon (or another backbone atom) in an amino acid. For example, the amino acid side chain for alanine is methyl, the amino acid side chain for phenylalanine is phenylmethyl, the amino acid side chain for cysteine is thiomethyl, the amino acid side chain for aspartate is carboxymethyl, the amino acid side chain for tyrosine is 4-hydroxyphenylmethyl, etc. Other non-naturally occurring amino acid side chains are also included, for example, those that occur in nature (e.g., an amino acid metabolite) or those that are made synthetically (e.g., an α,α di-substituted amino acid).
  • The term “α,α di-substituted amino” acid refers to a molecule or moiety containing both an amino group and a carboxyl group bound to a carbon (the α-carbon) that is attached to two natural or non-natural amino acid side chains.
  • The term “polypeptide” encompasses two or more naturally or non-naturally-occurring amino acids joined by a covalent bond (e.g., an amide bond). Polypeptides as described herein include full length proteins (e.g., fully processed proteins) as well as shorter amino acid sequences (e.g., fragments of naturally-occurring proteins or synthetic polypeptide fragments).
  • The term “macrocyclization reagent” or “macrocycle-forming reagent” as used herein refers to any reagent which may be used to prepare a peptidomimetic macrocycle of the invention by mediating the reaction between two reactive groups. Reactive groups may be, for example, an azide and alkyne, in which case macrocyclization reagents include, without limitation, Cu reagents such as reagents which provide a reactive Cu(I) species, such as CuBr, CuI or CuOTf, as well as Cu(II) salts such as Cu(CO2CH3)2, CuSO4, and CuCl2 that can be converted in situ to an active Cu(I) reagent by the addition of a reducing agent such as ascorbic acid or sodium ascorbate. Macrocyclization reagents may additionally include, for example, Ru reagents known in the art such as Cp*RuCl(PPh3)2, [Cp*RuCl]4 or other Ru reagents which may provide a reactive Ru(II) species. In other cases, the reactive groups are terminal olefins. In such embodiments, the macrocyclization reagents or macrocycle-forming reagents are metathesis catalysts including, but not limited to, stabilized, late transition metal carbene complex catalysts such as Group VIII transition metal carbene catalysts. For example, such catalysts are Ru and Os metal centers having a +2 oxidation state, an electron count of 16 and pentacoordinated. In other examples, catalysts have W or Mo centers. Various catalysts are disclosed in Grubbs et al., “Ring Closing Metathesis and Related Processes in Organic Synthesis” Acc. Chem. Res. 1995, 28, 446-452, and U.S. Pat. No. 5,811,515; U.S. Pat. No. 7,932,397; U.S. Application No. 2011/0065915; U.S. Application No. 2011/0245477; Yu et al., “Synthesis of Macrocyclic Natural Products by Catalyst-Controlled Stereoselective Ring-Closing Metathesis,” Nature 2011, 479, 88; and Peryshkov et al., “Z-Selective Olefin Metathesis Reactions Promoted by Tungsten Oxo Alkylidene Complexes,” J. Am. Chem. Soc. 2011, 133, 20754. In yet other cases, the reactive groups are thiol groups. In such embodiments, the macrocyclization reagent is, for example, a linker functionalized with two thiol-reactive groups such as halogen groups.
  • The term “halo” or “halogen” refers to fluorine, chlorine, bromine or iodine or a radical thereof.
  • The term “alkyl” refers to a hydrocarbon chain that is a straight chain or branched chain, containing the indicated number of carbon atoms. For example, C1-C10 indicates that the group has from 1 to 10 (inclusive) carbon atoms in it. In the absence of any numerical designation, “alkyl” is a chain (straight or branched) having 1 to 20 (inclusive) carbon atoms in it.
  • The term “alkylene” refers to a divalent alkyl (i.e., —R—).
  • The term “alkenyl” refers to a hydrocarbon chain that is a straight chain or branched chain having one or more carbon-carbon double bonds. The alkenyl moiety contains the indicated number of carbon atoms. For example, C2-C10 indicates that the group has from 2 to 10 (inclusive) carbon atoms in it. The term “lower alkenyl” refers to a C2-C6 alkenyl chain. In the absence of any numerical designation, “alkenyl” is a chain (straight or branched) having 2 to 20 (inclusive) carbon atoms in it.
  • The term “alkynyl” refers to a hydrocarbon chain that is a straight chain or branched chain having one or more carbon-carbon triple bonds. The alkynyl moiety contains the indicated number of carbon atoms. For example, C2-C10 indicates that the group has from 2 to 10 (inclusive) carbon atoms in it. The term “lower alkynyl” refers to a C2-C6 alkynyl chain. In the absence of any numerical designation, “alkynyl” is a chain (straight or branched) having 2 to 20 (inclusive) carbon atoms in it.
  • The term “aryl” refers to a monocyclic or bicyclic aromatic ring system wherein 0, 1, 2, 3, or 4 atoms of each ring are substituted by a substituent. Examples of aryl groups include phenyl, biphenyl, naphthyl and the like. The term “arylalkoxy” refers to an alkoxy substituted with aryl.
  • “Arylalkyl” refers to an aryl group, as defined above, wherein one of the aryl group's hydrogen atoms has been replaced with a C1-C5 alkyl group, as defined above. Representative examples of an arylalkyl group include, but are not limited to, 2-methylphenyl, 3-methylphenyl, 4-methylphenyl, 2-ethylphenyl, 3-ethylphenyl, 4-ethylphenyl, 2-propylphenyl, 3-propylphenyl, 4-propylphenyl, 2-butylphenyl, 3-butylphenyl, 4-butylphenyl, 2-pentylphenyl, 3-pentylphenyl, 4-pentylphenyl, 2-isopropylphenyl, 3-isopropylphenyl, 4-isopropylphenyl, 2-isobutylphenyl, 3-isobutylphenyl, 4-isobutylphenyl, 2-sec-butylphenyl, 3-sec-butylphenyl, 4-sec-butylphenyl, 2-t-butylphenyl, 3-t-butylphenyl and 4-t-butylphenyl.
  • “Arylamido” refers to an aryl group, as defined above, wherein one of the aryl group's hydrogen atoms has been replaced with one or more —C(O)NH2 groups. Representative examples of an arylamido group include 2-C(O)NH2-phenyl, 3-C(O)NH2-phenyl, 4-C(O)NH2-phenyl, 2-C(O)NH2-pyridyl, 3-C(O)NH2-pyridyl, and 4-C(O)NH2-pyridyl,
  • “Alkylheterocycle” refers to a C1-C5 alkyl group, as defined above, wherein one of the C1-C5 alkyl group's hydrogen atoms has been replaced with a heterocycle. Representative examples of an alkylheterocycle group include, but are not limited to, —CH2CH2-morpholine, —CH2CH2-piperidine, —CH2CH2CH2-morpholine, and —CH2CH2CH2-imidazole.
  • “Alkylamido” refers to a C1-C5 alkyl group, as defined above, wherein one of the C1-C5 alkyl group's hydrogen atoms has been replaced with a —C(O)NH2 group. Representative examples of an alkylamido group include, but are not limited to, —CH2—C(O)NH2, —CH2CH2—C(O)NH2, —CH2CH2CH2C(O)NH2, —CH2CH2CH2CH2C(O)NH2, —CH2CH2CH2CH2CH2C(O)NH2, —CH2CH(C(O)NH2)CH3, —CH2CH(C(O)NH2)CH2CH3, —CH(C(O)NH2)CH2CH3, —C(CH3)2CH2C(O)NH2, —CH2—CH2—NH—C(O)—CH3, —CH2—CH2—NH—C(O)—CH3—CH3, and —CH2—CH2—NH—C(O)—CH═CH2.
  • “Alkanol” refers to a C1-C5 alkyl group, as defined above, wherein one of the C1-C5 alkyl group's hydrogen atoms has been replaced with a hydroxyl group. Representative examples of an alkanol group include, but are not limited to, —CH2OH, —CH2CH2OH, —CH2CH2CH2OH, —CH2CH2CH2CH2OH, —CH2CH2CH2 CH2CH2OH, —CH2CH(OH)CH3, —CH2CH(OH)CH2CH3, —CH(OH)CH3 and —C(CH3)2CH2OH.
  • “Alkylcarboxy” refers to a C1-C5 alkyl group, as defined above, wherein one of the C1-C5 alkyl group's hydrogen atoms has been replaced with a —COOH group. Representative examples of an alkylcarboxy group include, but are not limited to, —CH2COOH, —CH2CH2COOH, —CH2CH2CH2COOH, —CH2CH2CH2CH2COOH, —CH2CH(COOH)CH3, —CH2CH2CH2CH2CH2COOH, —CH2CH(COOH)CH2CH3, —CH(COOH)CH2CH3 and —C(CH3)2CH2COOH.
  • The term “cycloalkyl” as employed herein includes saturated and partially unsaturated cyclic hydrocarbon groups having 3 to 12 carbons, preferably 3 to 8 carbons, and more preferably 3 to 6 carbons, wherein the cycloalkyl group additionally is optionally substituted. Some cycloalkyl groups include, without limitation, cyclopropyl, cyclobutyl, cyclopentyl, cyclopentenyl, cyclohexyl, cyclohexenyl, cycloheptyl, and cyclooctyl.
  • The term “heteroaryl” refers to an aromatic 5-8 membered monocyclic, 8-12 membered bicyclic, or 11-14 membered tricyclic ring system having 1-3 heteroatoms if monocyclic, 1-6 heteroatoms if bicyclic, or 1-9 heteroatoms if tricyclic, said heteroatoms selected from O, N, or S (e.g., carbon atoms and 1-3, 1-6, or 1-9 heteroatoms of O, N, or S if monocyclic, bicyclic, or tricyclic, respectively), wherein 0, 1, 2, 3, or 4 atoms of each ring are substituted by a substituent. Examples of heteroaryl groups include pyridyl, furyl or furanyl, imidazolyl, benzimidazolyl, pyrimidinyl, thiophenyl or thienyl, quinolinyl, indolyl, thiazolyl, and the like.
  • The term “heteroarylalkyl” or the term “heteroaralkyl” refers to an alkyl substituted with a heteroaryl. The term “heteroarylalkoxy” refers to an alkoxy substituted with heteroaryl.
  • The term “heteroarylalkyl” or the term “heteroaralkyl” refers to an alkyl substituted with a heteroaryl. The term “heteroarylalkoxy” refers to an alkoxy substituted with heteroaryl.
  • The term “heterocyclyl” refers to a nonaromatic 5-8 membered monocyclic, 8-12 membered bicyclic, or 11-14 membered tricyclic ring system having 1-3 heteroatoms if monocyclic, 1-6 heteroatoms if bicyclic, or 1-9 heteroatoms if tricyclic, said heteroatoms selected from O, N, or S (e.g., carbon atoms and 1-3, 1-6, or 1-9 heteroatoms of O, N, or S if monocyclic, bicyclic, or tricyclic, respectively), wherein 0, 1, 2 or 3 atoms of each ring are substituted by a substituent. Examples of heterocyclyl groups include piperazinyl, pyrrolidinyl, dioxanyl, morpholinyl, tetrahydrofuranyl, and the like.
  • The term “substituent” refers to a group replacing a second atom or group such as a hydrogen atom on any molecule, compound or moiety. Suitable substituents include, without limitation, halo, hydroxy, mercapto, oxo, nitro, haloalkyl, alkyl, alkaryl, aryl, aralkyl, alkoxy, thioalkoxy, aryloxy, amino, alkoxycarbonyl, amido, carboxy, alkanesulfonyl, alkylcarbonyl, and cyano groups.
  • In some embodiments, the compounds of this invention contain one or more asymmetric centers and thus occur as racemates and racemic mixtures, single enantiomers, individual diastereomers and diastereomeric mixtures. All such isomeric forms of these compounds are included in the present invention unless expressly provided otherwise. In some embodiments, the compounds of this invention are also represented in multiple tautomeric forms, in such instances, the invention includes all tautomeric forms of the compounds described herein (e.g., if alkylation of a ring system results in alkylation at multiple sites, the invention includes all such reaction products). All such isomeric forms of such compounds are included in the present invention unless expressly provided otherwise. All crystal forms of the compounds described herein are included in the present invention unless expressly provided otherwise.
  • As used herein, the terms “increase” and “decrease” mean, respectively, to cause a statistically significantly (i.e., p<0.1) increase or decrease of at least 5%.
  • As used herein, the recitation of a numerical range for a variable is intended to convey that the variable is equal to any of the values within that range. Thus, for a variable which is inherently discrete, the variable is equal to any integer value within the numerical range, including the end-points of the range Similarly, for a variable which is inherently continuous, the variable is equal to any real value within the numerical range, including the end-points of the range. As an example, and without limitation, a variable which is described as having values between 0 and 2 takes the values 0, 1 or 2 if the variable is inherently discrete, and takes the values 0.0, 0.1, 0.01, 0.001, or any other real values ≥0 and ≤2 if the variable is inherently continuous.
  • As used herein, unless specifically indicated otherwise, the word “or” is used in the inclusive sense of “or” and not the exclusive sense of “either/or.”
  • The term “on average” represents the mean value derived from performing at least three independent replicates for each data point.
  • The term “biological activity” encompasses structural and functional properties of a macrocycle of the invention. Biological activity is, for example, structural stability, alpha-helicity, affinity for a target, resistance to proteolytic degradation, cell penetrability, intracellular stability, in vivo stability, or any combination thereof.
  • The details of one or more particular embodiments of the invention are set forth in the accompanying drawings and the description below. Other features, objects, and advantages of the invention will be apparent from the description and drawings, and from the claims.
    • Peptidomimetic Macrocycles of the Invention
  • The present invention provides pharmaceutical formulations comprising an effective amount of peptidomimetic macrocycles or pharmaceutically acceptable salts thereof. The peptidomimetic macrocycles of the invention are cross-linked (e.g., stapled or stitched) and possess improved pharmaceutical properties relative to their corresponding uncross-linked peptidomimetic macrocycles. These improved properties include improved bioavailability, enhanced chemical and in vivo stability, increased potency, and reduced immunogenicity (i.e., fewer or less severe injection site reactions).
  • In some embodiments, the peptide sequences are derived from BIM.
  • In some embodiments, a peptidomimetic macrocycle peptide derived from a human BIM peptide can be a peptide comprising 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, or 22 amino acids from a BIM peptide sequence.
  • In some embodiments, a peptidomimetic macrocycle peptide derived from a human BIM peptide sequence can be a peptide comprising 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, or 22 amino acids that are different from the selected sequences from which the peptide is derived. In some embodiments, a peptidomimetic macrocycle peptide derived from a human BIM peptide sequence can be a peptide comprising a mutation at amino acid position 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, or 22. In some embodiments, mutations are mutations of non-essential amino acids. In some embodiments, mutations are mutations of essential amino acids. In some embodiments, mutations are mutations of hydrophobic amino acids. In some embodiments, mutations are mutations of naturally occurring amino acids. In some embodiments, mutations are mutations to a conservative amino acid. In some embodiments, a peptidomimetic macrocycle peptide derived from a human BIM peptide sequence can be a peptide comprising 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, or 22 amino acid analogues. In some embodiments, a peptidomimetic macrocycle peptide derived from a human BIM peptide sequence can be a peptide comprising 1 or 2 capping groups.
  • In some embodiments, the peptidomimetic macrocycle comprises a C-terminal truncation of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29 or 30 amino acids from an amino acid sequence in Table 1. In some embodiments, the peptidomimetic macrocycle comprises a N-terminal truncation of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, or 22 amino acids from the sequence of BIM.
  • A non-limiting list of suitable BIM macrocycles for use in the present disclosure are given in Table 1. In Table 1, at the C-terminus, some peptides possess a carboxamide terminus (shown as —NH2); some peptides possess a hydroxyl terminus (shown as -OH); some peptides possess a 5-carboxyfluorescein terminus (shown as -5-FAM); some peptides possess a isobutylamide terminus (shown as -NHiBu); some peptides possess a cyclohexylamide terminus (shown as -NHChx); some peptides possess a cyclohexylmethylamide terminus (shown as -NHMeChx); some peptides possess a phenethylamide terminus (shown as -NHPe); some peptides possess a n-butylamide terminus (shown as -NHBu); some peptides possess a sec-butylamide terminus (shown as -NHsBu); and some peptides possess an uncapped terminus (shown as no terminal modification).
  • In Table 1, at the N-terminus, some peptides possess an acetyl terminus (shown as Ac-); some peptides possess a fluorescein isothiocyanate terminus (shown as FITC-); some peptides possess a single-unit polyethylene glycol terminus (shown as dPEG1-); some peptides possess a five-unit polyethylene glycol terminus (shown as dPEG5-); some peptides possess an eleven-unit polyethylene glycol terminus (shown as dPEG11-); some peptides possess a propyl terminus (shown as Pr-); some peptides possess a biotin terminus (shown as Biotin-); some peptides possess a KLH terminus (shown as KLH-); some peptides possess an ovalbumin terminus (shown as OVA-); some peptides possess an uncapped terminus (shown as H-); some peptides possess a isobutyl terminus (shown as iBu-); some peptides possess a decanoyl terminus (shown as Decac-); some peptides possess a benzyl terminus (shown as Bz-); some peptides possess a cyclohexyl terminus (shown as Chx-); some peptides possess a benzyl terminus (shown as Bz-); some peptides possess a Vrl terminus (shown as Vrl-); some peptides possess a HBS terminus (shown as HBS-); some peptides possess a Melm terminus (shown as MeImC-); some peptides possess a tert-butyl terminus (shown as t-Bu-U-); some peptides possess a nonanoyl terminus (shown as non-U-); some peptides possess a ethyl terminus (shown as Et-U-); some peptides possess a cyclohexyl terminus (shown as Chx-U-); some peptides possess a isopropyl terminus (shown as iPr-U-); some peptides possess a phenyl terminus (shown as Ph-U-); some peptides possess a uric terminus (shown as NH2CO-); some peptides possess a palmitoyl terminus (shown as Pam-); some peptides possess a heptenoic terminus (shown as Hep-); and some peptides possess a 5-carboxytetramethylrhodamine terminus (shown as 5-TAMRA-).
  • TABLE 1
    SEQ
    ID
    NO Peptide seguence
    1 Ac-IWIAQELRRIGDEFNAYYARR-NH2
    2 Ac-IWIAQELR$IGD$FNAYYARR-NH2
    3 Ac-IWIAQELR$IED$FNAYYARR-NH2
    4 FITC-IWIAQELRRIGDEFNAYYARR-NH2
    5 FITC-IWIAQELR$IGD$FNAYYARR-NH2
    6 FITC-IWIAQELR$IED$FNAYYARR-NH2
    7 Ac-IWIAQQLR$IGD$FNAYYARR-NH2
    8 Ac-RWIAQQLR$IGD$FNAYYARR-NH2
    9 Ac-IRIAQQLR$IGD$FNAYYARR-NH2
    10 Ac-RRIAQQLR$IGD$FNAYYARR-NH2
    11 Ac-EIWIAQQLR$IGD$FNAYYARR-NH2
    12 Ac-ERRIAQQLR$IGD$FNAYYARR-NH2
    13 Ac-IRIAQELR$IGD$FNAYYARR-NH2
    14 Ac-RWIAQELR$IGD$FNAYYARR-NH2
    15 Ac-RRIAQELR$IGD$FNAYYARR-NH2
    16 Ac-EIWIAQELR$IGD$FNAYYARR-NH2
    17 Ac-ERWIAQELR$IGD$FNAYYARR-NH2
    18 Ac-EIRIAQELR$IGD$FNAYYARR-NH2
    19 Ac-ERRIAQELR$IGD$FNAYYARR-NH2
    20 PEG1-IWIAQELR$IGD$FNAYYARR-NH2
    21 PEGS-IWIAQELR$IGD$FNAYYARR-NH2
    22 PEG11-IWIAQELR$IGD$FNAYYARR-NH2
    23 Ac-IWIAQELR$IGD$FNASYARR-NH2
    24 Ac-RRIAQELR$IGD$FNASYARR-NH2
    25 Ac-ERRIAQELR$IGD$FNASYARR-NH2
    26 Ac-RRIAQELR$IGD$FNAYYAR-NH2
    27 Ac-RRIAQELR$IGD$FNAYYA-NH2
    28 Ac-RRIAQELR$IGD$FNAYYAib-NH2
    29 Ac-RRIAQELR$IGD$FNASYAib-NH2
    30 Ac-IWIAQELR$IAibD$FNAYYAR-NH2
    31 Ac-IWIAQELR%IAibD%FNAYYAR-NH2
    32 Ac-IRIAQELRRIGDEFNETYTRR-NH2
    33 Ac-IRIAQELR$IGD$FNETYTRR-NH2
    34 Ac-IRIAQELR$IED$FNETYTRR-NH2
    35 Ac-IWIAQELR$/IGD$/FNAYYARR-NH2
    36 Pr-IWIAQELR$IGD$FNAYYARR-NH2
    37 Ac-IWIAQELR$IAibD$FNAYYARR-NH2
    38 Ac-IWIAQELR%IAibD%FNAYYARR-NH2
    39 Ac-IWIAQELR$IGD$ANAYYARR-NH2
    40 Ac-IWIAQELR$IGD$FAAYYARR-NH2
    41 Ac-IWIAQELR$IGD$AAAYYARR-NH2
    42 Ac-IWIAQELR%IGD%FNAYYARR-NH2
    43 Ac-AWIAQELR$IGD$FNAYYARR-NH2
    44 Ac-IWAAQELR$IGD$FNAYYARR-NH2
    45 Ac-AWAAQELR$IGD$FNAYYARR-NH2
    46 Ac-IWIAibQELR$IGD$FNAYYARR-NH2
    47 Ac-IWIAQELR$IGD$FNAAYARR-NH2
    48 Ac-IWIAQELR$IGD$FNAYAARR-NH2
    49 Ac-IWIAQELR$IGD$FNAAAARR-NH2
    50 Ac-IWIAQELR$IGD$FNAYYAibRR-NH2
    51 Ac-IAIAQELR%IAibD%FNAYYARR-NH2
    52 Ac-IAIAQELR$IAibD$FNAYYARR-NH2
    53 Ac-DIIRNIAibRHLA$VGD$NleDRSI-NH2
    54 Ac-DIIRNIARHLA$VGD$NleDKSI-NH2
    55 Ac-DIIKNIARHLA$VGD$NleDRSI-NH2
    56 Ac-DIIRNIARHLACVGDCNleDRSI-NH2
    57 Ac-DIIRNIARHLACVAibDCNleDRSI-NH2
    58 Ac-IWIAQELR$IGD$FNA-NH2
    59 Ac-IWIAQELR$IGD$FNRSI-NH2
    60 Ac-IWIAQELR$IGD$FNRSIARR-NH2
    61 Ac-IWIAQELR$IGD$NleDRSI-NH2
    62 Ac-IWIAQELR$VGD$NleDRSI-NH2
    63 Ac-IWIAQEAR$IGA$FNAYYARR-NH2
    64 Ac-WIAQELR$IGD$FNAYYARR-NH2
    65 Ac-IAQELR$IGD$FNAYYARR-NH2
    66 Ac-AQELR$IGD$FNAYYARR-NH2
    67 Ac-QELR$IGD$FNAYYARR-NH2
    68 Ac-ELR$IGD$FNAYYARR-NH2
    69 Ac-IWIAQELR$IGD$FNAYYAR-NH2
    70 Ac-IWIAQELR$IGD$FNAYYA-NH2
    71 Ac-IWIAQELR$IGD$FNAYY-NH2
    72 Ac-IWIAQELR$IGD$FNAY-NH2
    73 Ac-IAIAQELR$IGD$FNAYYARR-NH2
    74 Ac-IWIAAELR$IGD$FNAYYARR-NH2
    75 Ac-IWIAQALR$IGD$FNAYYARR-NH2
    76 Ac-IWIAQEAR$IGD$FNAYYARR-NH2
    77 Ac-IWIAQELA$IGD$FNAYYARR-NH2
    78 Ac-IWIAQELR$AGD$FNAYYARR-NH2
    79 Ac-IWIAQELR$IAD$FNAYYARR-NH2
    80 Ac-IWIAQELR$IGA$FNAYYARR-NH2
    81 Ac-IWIAQELR$IGD$FNAYYAAR-NH2
    82 Ac-IWIAQELR$IGD$FNAYYARA-NH2
    83 Pr-RNIARHLA$VGD$FNAYYARR-NH2
    84 Pr-RNIARHLAib$VGD$FNAYYARR-NH2
    85 Pr-RNIAibRHLAib$VGD$FNAYYARR-NH2
    86 Pr-RNChgARHLA$VAibD$FNAYYARR-NH2
    87 Pr-RNChaARHLA$VAibD$FNAYYARR-NH2
    88 FITC-BaIWIAQELRRIGDEFNAYYARR-NH2
    89 Biotin-AhxIWIAQELRRIGDEFNAYYARR-NH2
    90 KLH-CBaIWIAQELRRIGDEFNAYYARR-NH2
    91 OVA-CBaIWIAQELRRIGDEFNAYYARR-NH2
    92 FITC-BaIWIAQELR$IGD$FNAYYARR-NH2
    93 Biotin-AhxIWIAQELR$IGD$FNAYYARR-NH2
    94 KLH-CBaIWIAQELR$IGD$FNAYYARR-NH2
    95 OVA-CBaIWIAQELR$IGD$FNAYYARR-NH2
    96 FITC-BaIWIAQELR$IED$FNAYYARR-NH2
    97 Biotin-AhxIWIAQELR$IED$FNAYYARR-NH2
    98 FITC-BaIWIAQELR$/IGD$/FNAYYARR-NH2
    99 Ac-BaIWIAQELR$IGD$FNAYYAR-NH2
    100 Ac-IWIAQELR%IGD%FNAYYARR-NH2
    101 H-CBaIWIAQELR$IGD$FNAYYARR-NH2
    102 Ac-IWIAQALR$IGD$FAAYYARR-NH2
    103 Ac-IWIAQALR$IAibD$FNAYYARR-NH2
    104 Ac-IWIAQ$LRR$GDEFNAYYARR-NH2
    105 Ac-IWIAQ$LRR$GDAFNAYYARR-NH2
    106 Ac-IWIAQ$LRA$GDAFNAYYARR-NH2
    107 Ac-IWI$QEL$RIGDEFNAYYARR-NH2
    108 Ac-IWI$QAL$RIGDEFNAYYARR-NH2
    109 Ac-IWI$QEL$RIGDAFNAYYARR-NH2
    110 Ac-IWI$QAL$RIGDAFNAYYARR-NH2
    111 Ac-IWIAQALR$IGD$ANAYYARR-NH2
    112 Ac-RWIAQALR$IGD$FNAYYARR-NH2
    113 Ac-RNIAQELR$IGD$FNAYYARR-NH2
    114 Ac-RNIAQALR$IGD$FNAYYARR-NH2
    115 Ac-RRIAQALR$IGD$FNAYYARR-NH2
    116 Ac-RNIAQALR$IGD$ANAYYARR-NH2
    117 Ac-RRIAQALR$IGD$ANAYYARR-NH2
    118 H-IWIAQELR$IGD$FNAYYARR-NH2
    119 Ac-IWIAQEChaR$IGD$FNAYYARR-NH2
    120 Ac-IWChgAQELR$IGD$FNAYYARR-NH2
    121 Ac-IRIAQALR$IGD$FNAYYARR-NH2
    122 Ac-IWIAQAibLR$IGD$FNAYYARR-NH2
    123 Ac-IWIAibQALR$IGD$FNAYYARR-NH2
    124 Ac-IWIAQALR$IGD$FNAibYYARR-NH2
    125 Ac-IWIAQALR$IGD$FNAYYAibRR-NH2
    126 Ac-IWIAQALR$IGD$FNASIARR-NH2
    127 Ac-IWIAQALR$IGD$FNAFYARR-NH2
    128 Ac-IWIAQALR$IGD$FNAFFARR-NH2
    129 Ac-IWIAQALR$IGD$FNARRA-NH2
    130 Ac-IWIAQALR$IGD$FNAYKA-NH2
    131 Ac-IWIAQALR$IGD$FNAYK-NH2
    132 Ac-IWIAQALR$IGD$FNASKARR-NH2
    133 Ac-RRIAQQLR$IGD$ANAYYARR-NH2
    134 Ac-WIAQQLR$IGD$FNAYYARR-NH2
    135 Pr-WIAQQLR$IGD$FNAYYARR-NH2
    136 Ac-RWIAQQLR$IGN$FNAYYARR-NH2
    137 H-NMeRWIAQQLR$IGD$FNAYYARR-NH2
    138 Ac-NMeRWIAQQLR$IGD$FNAYYARR-NH2
    139 Ac-IWIAQHLR$IGD$FNAYYARR-NH2
    140 Ac-RWIAQHLR$IGD$FNAYYARR-NH2
    141 Ac-RWIAQELR$ChgGD$FNAYYARR-NH2
    142 Ac-RWIAQELR$ChaGD$FNAYYARR-NH2
    143 Ac-IWIAQQLR$IGD$FNAFFARR-NH2
    144 Ac-RWIAQQLR$IGD$FNAFYARR-NH2
    145 Ac-RWIAQQLR$IGD$FNAYFARR-NH2
    146 Ac-RWIAQQLR$IGD$FNATIARR-NH2
    147 Ac-RWIAQQLR$IGD$FNAYYAR-NH2
    148 Ac-RWIAQQLR$IGD$FNAYYA-NH2
    149 Ac-RWIAQQLR$IGD$FNAYY-NH2
    150 Ac-IWIAQ$LRR$GDQFNAYYARR-NH2
    151 Ac-IWIAQ$LRQ$GDQFNAYYARR-NH2
    152 Ac-RWIAQ$LRA$GDQFNAYYARR-NH2
    153 H-CBaIWIAQELRRIGDEFNAYYARR-NH2
    154 H-CBaIWIAQELRRIGDEFNAYYARR-NH2
    155 H-CBaIWIAQELR$IGD$FNAYYARR-NH2
    156 H-CBaIWIAQELR$IGD$FNAYYARR-NH2
    157 Ac-RRIAQQLR$IGD$FNAYYAR-NH2
    158 Ac-RRIAQALR$IGD$FNAYYAR-NH2
    159 Ac-RRIAQQLR$IGD$FNAYYA-NH2
    160 Ac-IWIAQQLR$IGD$FNARRA-NH2
    161 Ac-RWIAQQLR$IGD$FNARRA-NH2
    162 Ac-RRIAQQLR$IGD$FNARRA-NH2
    163 Ac-RRIAQQLR$IGD$FNARRA-NH2
    164 Ac-RWIAQQLR$IGD$FNARYA-NH2
    165 Ac-RWIAQQLR$IGD$FNAYRA-NH2
    166 Ac-RWIAQQLR$IGD$FNARYA-NH2
    167 Ac-RWIAQQLR$IGD$FNAYRA-NH2
    168 Ac-RRIAQQLR$IGD$FNASIA-NH2
    169 Ac-RRIAQALR$IGD$FNASIA-NH2
    170 Ac-RRIAQALR$IGD$FNASI-NH2
    171 Ac-RWIAQQLR$IGD$FNARR-NH2
    172 Ac-RWIAQQLR$IGD$FNAR-NH2
    173 Ac-RRIAQQLR$IGD$FNAR-NH2
    174 Ac-RRIAQQLR$IGD$FNAib-NH2
    175 Ac-RRIAQQLR$IGD$FNA-NH2
    176 Ac-RRIAQQLR$IGD$FNARRA-NH2
    177 Ac-RRIAQQLR$IGD$FNAYYA-NH2
    178 Ac-RRIAQQLR$IGD$FNAYYAib-NH2
    179 Ac-RWIAQQLR$IGD$FNAibRRA-NH2
    180 Ac-RWIAibQQLR$IGD$FNARRA-NH2
    181 Ac-RWAibAQQLR$IGD$FNARRA-NH2
    182 Ac-RAibIAQQLR$IGD$FNARRA-NH2
    183 Ac-RFIAQQLR$IGD$FNAYYARR-NH2
    184 Ac-RFIAQQLR$IGD$FNARRA-NH2
    185 Ac-RAibIAQQLR$IGD$FNAYYARR-NH2
    186 Ac-RWIAQQhFR$IGD$FNAYYARR-NH2
    187 Ac-RWIAQQ3cfR$IGD$FNAYYARR-NH2
    188 Ac-RWIAQQ1NalR$IGD$FNAYYARR-NH2
    189 Ac-RWIAQQ2NalR$IGD$FNAYYARR-NH2
    190 Ac-IWIAQEAR$IGD$ANAYYARR-NH2
    191 Ac-RRI$QAL$RIGDAibFNARRA-NH2
    192 Ac-RRIAQ$LRR$GDAibFNARRA-NH2
    193 iBu-RWIAQQLR$IGD$FNAYYARR-NH2
    194 Dec-RWIAQQLR$IGD$FNAYYARR-NH2
    195 Bz-RWIAQQLR$IGD$FNAYYARR-NH2
    196 H-RWIAQQLR$IGD$FNAYYARR-NH2
    197 Chx-RWIAQQLR$IGD$FNAYYARR-NH2
    198 Vrl-RWIAQQLR$IGD$FNAYYARR-NH2
    199 PhAc-RWIAQQLR$IGD$FNAYYARR-NH2
    200 MeImC-RWIAQQLR$IGD$FNAYYARR-NH2
    201 Pr-RWIAQQLR$IGD$FNAYYARR-NH2
    202 Ac-RWIAQALR$IGD$FNASIARR-NH2
    203 Ac-RWIAQQLR$IGD$FNASIARR-NH2
    204 Ac-RWIAQALR$IGD$FNAFYARR-NH2
    205 Ac-RRIAQALR$IGD$FNAFYA-NH2
    206 Ac-RRIAQQLR$IGD$FNAFYA-NH2
    207 Ac-RWIAQALR$IGD$FNAYYARR-NHPr
    208 Ac-RWIAQALR$IGD$FNAYYARR-NHiBu
    209 Ac-RWIAQALR$IGD$FNAYYARR-NHChx
    210 Ac-RWIAQALR$IGD$FNAYYARR-NHBn
    211 Ac-RWIAQALR$IGD$FNAYYARR-NHMeChx
    212 Ac-RWIAQALR$IGD$FNAYYARR-NHEtPh
    213 Ac-RWIAQALR$IGD$FNAYYARR-NHsBu
    214 Ac-RWIAQALR$IGD$FNARR-NHPr
    215 Ac-RWIAQALR$IGD$FNARR-NHiBu
    216 Ac-RWIAQALR$IGD$FNARR-NHChx
    217 Ac-RWIAQALR$IGD$FNARR-NHBn
    218 Ac-RWIAQALR$IGD$FNARR-NHMeChx
    219 Ac-RWIAQALR$IGD$FNARR-NHEtPh
    220 Ac-RWIAQALR$IGD$FNARR-NHsBu
    221 Ac-RWIAQALR$IGA$FNAYYARR-NH2
    222 Ac-RWIAQALR$IGN$FNAYYARR-NH2
    223 Ac-IWIAQALR$IGA$FNARRA-NH2
    224 Ac-IWIAQALR$IGN$FNARRA-NH2
    225 Ac-RWIAQAFR$IGD$FNAYYARR-NH2
    226 H-CAhxIWIAQELRRIGDEFNAYYARR-NH2
    227 H-CAhxIWIAQELR$IGD$FNAYYARR-NH2
    228 Pr-IPIAQALR$IGD$FNARRA-NH2
    229 Pr-PWIAQALR$IGD$FNARRA-NH2
    230 KLH-CAhxIWIAQELRRIGDEFNAYYARR-NH2
    231 OVA-CAhxIWIAQELRRIGDEFNAYYARR-NH2
    232 KLH-CAhxIWIAQELR$IGD$FNAYYARR-NH2
    233 OVA-CAhxIWIAQELR$IGD$FNAYYARR-NH2
    234 Ac-IWIAEELA$IGD$FDAYYA-NH2
    235 FITC-BaIWIAEELA$IGD$FDAYYA-NH2
    236 Ac-IWIAEELA$IGD$FDAYYAAA-NH2
    237 FITC-BaIWIAEELA$IGD$FDAYYAAA-NH2
    238 Ac-RWIAQALR$IGD$FNAYKARR-NH2
    239 Ac-RWIAQQLR$IGD$FNAYKARR-NH2
    240 Ac-RWIAQALR$IGD$FNAYK-NH2
    241 Ac-RWIAQALR$IGD$FNAFK-NH2
    242 Ac-RWIAQALR$IGD$hFNAYYARR-NH2
    243 Ac-RWIAQALR$IGD$1NalNAYYARR-NH2
    244 Ac-RWIAQALR$IGD$2NalNAYYARR-NH2
    245 Ac-R2NalIAQALR$IGD$FNAYYARR-NH2
    246 Ac-RhFIAQALR$IGD$FNAYYARR-NH2
    247 Ac-RWIAQALR$IGNle$FNAYYARR-NH2
    248 Ac-RWNleAQALR$IGD$FNAYYARR-NH2
    249 Ac-RWIAQNleLR$IGD$FNAYYARR-NH2
    250 Ac-RWIAQQLR$IGD$FNAYK-NH2
    251 H-CAhxIWIAQELR$IED$FNAYYARR-NH2
    252 Ac-IWIAQALR$IGD$FNAYOrnARR-NH2
    253 Ac-IWIAQALR$IGD$FNAYOrn-NH2
    254 Ac-IWIAQALR$IGD$FNAYR-NH2
    255 Ac-IWIAQALR$IGD$FNAYRA-NH2
    256 Ac-IWIAQALR$IFD$FNARRA-NH2
    257 Ac-RWIAQALR$IGD$FNARRA-NH2
    258 Ac-IWIAQELR$ChgGD$FNAYYARR-NH2
    259 Ac-IWIAQQLR$IGD$FNAYY-NH2
    260 Ac-IWIAQ$LRA$GDQFNAYYARR-NH2
    261 Ac-IWIAQALR$IGD$FAibAYK-NH2
    262 Ac-IWIAQALR$IGD$FAibAYYARR-NH2
    263 Ac-IWIAQALR$IGN$FNAFYARR-NH2
    264 Ac-RWIAQALR$IGN$FNAFYARR-NH2
    265 Ac-IWIAQAibLR$IGN$FNAFYARR-NH2
    266 Ac-IWIAQALR$IGN$FNAibFYARR-NH2
    267 Ac-IWIAQAibLR$IGN$FNAibFYARR-NH2
    268 Pr-RNChgARHLA$VAibD$FNAFYARR-NH2
    269 Ac-IWIAQAAR$IGD$FNAYYARR-NH2
    270 Ac-IWIAQAAR$IGD$ANAYYARR-NH2
    271 Ac-IWIAQAAR$IGA$ANAYYARR-NH2
    272 Ac-IWIAQAAR$IEA$ANAYYARR-NH2
    273 Ac-IWIAQALR$DIG$FNAYYARR-NH2
    274 Ac-IWIAQAAR$DIG$ANAYYARR-NH2
    275 Ac-IWIAQALR$IED$FNAYYARR-NH2
    276 Ac-IWIAQALD$IGR$FNAYYARR-NH2
    277 Ac-IWIAQAAD$IGR$ANAYYARR-NH2
    278 Ac-IWIAQAAD$IER$ANAYYARR-NH2
    279 Ac-IWIAQAibLR$IGD$FNAibYYARR-NH2
    280 Ac-IWIAQQLR$IGD$FNAYRA-NH2
    281 Ac-IWI$QAL$RIGDAibFNAYYARR-NH2
    282 t-Bu-U-IWIAQELR$IGD$FNAYYARR-NH2
    283 non-U-IWIAQELR$IGD$FNAYYARR-NH2
    284 Et-U-IWIAQELR$IGD$FNAYYARR-NH2
    285 Chx-U-IWIAQELR$IGD$FNAYYARR-NH2
    286 iPr-U-IWIAQELR$IGD$FNAYYARR-NH2
    287 Ph-U-IWIAQELR$IGD$FNAYYARR-NH2
    288 NH2CO-IWIAQELR$IGD$FNAYYARR-NH2
    289 Ac-IWIAQAAR$IGR$ANAYYARR-NH2
    290 Ac-IWIAQAAD$IGD$ANAYYARR-NH2
    291 Ac-IWIAQALD$IGD$FNAYYARR-NH2
    292 Ac-IWIAQALR$IGR$FNAYYARR-NH2
    293 Ac-IWIAQAAR$IGD$ANAYYARR-NH2
    294 Ac-IWIAQAAD$IGR$ANAYYARR-NH2
    295 Ac-IWIAQALD$IGR$FNAYYARR-NH2
    296 Ac-IWIAQALRRIGDEFNAYYARR-NH2
    297 Ac-IWIAQALR$IGN$FNAYYARR-NH2
    298 Ac-IWIAQALR$IGNle$FNAYYARR-NH2
    299 Ac-IWIAQALR$IGA$FNAFYARR-NH2
    300 Ac-IWIAQALR$IGN$FNAFYARR-NH2
    301 Ac-IWIAQALR$IGNle$FNAFYARR-NH2
    302 Ac-RWIAQAFR$IGD$FNAFYARR-NH2
    303 Ac-IWIAQAFR$IGD$FNAFYARR-NH2
    304 Ac-IWIAQAFR$IGN$FNAYYARR-NH2
    305 Ac-IWIAQAFR$IGN$FNAFYARR-NH2
    306 Ac-IWIAQALR$IG$EFNAYYARR-NH2
    307 Ac-IWIAQALRR$GD$FNAYYARR-NH2
    308 Ac-IWIAQALRAibIGAmDEFNAYYARR-NH2
    309 Ac-IWIAQELR#IGD#FNAYYARR-NH2
    310 Ac-IWIAQELR$IGD#FNAYYARR-NH2
    311 Ac-IWIAQELR#IGD$FNAYYARR-NH2
    312 Ac-IWIAQALR$IGD$FNAYYARR-NHiBu
    313 Chx-IWIAQALR$IGD$FNAYYARR-NHiBu
    314 Chx-U-IWIAQALR$IGD$FNAYYARR-NHiBu
    315 FITC-AhxIWIAQALR$IGD$FNAibYYARR-NH2
    316 FITC-AhxIWIAQALR$IGD$FNAFYARR-NH2
    317 FITC-AhxRWIAQALR$IGD$FNAFYARR-NH2
    318 FITC-AhxRWIAQALR$IGN$FNAYYARR-NH2
    319 FITC-AhxRWIAQALR$IGNle$FNAYYARR-NH2
    320 FITC-AhxIWIAQALR$IGN$FNAYYARR-NH2
    321 FITC-AhxIWIAQALR$IGNle$FNAYYARR-NH2
    322 Ac-IWIAQELRbKIGDbEFNAYYARR-NH2
    323 Ac-IWIAQELRbEIGDbKFNAYYARR-NH2
    324 Ac-IWIAQELRbKIAibDbEFNAYYARR-NH2
    325 Ac-IWIAQELRbEIAibDbKFNAYYARR-NH2
    326 Ac-IWIAQELR#sIGD#sFNAYYARR-NH2
    327 Ac-IWIAQELR#sIAibD#sFNAYYARR-NH2
    328 Ac-IWIAQELR$sIGD$sFNAYYARR-NH2
    329 Ac-IAmWIAQELR$IGD$FNAYYARR-NH2
    330 Ac-IWIAQELR$r5IGD$r5FNAYYARR-NH2
    331 Ac-IWIA$r5ELR$r5IGDEFNAYYARR-NH2
    332 Ac-IWIA$ELR$IGDEFNAYYARR-NH2
    333 Ac-IWIAQ$r8LRRIGD$FNAYYARR-NH2
    334 Ac-I$r8IAQELR$IGDEFNAYYARR-NH2
    335 HepIAQ$LRRIGDEFNAYYARR-NH2
    336 HepIAQ$LR$IGD$FNAYYARR-NH2
    337 HepWIA$ELRRIGDEFNAYYARR-NH2
    338 HepWIA$ELR$IGD$FNAYYARR-NH2
    339 Ac-I$IAQ$LRRIGDEFNAYYARR-NH2
    340 Ac-I$IAQ$LR$IGD$FNAYYARR-NH2
    341 Ac-IWIAQALE$IGD$FNAYYARR-NH2
    342 Ac-IWIAQALR$IGR$ANAYYARR-NH2
    343 Ac-IWIAQAAESIGR$ANAYYARR-NH2
    344 Ac-IWIAQAAE$IGE$ANAYYARR-NH2
    345 Ac-RWIAQALR$IGR$FNAFYARR-NH2
    346 Ac-RWIAQALE$IGD$FNAFYARR-NH2
    347 Ac-RWIAQAAR$IGR$ANAFYARR-NH2
    348 Ac-RWIAQAAE$IGD$ANAFYARR-NH2
    349 Ac-RWIAQAAD$IGD$ANAFYARR-NH2
    350 Ac-RWIAQAAESIGR$ANAFYARR-NH2
    351 Ac-RWIAQAAR$IGD$ANAFYARR-NH2
    352 Ac-RWIAQALR$DIG$FNAFYARR-NH2
    353 Ac-RWIAQALR$IGN$ANAYYARR-NH2
    354 Ac-RWIAQAAR$IGN$ANAYYARR-NH2
    355 Ac-RWIAQAAESIGN$ANAYYARR-NH2
    356 Ac-RWIAQAAESIGN$ANAYYARR-NH2
    357 Ac-RWIAQAAE$NIG$ANAYYARR-NH2
    358 Ac-RWIAQAAR$NIG$ANAYYARR-NH2
    359 Ac-IWIAQALR$IGN$ANAYYARR-NH2
    360 Ac-IWIAQAAR$IGN$ANAYYARR-NH2
    361 Ac-IWIAQAAE$IGN$ANAYYARR-NH2
    362 Ac-IWIAQAAE$IGN$ANAYYARR-NH2
    363 Ac-IWIAQAAE$NIG$ANAYYARR-NH2
    364 Ac-IWIAQAAR$NIG$ANAYYARR-NH2
    365 Ac-RWIAQALRRIGNEFNAYYARR-NH2
    366 Ac-IWIAQALRRIGNEFNAYYARR-NH2
    367 Ac-RWIAQALR$IEN$FNAYYARR-NH2
    368 Ac-RWIAQALR$IED$FNAFYARR-NH2
    369 Ac-IWIAQALR$IED$FNAFYARR-NH2
    370 Ac-IWIAQELR$IGR$FNAYYARR-NH2
    371 Ac-IWIAQELRbKIGDbDFNAYYARR-NH2
    372 Ac-IWIAQELRbDIGDbKFNAYYARR-NH2
    373 FITC-AhxRWIAQALRRIGDEFNAFYARR-NH2
    374 FITC-AhxRWIAQALRRIGNEFNAYYARR-NH2
    375 FITC-AhxIWIAQALRRIGNEFNAYYARR-NH2
    376 FITC-AhxIWIAQELRRIGDEFNAYYARR-NH2
    377 Ac-RWIAQALR$/IGN$/FNAYYARR-NH2
    378 Ac-IWIAQELR#cIGR#cFNAYYARR-NH2
    379 Ac-IWIAQELRCIGRCFNAYYARR-NH2
    380 FITC-AhxIWIAQAAR$DIG$ANAYYARR-NH2
    381 Ac-IWIAQQLR%IGD%FNAYYARR-NH2
    382 FITC-AhxRNIARHLA$VGD$NleAibRSI-NH2
    383 FITC-AhxIWIAQALR$IGD$FNAYYARR-NH2
    384 Ac-IWIAQELR#c4IGD#c4FNAYYARR-NH2
    385 Ac-IWIAQELR$c4IGD$c4FNAYYARR-NH2
    386 Ac-IWIAQELR#cIGD#cFNAYYARR-NH2
    387 Ac-IWIAQELR$cIGD$cFNAYYARR-NH2
    388 FITC-AhxIWIAQELR#IGD#FNAYYARR-NH2
    389 5-FAM-AhxIWIAQELR#c4IGD#c4FNAYYARR-NH2
    390 5-FAM-AhxIWIAQELR$c4IGD$c4INAYYARR-NH2
    391 FITC-AhxIWIAQELR#cIGD#cFNAYYARR-NH2
    392 FITC-AhxIWIAQELR#sIGD#sFNAYYARR-NH2
    393 FITC-AhxIWIAQELR$cIGD$cFNAYYARR-NH2
    394 Ac-IWIAQELR$4n4IGD$4a5FNAYYARR-NH2
    395 Ac-IWIAQELR$4a5IGD$4n4FNAYYARR-NH2
    396 Ac-IWIAQELR$5n3IGD$5a5FNAYYARR-NH2
    397 Ac-IWIAQELR$5a5IGD$5n3FNAYYARR-NH2
    398 Ac-IWIAQELR#5n3IGD#5a5FNAYYARR-NH2
    399 Ac-IWIAQELR#5a5IGD#5n3FNAYYARR-NH2
    400 FITC-AhxIWIAQELR$4n4IGD$4a5FNAYYARR-NH2
    401 FITC-AhxIWIAQELR$4a5IGD$4n4FNAYYARR-NH2
    402 FITC-AhxIWIAQELR$5n3IGD$5a5FNAYYARR-NH2
    403 FITC-AhxIWIAQELR$5a5IGD$5n3FNAYYARR-NH2
    404 FITC-AhxIWIAQELR#5n3IGD#5a5FNAYYARR-NH2
    405 FITC-AhxIWIAQELR#5a5IGD#5n3FNAYYARR-NH2
    406 Ac-IWIAQALR$IEN$FNAYYARR-NH2
    407 Ac-RWIAQALR$/IGD$/FNAFYARR-NH2
    408 Ac-IWIAQALR$/IGN$/FNAYYARR-NH2
    409 Ac-IWIAQALR$/IGD$/FNAYYARR-NH2
    410 Ac-RWIChaQALR$IGD$FNAFYARR-NH2
    411 Ac-RWIAQALR$IChaD$FNAFYARR-NH2
    412 Ac-RWIAQALR$IGD$FNAFYARR-NH2
    413 Ac-RWIAQALR$IGD$FNChaFYARR-NH2
    414 Ac-RWIAQALR$IGD$FNAFYChaRR-NH2
    415 Ac-IWIChaQALR$IGN$FNAYYARR-NH2
    416 Ac-IWIAQALR$IChaN$FNAYYARR-NH2
    417 Ac-IWIAQALR$IGN$FNAYYARR-NH2
    418 Ac-IWIAQALR$IGN$FNChaYYARR-NH2
    419 Ac-IWIAQALR$IGN$FNAYYChaRR-NH2
    420 HepIAQ$LR$IGD$FNAFYARR-NH2
    421 Ac-YGRKKRRQRRRIWIAQELRRIGDEFNAYYARR-NH2
    422 FITC-AhxYGRKKRRQRRRIWIAQELRRIGDEFNAYYARR-
    NH2
    423 Ac-RWIAQALR$IGD$FNAFYAHR-NH2
    424 Ac-RWIAQALR$IGD$FNAFYARH-NH2
    425 Ac-RWIAQSLR$IGD$FNAFYARR-NH2
    426 Ac-IWIAQELR#4n4IGD#4a5FNAYYARR-NH2
    427 FITC-AhxRWIAQALR$/IGN$/FNAYYARR-NH2
    428 FITC-AhxRWIAQALR$/IGD$/FNAFYARR-NH2
    429 FITC-AhxIWIAQALR$/IGN$/FNAYYARR-NH2
    430 FITC-AhxIWIAQALR$/IGD$/FNAYYARR-NH2
    431 FITC-AhxIWIAQELR$sIGD$sFNAYYARR-NH2
    432 Biotin-AhxRWIAQALRRIGDEFNAFYARR-NH2
    433 Biotin-AhxRWIAQALRRIGNEFNAYYARR-NH2
    434 Biotin-AhxIWIAQALRRIGNEFNAYYARR-NH2
    435 Biotin-AhxIWIAQALRRIGDEFNAYYARR-NH2
    436 FITC-AhxIWIAQALRRIGDEFNAYYARR-NH2
    437 Biotin-AhxRWIAQALR$IGD$FNAFYARR-NH2
    438 Biotin-AhxRWIAQALR$IGN$FNAYYARR-NH2
    439 Biotin-AhxIWIAQALR$IGN$FNAYYARR-NH2
    440 Biotin-AhxIWIAQALR$IGD$FNAYYARR-NH2
    441 Biotin-AhxIWIAQALR$IGD$FNAFYARR-NH2
    442 5-FAM-AhxIWIAQELR$IGD$FNAYYARR-NH2
    443 DuIAQDprLRRIGDEFNAYYARR-NH2
    444 DuIAQDprLRRIGDQFNAYYARR-NH2
    445 DuWIADprALRRIGDEFNAYYARR-NH2
    446 DuWIADprALRRIGDQFNAYYARR-NH2
    447 5-FAM-AhxIWIAQALRRIGDEFNAYYARR-NH2
    448 5-FAM-AhxIWIAQALR$IGD$FNAYYARR-NH2
    449 5-FAM-AhxIWIAQAARRDIGEANAYYARR-NH2
    450 5-FAM-AhxRWIAQALR$IGD$FNAFYARR-NH2
    451 5-FAM-AhxIWIAQALRRIGDEFNAFYARR-NH2
    452 Ac-IWIAQEAmLR$IGD$FNAYYARR-NH2
    453 Ac-IWIAQELR$IGD$FNAibYYARR-NH2
    454 Ac-IWIAQELR$IGD$FNAAmfYARR-NH2
    455 Ac-IWIAQELR$IGD$FNAYAmfARR-NH2
    456 Ac-IWIAQELR$IGD$FNAAmyeYARR-NH2
    457 Ac-IWIAQELR$IGD$FNAYAmyeARR-NH2
    458 Ac-IWIAQELR$IGD$FNAYYAAmrR-NH2
    459 Ac-IWIAQELR$IGD$FNAYFARR-NH2
    460 Ac-IWIAQELR$IGD$FNAFYARR-NH2
    461 Ac-RWIAQELR$IGD$FNAFYARR-NH2
    462 Ac-RWIAQALR$IGD$FNAAmfYARR-NH2
    463 Ac-RWIAQALR$IGD$FNAFYAAmrR-NH2
    464 Ac-IWIA$r5ALRStIGD$FNAYYARR-NH2
    465 Ac-IWIA$ALRStIGDEFN$s8YYARR-NH2
    466 Ac-IWIAQALR$r5IGDStFNA$YARR-NH2
    467 5-FAM-AhxIWIAQELRbKIGDbDFNAYYARR-NH2
    468 5-FAM-AhxIWIAQELRbDIGDbKFNAYYARR-NH2
    469 5-FAM-AhxIWIAQELR#IGD#FNAYYARR-NH2
    470 5-FAM-AhxIWIAQELR#cmlIGD#cmlFNAYYARR-NH2
    471 5-FAM-AhxRWIAQALR$IGD$FNAFYAHR-NH2
    472 5-FAM-AhxRWIAQALRRIGDEFNAFYAHR-NH2
    473 5-FAM-AhxRWIAQALR$IGD$FNAFYARH-NH2
    474 5-FAM-AhxRWIAQALRRIGDEFNAFYARH-NH2
    475 Ac-RWIAQALR$IGD$FNAFYAAR-NH2
    476 Ac-RWIAQALR$IGD$FNAFYARA-NH2
    477 Ac-RWIAQAAR$DIG$ANAFYARR-NH2
    478 Ac-IWIAQAAR$DIG$ANAFYARR-NH2
    479 5-FAM-AhxIWIAQELR$IED$FNAYYARR-NH2
    480 5-FAM-AhxIWIAQELRRIEDEFNAYYARR-NH2
    481 Ac-IWIAQELRNleIGDNleFNAYYARR-NH2
    482 Ac-IWIAQELRAibIGDAibFNAYYARR-NH2
    483 5-FAM-AhxRWIAQALR$IGD$FNAFYARR-NH2
    484 5-FAM-AhxRWIAQALRRIGDEFNAFYARR-NH2
    485 H-CAhxIWIAQALR$IGD$FNAFYARR-NH2
    486 H-CAhxRWIAQALR$IGD$FNAFYARR-NH2
    487 5-FAM-AhxIWIAQALR$IGD$FNAFYARR-NH2
    488 OVA-CAhxIWIAQELR$IGD$FNAYYARR-NH2
    489 OVA-CAhxRWIAQQLR$IGD$FNAYYARR-NH2
    490 H-CAhxRWIAQAAR$IGR$ANAFYARR-NH2
    491 H-CAhxRWIAQALR$IGD$FNAYYARR-NH2
    492 H-CAhxIWIAQALRRIGDEFNAYYARR-NH2
    493 OVA-CAhxRWIAQAAR$IGD$ANAYYARR-NH2
    494 OVA-CAhxRWIAQALR$IGD$FNAYYARR-NH2
    495 OVA-CAhxIWIAQALRRIGDEFNAYYARR-NH2
    496 Ac-6xhAhxIWIAQAAR$DIG$ANAYYARR-NH2
    497 Ac-FlagAhxIWIAQAAR$DIG$ANAYYARR-NH2
    498 5-FAM-6xhAhxIWIAQAAR$DIG$ANAYYARR-NH2
    499 5-FAM-FlagAhxIWIAQAAR$DIG$ANAYYARR-NH2
    500 Ac-6xhAhxRWIAQALR$IGD$FNAFYARR-NH2
    501 Ac-FlagAhxRWIAQALR$IGD$FNAFYARR-NH2
    502 5-FAM-6xhAhxRWIAQALR$IGD$FNAFYARR-NH2
    503 5-FAM-FlagAhxRWIAQALR$IGD$FNAFYARR-NH2
    504 5-FAM-IWIAQELR$IGD$FNAYYARR-NH2
    505 5-FAM-BaIWIAQELR$IGD$FNAYYARR-NH2
    506 Ac-IWIAQELR%OcoIGD%OcoFNAYYARR-NH2
    507 Ac-AhxIWIAQELR$IGD$FNAYYARR-NH2
    508 Ac-BaIWIAQELR$IGD$FNAYYARR-NH2
    509 H-CAhxIWIAQALR$IGD$FNAYYARR-NH2
    510 5-FAM-AhxIWIAQELR$/IGD$/FNAYYARR-NH2
    511 Ac-RWIAQALRRIGDEFNAFYAHH-NH2
    512 5-FAM-AhxRWIAQALR$IGD$FNAFYAHH-NH2
    513 5-FAM-AhxIWIAQELRRIGDEFNAYYARR-NH2
    514 Ac-TatAhxIWIAQELRRIGDEFNAYYARR-NH2
    515 5-FAM-TatAhxIWIAQELRRIGDEFNAYYARR-NH2
    516 Ac-TatAhxIWIAQELR$IGD$FNAYYARR-NH2
    517 5-FAM-TatAhxIWIAQELR$IGD$FNAYYARR-NH2
    518 Ac-TatAhxRWIAQALR$IGD$FNAFYARR-NH2
    519 5-FAM-TatAhxRWIAQALR$IGD$FNAFYARR-NH2
    520 Ac-TatAhxRWIAQALRRIGDEFNAFYARR-NH2
    521 5-FAM-TatAhxRWIAQALRRIGDEFNAFYARR-NH2
    522 5-FAM-AhxRWIAQALR$/IGD$/FNAFYARR-NH2
    523 5-FAM-AhxIWIAQALR$/IGD$/FNAFYARR-NH2
    524 Ac-TatAhxIWIAQELR$IED$FNAYYARR-NH2
    525 5-FAM-TatAhxIWIAQELR$IED$FNAYYARR-NH2
    526 Ac-IWIAQELRRIEDDFNAYYARR-NH2
    527 Ac-TatAhxIWIAQELRRIEDDFNAYYARR-NH2
    528 5-FAM-TatAhxIWIAQELRRIEDDFNAYYARR-NH2
    529 Ac-IWIAQELR$/iED$/FNAYYARR-NH2
    530 5-FAM-AhxIWIAQELR$/IED$/FNAYYARR-NH2
    531 5-FAM-AhxIWIAQAAR$DIG$ANAYYARR-NH2
    532 Ac-TatAhxIWIAQAAR$DIG$ANAYYARR-NH2
    533 5-FAM-TatAhxIWIAQAAR$DIG$ANAYYARR-NH2
    534 Ac-IWIAQAARRDIGEANAYYARR-NH2
    535 Ac-TatAhxIWIAQAARRDIGEANAYYARR-NH2
    536 5-FAM-TatAhxIWIAQAARRDIGEANAYYARR-NH2
    537 Ac-IWIAQAAR$DIG$ANAYYARR-NH2
    538 5-FAM-AhxIWIAQAAR$/DIG$/ANAYYARR-NH2
    539 Ac-IWIAQELRRIEDEFNAYYARR-NH2
    540 Ac-IWIAQALR$/IGD$/FNAFYARR-NH2
    541 Ac-RWIAQALR$IGD$FNAFYAHH-NH2
    542 TatAhxIWIAQELRRIGDEFNAYYARR-NH2
    543 5-FAM-TatAhxIWIAQELRRIEDEFNAYYARR-NH2
    544 Ac-IWIAQALRRI$DEF$AYYARR-NH2
    545 Ac-IWIAQALR$r8IGDEFN$YYARR-NH2
    546 Ac-IWIAQELRRIEDEFNAYYARR-NH2
    547 Ac-IWIAQELR$/IED$/FNAYYARR-NH2
    548 Ac-IWIAQAARRDIGEANAYYARR-NH2
    549 Ac-IWIAQAAR$/DIG$/ANAYYARR-NH2
    550 Ac-IWIAQALR$/IGD$/FNAFYARR-NH2
    551 Ac-RWIAQALR$IGD$FNAFYAHH-NH2
    552 Ac-IWIAQALRRIGDEFNAFYARR-NH2
    553 5-FAM-AhxIWIAQALR$r8IGDEFN$YYARR-NH2
    554 Ac-RWIAQALR$IGD$FNA-OH
    555 Ac-RWIAQALR$IGD$FNAFYA-OH
    556 Ac-RWIAQALR$IGD$FNAF-OH
    557 Ac-RWIAQALR$IGD$FNAFYARAmr-NH2
    558 5-FAM-AhxIWIAQALR$/r8IGDEFN$/YYARR-NH2
    559 Ac-IWIAQALR$/r8IGDEFN$/YYARR-NH2
    560 OVA-CAhxIWIAQALR$IGD$FNAYYARR-NH2
    561 Ac-IWIA$ALR$IGDEFNAYYARR-NH2
    562 Ac-IWIA$/ALR$/IGDEFNAYYARR-NH2
    563 5-FAM-AhxIWIA$/r5ALRSt//IGD$/FNAYYARR-NH2
    564 5-FAM-AhxIWIA$ALRStIGDEFN$s8YYARR-NH2
    565 HepIAQ$LR$IGD$FNAYYARRTag5-FAM
    566 5-FAM-AhxIWIA$/ALRSt//IGDEFN$/s8YYARR-NH2
    567 5-FAM-AhxIWIA$r5ALRStIGD$FNAYYARR-NH2
    568 Ac-AAARAAARAAA$AAA$AAAAA-NH2
    569 Ac-AAAAAAAR$AAA$AAAAAARA-NH2
    570 Ac-AAARAAARAAAKAAAEAAAAA-NH2
    571 Ac-AAAAAAARKAAAEAAAAAARA-NH2
    572 Ac-AAARAAAAAARAAAAA-NH2
    573 Ac-IWIAQELR%OIGD%OFNAYYARR-NH2
    574 Ac-IWIA$/r5ALRSt//IGD$/FNAYYARR-NH2
    575 Ac-IWIA$/ALRSt//IGDEFN$/s8YYARR-NH2
    576 Ac-I$r8IAQALR$IGDEFNAYYARR-NH2
    577 Ac-IWIAQALRRIG$r8EFNAYY$RR-NH2
    578 Ac-I$/r8IAQALRVIGDEFNAYYARR-NH2
    579 Ac-IWIAQALRRIG$/r8EFNAYY$/RR-NH2
    580 Ac-RWIAQALR$IGD$FNAFYAibRR-NH2
    581 Ac-RWIAQALR$IGD$FNASYARR-NH2
    582 Ac-RWIAQALR$r5IGD$r5FNAFYARR-NH2
    583 Ac-IWIAQALRRIGDEF$AYY$RR-NH2
    584 Ac-RWIAEALR$IGD$FNAFYARR-NH2
    585 Ac-RWIAEALR$IGD$FDAFYARR-NH2
    586 Ac-RWIAQALR$/r5IGD$/FNAFYARR-NH2
    587 Ac-RWIAQALR$/IGD$/r5FNAFYARR-NH2
    588 Ac-IWIAQALRRIG$EFN$YYARR-NH2
    589 Ac-IWIAQALRRIGD$FNA$YARR-NH2
    590 Ac-IWIAQALRRIGDE$NAY$ARR-NH2
    591 Ac-IWIAQALRRIGD$r8FNAYYA$R-NH2
    592 %HepIAQ%LR%IGD%FNAYYARR-NH2
    593 Ac-SYDDALLMLRSIGDSL-NH2
    594 Ac-TEMMLAIMLRGIGDSL-NH2
    595 Ac-WVSEFLAIGDYVDFHY-NH2
    596 Ac-DLPVFILRNIGDSLIG-NH2
    597 Ac-VSDFDDFLTSVLDIYL-NH2
    598 5-FAM-AhxIWIA$ALR$IGDEFNAYYARR-NH2
    599 5-FAM-AhxIWIAQALRRIGDEF$AYY$RR-NH2
    600 5-FAM-AhxI$IAQ$LRRIGDEFNAYYARR-NH2
    601 5-FAM-AhxI$IAQ$LR$IGD$FNAYYARR-NH2
    602 5-FAM-AhxIWIAQALRRIG$EFN$YYARR-NH2
    603 5-FAM-AhxIWIAQALRRIGD$FNA$YARR-NH2
    604 5-FAM-AhxIWIAQALRRIGDE$NAY$ARR-NH2
    605 5-FAM-AhxI$r8IAQALR$IGDEFNAYYARR-NH2
    606 5-FAM-AhxIWIAQALRRIGD$r8FNAYYA$R-NH2
    607 5-FAM-AhxIWIAQALRRIGD$r8FNAYYA$R-NH2
    608 Ac-RWIAQALR$IGD$FDAFYARR-NH2
    609 Ac-IWIA$ALRStIGD$r5FNAYYARR-NH2
    610 Ac-IWIAQALR$IGDStFNA$r5YARR-NH2
    611 Ac-RWIA$ALRStIGD$r5FNAFYARR-NH2
    612 Ac-RWIAQALR$IGDStFNA$r5YARR-NH2
    613 Ac-TENleNleLAINleLR$IGD$L-NH2
    614 Ac-WVSEFL$IGD$VDFHY-NH2
    615 Ac-DLPVFILR$IGD$LIG-NH2
    616 Ac-VSDFDDFLT$VLD$YL-NH2
    617 Ac-RWIAQALR$trIGD$trFNAFYARR-NH2
    618 Ac-RWIAQALR$r5IGDStFNA$YARR-NH2
    619 Ac-RWIAQALR$IGD$FNAibFYARR-NH2
    620 Ac-RWIAQALR$IGD$FNAibFYAibRR-NH2
    621 Ac-PEG3RWIAQALR$IGD$FNAFYARR-NH2
    622 Ac-RWIAQALR$IGD$FNAFYAibHH-NH2
    623 Ac-RWIAQALR$IGD$FNAibFYAHH-NH2
    624 Ac-RWIAQALR$IGD$FNAibFYAibHH-NH2
    625 Ac-RWIAQALR$IGD$FNAAmfYAHH-NH2
    626 Ac-RWIAQALR$r5IGD$FNAFYARR-NH2
    627 Ac-RWIAQALR$IGD$r5FNAFYARR-NH2
    628 Ac-RWIAQALR$IGD$FNAFYARRPEG3-NH2
    629 Ac-RWIAQ$r8LRRIGDStFNAFYA$s8R-NH2
    630 Ac-R$r8IAQALRStIGDEFN$s8FYARR-NH2
    631 Ac-RWIAQALR$IGD$FNADamfYARR-NH2
    632 Ac-RWIAQALRbDIGDbKFNAFYARR-NH2
    633 Ac-RWIAQALRbKIGDbDFNAFYARR-NH2
    634 Ac-RWIAQALR$IAibD$FNAFYARR-NH2
    635 Ac-R$r5IGDStFNA$YARR-NH2
    636 Ac-RWIA$ALRStIGD$r5FNAAmfYARR-NH2
    637 Ac-RWIA$r5ALRStIGD$FNAAmfYARR-NH2
    638 Ac-IWIA$ALRStIGD$r5FNAAmfYARR-NH2
    639 Ac-IWIA$r5ALRStIGD$FNAAmfYARR-NH2
    640 Ac-RWIAQQLR$IGD$FNAFYAHH-NH2
    641 Ac-RWIAQALR#c4IGD#c4FNAFYARR-NH2
    642 Ac-RWIAQALR#c4eIGD#c4eFNAFYARR-NH2
    643 Ac-RWIAQLLR$IGD$FNAFYARR-NH2
    644 Ac-RWIAQALR$IGD$FNAhFYARR-NH2
    645 Ac-RWIAQALR$IGD$FNAAmfYAAmrR-NH2
    646 Biotin-IWIAQELR$IGD$FNAYYARR-NH2
    647 5-FAM-AhxIWIA$/ALR$/IGDEFNAYYARR-NH2
    648 5-FAM-AhxRWIAQALR$DIG$FNAFYARR-NH2
    649 Ac-RWIAQALR$IGD$FNAFYARR-OH
    650 Ac-IWIAQALR$5a5IGD$5n3FNAYYARR-NH2
    651 Ac-RWIAQQFR$IGD$FNAYYARR-NH2
    652 Ac-RWIAQQLR$IGD$FNAFYAHR-NH2
    653 Ac-RWIAQQLR$IGD$FNAFYARH-NH2
    654 Ac-RWIAQQLRRIGDEFNAFYAHH-NH2
    655 Pr-WIAQQLR$IGD$FNAFYARR-NH2
    656 Ac-WIAQQLR$IGD$FNAYYAR-NH2
    657 Ac-WIAQQLR$IGD$FNAFYAR-NH2
    658 Ac-IWIAQELD$IGD$FNAYYARR-NH2
    659 Ac-RWIAQALD$IGD$FNAFYARR-NH2
    660 Ac-IWIAQLLR$IGD$FNAFYARR-NH2
    661 Ac-RWIAQQLR$IGD$INalNAYYARR-NH2
    662 Ac-RWIAQLLR$IGD$INalNAYYARR-NH2
    663 Ac-RWIAQALR$IGD$INalNAFYARR-NH2
    664 Ac-RWIAQALR$5n3IGD$5a5FNAFYARR-NH2
    665 Ac-RWIAQALR$5a5IGD$5n3FNAFYARR-NH2
    666 Ac-RWIAQALR$/n3IGD$/a5FNAFYARR-NH2
    667 Ac-RWIAQALR$/a5IGD$/n3FNAFYARR-NH2
    668 Pr-WIAQQLR$IGD$FNASYARR-NH2
    669 Pr-NIAQQLR$IGD$FNASYARR-NH2
    670 Pr-SIAQQLR$IGD$FNASYARR-NH2
    671 Pr-WIAQQLR$IGD$FNASYAR-NH2
    672 Ac-RWIAQNLR$IGD$FNAYYARR-NH2
    673 Ac-RWIAQRLR$IGD$FNAYYARR-NH2
    674 Pr-WIAQ$LRR$GDAFNASYARR-NH2
    675 Ac-RWIAQQLR$IGD$FNAYYAHR-NH2
    676 Ac-RWIAQQLR$IGD$FNAYYARH-NH2
    677 Ac-RWIAQQLR$IGD$FNAYYAHH-NH2
    678 Pr-WIAQQLR$IGD$FNASIARR-NH2
    679 Ac-IWIAQQLR$IED$FNAYYARR-NH2
    680 FITC-BaIWIAQELR$IGD$FNAYYARR-NH2
    681 FITC-BaIWIAQELD$IGD$FNAYYARR-NH2
    682 FITC-BaRWIAQALR$IGD$FNAFYARR-NH2
    683 FITC-BaRWIAQALD$IGD$FNAFYARR-NH2
    684 HBS-IWAarAQELRRIGDEFNAYYARR-NH2
    685 FITC-BaBaRWIAQALR$IGD$FNAFYARR-NH2
    686 5-TAMRA-BaIWIAQELR$IGD$FNAYYARR-NH2
    687 5-TAMRA-BaRWIAQALR$IGD$FNAFYARR-NH2
    688 5-TAMRA-BaIWIAQELR$IED$FNAYYARR-NH2
    689 Ac-RWIAQQLR$IGD$FNASYARR-NH2
    690 Ac-RWIAQQLR$r5IGDStFNA$YARR-NH2
    691 Ac-RWIAQALR$IGD$FNAC13FYARR-NH2
    692 Ac-WIAQQLR$r5IGDStFNA$YARR-NH2
    693 Ac-RIAQELR$IGD$FNAYYAR-NH2
    694 Ac-RIAQQLR$IGD$FNAYYAR-NH2
    695 Ac-RWIA4QAL7R$IGD$FNAFYARR-NH2
    696 Ac-IWIAQELR#cIGR#cFNAYYARR-NH2
    697 Ac-IWIAQELR#cIGD#cFNAYYARR-NH2
    698 Ac-IWIAQELR#5n3IGD#5a5FNAYYARR-NH2
    699 FITC-AhxIWIAQELR#5n3IGD#5a5FNAYYARR-NH2
    700 HepIAQ$LR$IGD$FNAFYARR-NH2
    701 IAQDprLRRIGDEFNAYYARR-NH2
    702 IAQDprLRRIGDQFNAYYARR-NH2
    703 WIADprALRRIGDEFNAYYARR-NH2
    704 WIADprALRRIGDQFNAYYARR-NH2
    705 HepIAQ$LR$IGD$FNAYYARRTag5-FAM-
    706 Ac-TENleNleLAINleLR$IGD$L-NH2
    707 5-TAMRA-BaIWIAQELR$IGD$FNAYYARR-NH2
    708 Ac-RWIAQALR$IGD$FNAFYARR-NH2
    709 Ac-IWIAQELR#sIGD#sFNAYYARR-NH2
    710 Ac-IWIAQELR#sIAibD#sFNAYYARR-NH2
    711 Ac-IWIAQELR$sIGD$sFNAYYARR-NH2
    712 HepIAQ$LR$IGD$FNAYYARR-NH2
    713 Ac-RWIAQALR$IGD$VNAFYARR-NH2
    714 Pr-WIAQQLR$IGD$VNAFYARR-NH2
    715 Ac-RWIAQALR$IGD$VNASYARR-NH2
    716 Ac-RWIAQQLR$IGD$VNAFYARR-NH2
    717 Ac-RWIAQQLR$IGD$VNASYARR-NH2
    718 Ac-RWIAQALR$IGD$LNAFYARR-NH2
    719 Ac-RWIAQQLR$IGD$LNAFYARR-NH2
    720 Ac-KALETLRRVGDGV$RNH$TA-NH2
    721 Pr-WIAQQLR$IGD$VNAFYARR-NH2
    722 Pr-WIAQQLR$IGD$VNASYARR-NH2
    723 Ac-RWIAQQLR$IGD$VNAFYAHH-NH2
    724 Pr-WIAQQLR$IGD$VNAFYAR-NH2
    725 Pr-WIAQQLR$IGD$FNAFYAHH-NH2
    726 Pr-WIAQQLR$IGD$FNAFYARH-NH2
    727 Pr-WIAQQLR$IGD$FNAFYAHR-NH2
    728 Ac-RWIA4QAL7R$IGD$FNAFYARR-NH2
    729 Pr-WIAQQLR$IGD$LNAYYARR-NH2
    730 Pr-WIAQQLR$IGD$LNASYARR-NH2
    731 Pr-WIAQQLR$IGD$LNAYYARH-NH2
    732 Pr-WIAQQLR$IGD$LNAYYAHR-NH2
    733 Pr-RIAQQLR$IGD$LNAYYARH-NH2
    734 Pr-RIAQQLR$IGD$LNAYYAHR-NH2
    735 Pr-RIAQQLR$IGD$LNAYYAHH-NH2
    736 Pr-SIAQQLR$IGD$LNAYYARR-NH2
    737 Pr-AibIAQQLR$IGD$LNAYYARR-NH2
    738 Pr-YIAQQLR$IGD$LNAYYARR-NH2
    739 Pr-RIAQQLR$IGD$LNAYYAR-NH2
    740 Ac-RSIAQQLR$IGD$LNAYYARR-NH2
    741 Ac-IWIAQELR$r5IGDStFNA$YARR-NH2
    742 Pr-SIAQQLR$r5IGDStFNA$YARR-NH2
    743 Ac-RWIA$r5ALRStDIL$FNAFYARR-NH2
    744 Ac-RWIAQALR$5a5DIL$5n3FNAFYARR-NH2
    745 Ac-RWIAQQLR$IGD$FNAYYAH-NH2
    746 Ac-RWIA$r5ALRStIDL$FNAFYARR-NH2
    747 Ac-RWIAQALR$5a5ILL$5n3FNAFYARR-NH2
    748 Pr-RIAQQLR$IGD$FNAYYAHH-NH2
    749 Pr-WIAQQLR$IGD$VNAYYAHR-NH2
    750 Pr-WIAQQLR$IGD$VNAFYAHR-NH2
    751 Pr-RIAQQLR$IGD$VNAYYAHR-NH2
    752 Ac-RWIAQALR$5n3DIL$5a5FNAFYARR-NH2
    753 Ac-R$r8IAQALRStIGDLFN$s8FYARR-NH2
    754 Pr-RIAQQLR$IGD$FNAYYAH-NH2
    755 Ac-RWIAQALR$5n3ILL$5a5FNAFYARR-NH2
    756 Ac-RAIAQQLR$IGD$FNAYYAH-NH2
    757 Pr-WIAQQLR$IGD$LNAYYAHH-NH2
    758 Pr-SIAQQLR$IGD$LNAYYAHR-NH2
    759 Ac-RWIAQQLR$IGD$VNAFYAHR-NH2
    760 Ac-IWIA$QLRStIGD$r5FNAYYARR-NH2
    761 Ac-RWIA$QLRStIGD$r5FNAYYARR-NH2
    762 Ac-RWIAQQLR$IGD$FNAibFYAHH-NH2
    763 Ac-RWIAQALR$IGD$LNAibFYAHH-NH2
    764 Ac-IWIA$ALRStIGD$r5LNAYYARR-NH2
    765 Ac-IWIAQALR$IGDStFNA$r5YAHH-NH2
    766 Ac-RWIA$ALRStIGD$r5FNAYYARR-NH2
    767 Pr-WIAQQLR$IGD$FNAYYAHH-NH2
    768 Pr-SIAQQLR$IGD$FNAFYARR-NH2
    769 Ac-WIAQQLR$IGD$FNAibFYAHH-NH2
    770 Ac-RWIAQALR$IGD$VNAibFYAHH-NH2
    771 Ac-IWIAQQLR$IGD$FNAibFYAHH-NH2
    772 Ac-IWIAQALR$IGD$VNAibFYAHH-NH2
    773 Ac-IWIAQALR$IGD$LNAibFYAHH-NH2
    774 Ac-ELR$r5IGDStFNA$YARR-NH2
    775 Ac-QELR$r5IGDStFNA$YARR-NH2
    776 Ac-AQELR$r5IGDStFNA$YARR-NH2
    777 Ac-IAQELR$r5IGDStFNA$YARR-NH2
    778 Ac-RWIAQALR$r5IGDStFNA$YAHH-NH2
    779 Ac-RWIAQQLR$r5IGDStFNA$YAHH-NH2
    780 Ac-RWIAQALR$IGDStFNA$r5YAHH-NH2
    781 Ac-RWIAQQLR$IGDStFNA$r5YAHH-NH2
    782 Ac-IWIAQQFR$IGD$FNAYYARR-NH2
    783 Ac-RWIAQQFR$IGD$FNAFYAHH-NH2
    784 Ac-IWIAQALR$IGD$FNAibFYAHH-NH2
    785 Ac-RWIAQQLR$IGD$FNAibYYAHH-NH2
    786 Ac-IWIAQALR$IGD$FNAibYYAHH-NH2
    787 Ac-RWIAQALR$IGD$FNAibYYAHH-NH2
    788 Ac-RWIAQALR$IGD$LNAibYYAHH-NH2
    789 Ac-RIAQQLR$IGD$FNAibFYAHH-NH2
    790 Pr-WIAQQLR$IGD$FNAibYYAHH-NH2
    791 Pr-RIAQQLR$IGD$FNAibYYAHH-NH2
    792 Pr-NIAQQLR$IGD$FNAibFYAHH-NH2
    793 Pr-SIAQQLR$IGD$FNAibFYAHH-NH2
    794 Pr-NIAQQLR$IGD$FNAibYYARR-NH2
    795 Pr-SIAQQLR$IGD$FNAibYYARR-NH2
    796 Ac-IWIA$r5QLRStIGD$FNAYYARR-NH2
    797 Ac-IWIA$ALDStIGD$r5FNAYYARR-NH2
    798 Ac-RWIAQALD$IGD$FNAibFYAHH-NH2
    799 Ac-RWIAQQLR$IGD$LNAibFYAHH-NH2
    800 Ac-IWIAQQLR$IGD$LNAibFYAHH-NH2
    801 Ac-RAIAQQLR$IGD$LNAibFYAHH-NH2
    802 Ac-IRIAQQLR$IGD$LNAibFYAHH-NH2
    803 Ac-RAIAQQLR$IGD$FNAibFYAHH-NH2
    804 Ac-IRIAQQLR$IGD$FNAibFYAHH-NH2
    805 Ac-RWIAQALR$IGA$FNAibFYAHH-NH2
    806 Ac-RWIAQQLR$IGA$FNAFYAHH-NH2
    807 Pr-RIAQQLR$IGD$FNAibFYAHH-NH2
    808 Pr-WIAQQLR$IGD$FNAibFYAHH-NH2
    809 Ac-RWIAQALR$IGD$INAibFYAHH-NH2
    810 Ac-RWIAQALR$IGD$ChgNAibFYAHH-NH2
    811 Ac-IWIAQQLR$IGD$VNAibFYAHH-NH2
    812 Ac-IWIAQQLR$IGD$INAibFYAHH-NH2
    813 Ac-RWIAQQLR$IGD$VNAibFYAHH-NH2
    814 Ac-RWIAQQLR$IGD$INAibFYAHH-NH2
    815 Pr-WIAQQLR$IGD$VNAibFYAHH-NH2
    816 Ac-RWIAQAFR$IGD$VNAibFYAHH-NH2
    817 Ac-RWIAQANleR$IGD$VNAibFYAHH-NH2
    818 Ac-RWIAQAChgR$IGD$VNAibFYAHH-NH2
    819 Ac-RWIAQALR$IGD$LNAFYAibHH-NH2
    820 Ac-RWIAQALR$IGD$VNAFYAibHH-NH2
    821 Ac-RWIAQALD$IGD$FNAibYYAHH-NH2
    822 Ac-RWIA$r5ALRStIGD$FNAYYARR-NH2
    823 Ac-IWIA$r5ALDStIGD$FNAYYARR-NH2
    824 Ac-IWIA$r5ALRStIGD$FNAYYAibRR-NH2
    825 Ac-IWIA$r5ALRStIGD$VNAYYARR-NH2
    826 Ac-IRIAQALR$IGD$FNAibFYAHH-NH2
    827 Ac-INIAQALR$IGD$FNAibFYAHH-NH2
    828 Ac-IFIAQALR$IGD$FNAibFYAHH-NH2
    829 Ac-ISIAQALR$IGD$FNAibFYAHH-NH2
    830 Ac-IAibIAQALR$IGD$FNAibFYAHH-NH2
    831 Ac-IWNleAQALR$IGD$FNAibFYAHH-NH2
    832 Ac-IWIAQANleR$IGD$FNAibFYAHH-NH2
    833 Ac-IWIAibQALR$IGD$FNAibFYAHH-NH2
    834 Pr-IAQALR$IGD$FNAibFYAHH-NH2
    835 Ac-IWIAQAibLR$IGD$FNAibFYAHH-NH2
    836 Ac-IWIAQLLR$IGD$FNAibFYAHH-NH2
    837 Ac-IWIAQFLR$IGD$FNAibFYAHH-NH2
    838 Ac-IAIAAFLR$IGD$FNAibFYA-NH2
    839 Ac-IWIAQALR$IGD$FNAibYYAibHH-NH2
    840 Ac-IWIAQALR$IGD$FAAibFYAHH-NH2
    841 Ac-RWIAQALR$r8IGDAibFN$FYAHH-NH2
    842 Ac-RWIAQALR$r8IGDAFN$FYAHH-NH2
    843 Ac-RWIA$r8ALRAibIG$AFNAibYYAHH-NH2
    844 Ac-RWIA$r8ALRAIG$AFNAibYYAHH-NH2
    845 Ac-IWIAQALR$IGD$ChaNAibFYAHH-NH2
    846 5-FAM-BaIWIAQALR$IGD$FNAibFYAHH-NH2
    847 5-FAM-BaRWIAQALR$IGD$LNAibFYAHH-NH2
    848 Ac-IWILQALR$IAibD$FNAibFYAHH-NH2
    849 Ac-IAIAQFLR$IGD$FNAibFYAHH-NH2
    850 Ac-IWIAQALR$r8IGDAFN$FYAHH-NH2
    851 Ac-IWIAQALR$r8IGDAibFN$FYAHH-NH2
    852 Ac-IWIAQNLR$IGD$FNAibFYAHH-NH2
    853 Ac-IWIAQHLR$IGD$FNAibFYAHH-NH2
    854 Ac-RWIAAQLR$IGD$FNAibFYA-NH2
    855 Ac-RNIAQALR$IGD$FNAibFYAHH-NH2
    856 Ac-RFIAQALR$IGD$FNAibFYAHH-NH2
    857 Ac-RAibIAQALR$IGD$FNAibFYAHH-NH2
    858 Ac-RAIAQFLR$IGD$FNAibFYAHH-NH2
    859 Ac-RWIAQLLR$IGD$FNAibFYAHH-NH2
    860 Ac-RWIAQFLR$IGD$FNAibFYAHH-NH2
    861 Ac-RWIAQAibLR$IGD$FNAibFYAHH-NH2
    862 Ac-RWIAQALR$IGD$FNAibFYQHH-NH2
    863 Ac-RWIAQHLR$IGD$FNAibFYAHH-NH2
    864 Ac-RWIAQALR$NleGD$FNAibFYAHH-NH2
    865 Pr-IAQLLR$IGD$FNAibFYAHH-NH2
    866 Ac-RWIALALR$IGD$FNAibFYAHH-NH2
    867 Pr-WIALALR$IGD$FNAibFYAHH-NH2
    868 Ac-RAIAFALR$IGD$FNAibFYAHH-NH2
    869 Ac-WIAQALR$IGD$FNAibFYQHH-NH2
    870 Ac-CCPGCCBaIWIAQALR$IGD$FNAibFYAHH-NH2
    871 Ac-CCPGCCBaRWIAQALR$IGD$VNAibFYAHH-NH2
    872 Ac-CCPGCCBaRWIAQALR$IGD$LNAibFYAHH-NH2
    873 Ac-IWIAQALR$IGD$FNAibFYQHH-NH2
    874 Ac-RWIAQAibLR$r5IGDStFNA$YAHH-NH2
    875 Ac-IWIAQLLR$IGD$FNAibFYQHH-NH2
    876 Ac-RWIAQALR$IGD$FNRFYAHH-NH2
    877 Ac-RWIAQALR$IGD$FNAFYRHH-NH2
    878 Ac-RWIAQRLR$IGD$FNAFYAHH-NH2
    879 Ac-RWIAQALR$IGD$FNARYAHH-NH2
    880 Ac-RWIAERLR$IGD$FNAFYAHH-NH2
    881 Ac-RWIAQALR$IGD$FNQFYAHH-NH2
    882 Ac-RWIAQALR$IGD$FNAFYQHH-NH2
    883 Ac-RWIAQELR$IGD$FNARYAHH-NH2
    884 Ac-RWIAQALR$IGD$FNAQYAHH-NH2
    885 Ac-RWIAQQLR$IGD$QNQQYQHH-NH2
    886 Ac-IWIAAFLR$IGD$FNAibFYAHH-NH2
    887 Ac-IWIAQALR$IGD$FNleAibFYAHH-NH2
    888 Ac-IWIAQALR$IGD$FNleAibFYQHH-NH2
    889 Ac-IWIAQAibLR$IGD$VNAibFYAHH-NH2
    890 Ac-IWIAQLLR$IGD$VNAibFYAHH-NH2
    891 Ac-IWIAQAAR$IGD$VNAibFYAHH-NH2
    892 Ac-IAIAFALR$IGD$VNAibFYAHH-NH2
    893 Ac-IWIALALR$IGD$VNAibFYAHH-NH2
    894 Ac-IWIAQALR$IGD$VNAibFYQHH-NH2
    895 Ac-IWIAQELR$4n4IGD$4a3FNAYYARR-NH2
    896 Ac-IWIAQELR$4a3IGD$4n4FNAYYARR-NH2
    897 Ac-IWIAQELR$4n3IGD$4a5FNAYYARR-NH2
    898 Ac-IWIAQELR$4a5IGD$4n3FNAYYARR-NH2
    899 Ac-IWIAQELR$4n5IGD$4a5FNAYYARR-NH2
    900 Ac-IWIAQELR$4a5IGD$4n5FNAYYARR-NH2
    901 Ac-RCouIAQALR$IGD$LNAibFYAHH-NH2
    902 Ac-RCouIAQALR$r5IGDStFNA$YAHH-NH2
    903 Ac-ICouIAQALRRIGDELNAibFYAHH-NH2
    904 Ac-RCouIAQALRRIGDEFNAFYAHH-NH2
    905 Ac-IWIAQALR$IGD$FNAFYAibHH-NH2
    906 Ac-IWIALALR$IGD$FNAibFYAHH-NH2
    907 Ac-IAIAFALR$IGD$FNAibFYAHH-NH2
    908 Ac-RWIAQHLR$IGD$VNAibFYAHH-NH2
    909 Ac-IWIAQHLR$IGD$VNAibFYAHH-NH2
    910 Ac-RWIAQLLR$IGD$VNAibFYAHH-NH2
    911 Ac-IWIAQLLR$IGD$VNAibFYAHH-NH2
    912 Ac-IWIAQFLR$IGD$VNAibFYAHH-NH2
    913 Ac-IWIAQALR$IGD$HNAibFYAHH-NH2
    914 Ac-IWIAHLLR$IGD$VNAibFYAHH-NH2
    915 Ac-IWIAQALR$IGD$INAibFYAHH-NH2
    916 Ac-IWIAQLLR$IGD$INAibFYAHH-NH2
    917 Ac-IHIAQLLR$IGD$FNAibFYAHH-NH2
    918 Ac-IHIAQLLR$IGD$VNAibFYAHH-NH2
    919 Ac-IWIAQLLR$IGD$VNAibFYAHA-NH2
    920 Ac-IWIAQLLR$IGD$VNAibFYAAH-NH2
    921 Ac-RWIAQALD$IGR$VNAibFYAHH-NH2
    922 Ac-RWIAQALD$IGD$VNAibFYAHH-NH2
    923 Ac-IWIAQALD$IGR$VNAibFYAHH-NH2
    924 Ac-RWIAQAAR$IAibD$VNAibFYAHH-NH2
    925 Ac-IWIAQALD$IGR$FNAibFYAHH-NH2
    926 Ac-IWIAQALD$IGD$FNAibFYAHH-NH2
    927 Ac-IWIAQAAR$IAibD$FNAibFYAHH-NH2
    928 Ac-RWIAQALD$r5IGRStFNA$YAHH-NH2
    929 Ac-IWIAQALR$r5IGDStFNA$YAHH-NH2
    930 Ac-RWIAAQLR$IGD$VNAibFYAHH-NH2
    931 Ac-IWIAAQLR$IGD$FNAibFYAHH-NH2
    932 Ac-IWNleAQLLR$IGD$FNAibFYAHH-NH2
    933 Ac-RWNleAQLLR$IGD$VNAibFYAHH-NH2
    934 Ac-IWNleAibQLLR$IGD$FNAibFYAHH-NH2
    935 Ac-RWNleAibQLLR$IGD$VNAibFYAHH-NH2
    936 Ac-IRIAQLLR$IGD$FNAibFYAHH-NH2
    937 Ac-ISIAQLLR$IGD$FNAibFYAHH-NH2
    938 Ac-IRIAibQLLR$IGD$FNAibFYAHH-NH2
    939 Ac-ISIAibQLLR$IGD$FNAibFYAHH-NH2
    940 Ac-IWIA$r5ALDStIGR$FNAYYARR-NH2
    941 Pr-WIAibQLLR$IGD$FNAibFYAibHH-NH2
    942 Ac-IWIAibQLLR$IGD$VNAibFYAibHH-NH2
    943 Pr-WIAQLLR$IGD$VNAibFYAibHH-NH2
    944 Pr-WIAibQALR$IGD$FNAibFYAibHH-NH2
    945 Ac-IWIAibQALR$IGD$VNAibFYAibHH-NH2
    946 Ac-RWIAibQALR$IGD$VNAibFYAibHH-NH2
    947 Ac-IWIAQAibLR$IGD$FNAibFYAibHH-NH2
    948 Ac-IWIAQAibLR$IGD$VNAibFYAibHH-NH2
    949 Ac-RWIAQAibLR$IGD$VNAibFYAibHH-NH2
    950 Ac-IWIAQALR$IGD$VNAibFYAibHH-NH2
    951 FITC-BaIWIAQELR$IGD$F
    952 Ac-I$IAQ$LRRIGDEF$AYY$R-NH2
    953 Ac-I$IAQ$LRNleIGDNleF$AYY$R-NH2
    954 Ac-I$IAQ$LRRIGDEF$AYY$HH-NH2
    955 Ac-I$IAQ$LRNleIGDNleF$AYY$HH-NH2
    956 Ac-IWIA$ALR$IGD$FNA$YARR-NH2
    957 Ac-IWIA$ALR$IGD$FNA$YAHH-NH2
    958 Ac-IWIA$ALR$IGD$FNA$YAR-NH2
    959 Ac-IWIAQ$LRA$GDAFNAYYAR-NH2
    960 Ac-IWIAQ$LRA$GDAFNAYYAHH-NH2
    961 Ac-IWIAQALR$r8IGDAFN$YYARR-NH2
    962 Ac-IWIAQALR$r8IGDNleFN$YYARR-NH2
    963 Ac-IWIAQALR$r8IGDAibFN$YYARR-NH2
    964 Ac-IWIAQALR$r8IGDAFN$YYAHH-NH2
    965 Ac-IWIAQALR$r8IGDNleFN$YYAHH-NH2
    966 Ac-IWIAQALR$r8IGDAibFN$YYAHH-NH2
    967 Ac-IWIAQALR$r8IGDAFN$YYAR-NH2
    968 Ac-ICouIAQQLR$IGD$FNAibFYAHH-NH2
    969 Ac-ICouIAQALR$IGD$FNAibFYAHH-NH2
    970 Ac-ICouIAQELR$IGD$FNAibFYAHH-NH2
    971 Ac-ICouIAQALD$IGR$FNAibFYAHH-NH2
    972 Ac-ICouIAQALR$IGD$FNAibFYAAA-NH2
    973 Ac-ICouIAQALR$IGD$FNAibFYA-NH2
    974 Ac-RCou2IAQALR$r5IGDStFNA$YAHH-NH2
    975 Ac-RCou2IAQQLR$r5IGDStFNA$YAHH-NH2
    976 Ac-RCou2IAQALR$IGD$LNAibFYAHH-NH2
    977 Ac-ICou2IAQALR$IGD$FNAibFYAHH-NH2
    978 Ac-ICou2IAQQLR$IGD$FNAibFYAHH-NH2
    979 Ac-RWIAQALR$5rn3IGDSta5FNA$5n3YAHH-NH2
    980 Ac-RCou3IAQALR$r5IGDStFNA$YAHH-NH2
    981 Ac-RCou3IAQQLR$r5IGDStFNA$YAHH-NH2
    982 Ac-RCou3IAQALR$IGD$LNAibFYAHH-NH2
    983 Ac-ICou3IAQALR$IGD$FNAibFYAHH-NH2
    984 Ac-ICou3IAQQLR$IGD$FNAibFYAHH-NH2
    985 Ac-IWIAQALR$IGD$FNAibFYAAA-NH2
    986 Ac-IWIAQELR$IGD$FNAibFYAHH-NH2
    987 Ac-IWIAQALR$r8IGAAibFN$FYAHH-NH2
    988 Ac-IWIAQALR$IGD$FNAibFYA-NH2
    989 Ac-ICou2IA$ALRStIGD$r5FNAYYARR-NH2
    990 Ac-IDprIA$ALRStIGD$r5FNAYYARR-NH2
    991 Ac-ICou2IA$QLRStIGD$r5FNAYYARR-NH2
    992 Ac-IDprIA$QLRStIGD$r5FNAYYARR-NH2
    993 Ac-IWIAQQLR$r5IGDStFNA$YAHH-NH2
    994 Ac-ICou2IAQQLR$r5IGDStFNA$YAHH-NH2
    995 Ac-IDprIAQQLR$r5IGDStFNA$YAHH-NH2
    996 Ac-RDprIAQQLR$r5IGDStFNA$YAHH-NH2
    997 Ac-IWIAQALR$IGD$FNAibCou2YAHH-NH2
    998 Ac-IWIAQALR$IGD$FNAibCou3YAHH-NH2
    999 Ac-IWIAQALR$IGD$FNAibDprYAHH-NH2
    1000 Ac-IRIAQALR$IGD$FNAibCou2YAHH-NH2
    1001 Ac-IRIAQALR$IGD$FNAibCou3YAHH-NH2
    1002 Ac-IRIAQALR$IGD$FNAibDprYAHH-NH2
    1003 Ac-IAibIAQALR$IGD$FNAibCou2YAHH-NH2
    1004 Ac-IAibIAQALR$IGD$FNAibCou3YAHH-NH2
    1005 Ac-IAibIAQALR$IGD$FNAibDprYAHH-NH2
    1006 Ac-ICou2IAQALR$IGD$FAAibFYAHH-NH2
    1007 Ac-ICou3IAQALR$IGD$FAAibFYAHH-NH2
    1008 Ac-IDprIAQALR$IGD$FAAibFYAHH-NH2
    1009 Pam-IWIAQALR$IGD$FNAibFYAHH-NH2
    1010 Pam-ICou2IAQALR$IGD$FNAibFYAHH-NH2
    1011 Pam-ICou3IAQALR$IGD$FNAibFYAHH-NH2
    1012 Pam-IDprIAQALR$IGD$FNAibFYAHH-NH2
    1013 Ac-IWIAQALR$5n3IGD$5a5FNAibFYAHH-NH2
    1014 Ac-IWIAQALR$5a5IGD$5n3FNAibFYAHH-NH2
    1015 Ac-IWIAQALR$r8IGDAFN$YYARR-NH2
    1016 Ac-ICou2IAQELR$IGD$FNAibFYAHH-NH2
    1017 Ac-ICou2IAQALD$IGR$FNAibFYAHH-NH2
    1018 Ac-ICou2IAQALR$IGD$FNAibFYAAA-NH2
    1019 Ac-ICou2IAQALR$IGD$FNAibFYA-NH2
    1020 Ac-RCou2IAQQLR$IGD$FNAibFYAHH-NH2
    1021 Ac-RCou2IAQALR$IGD$FNAibFYAHH-NH2
    1022 Ac-RCou2IAQELR$IGD$FNAibFYAHH-NH2
    1023 Ac-RCou2IAQALD$IGR$FNAibFYAHH-NH2
    1024 Ac-RCou2IAQALR$IGD$FNAibFYAAA-NH2
    1025 Ac-RCou2IAQALR$IGD$FNAibFYA-NH2
    1026 Ac-IWIAQALR$r8IGAAibFN$FYAHH-NH2
    1027 Ac-IWIA$ALRStIGD$r5FNAYYARR-NH2
    1028 Pr-Cou2IAQALR$IGD$FNAibFYAHH-NH2
    1029 Pr-Cou2IAQALR$IGD$FNAibFYQHH-NH2
    1030 Ac-RWIAQELR$IGD$FNAibFYAHH-NH2
    1031 Ac-RWIAQALD$IGR$FNAibFYAHH-NH2
    1032 Ac-RWIAQALR$IGD$FNAibFYAAA-NH2
    1033 Ac-RWIAQALR$IGD$FNAibFYA-NH2
    1034 Ac-ICou2IAQALRRIGDEFNAYYAHH-NH2
    1035 Ac-ICou2IAQELR$IGD$FNAibFYAHH-NH2
    1036 Ac-ICou2IAQALD$IGR$FNAibFYAHH-NH2
    1037 Ac-ICou4IAQALR$r5IGDStFNA$YAHH-NH2
    1038 Ac-RCou4IAQALR$r5IGDStFNA$YAHH-NH2
    1039 Ac-ICou4IAQALR$IGD$FNAibFYAHH-NH2
    1040 Ac-ICou4IAQQLR$IGD$FNAibFYAHH-NH2
    1041 Ac-RCou4IAQALR$IGD$LNAibFYAHH-NH2
    1042 Ac-IWIAQALR$5a5IGD$5n3FNAibFYAHH-NH2
    1043 Ac-RWIAQALR$/rn3IGDSta/FNA$/n3YAHH-NH2
    1044 Ac-ICou2IA$r5ALRStIGD$FNAYYARR-NH2
    1045 Ac-ICou2IA$r5QLRStIGD$FNAYYARR-NH2
    1046 Ac-ICou4IA$r5ALRStIGD$FNAYYARR-NH2
    1047 Ac-ICou4IA$r5QLRStIGD$FNAYYARR-NH2
    1048 Ac-RCou2IAQALR$IGDStFNA$r5YAHH-NH2
    1049 Ac-RCou4IAQALR$IGDStFNA$r5YAHH-NH2
    1050 Ac-ICou7IAQQLR$r5IGDStFNA$YAHH-NH2
    1051 Ac-RCou7IAQQLR$r5IGDStFNA$YAHH-NH2
    1052 Ac-IWIAQALR$IGD$FNAibCou7YAHH-NH2
    1053 Ac-IRIAQALR$IGD$FNAibCou7YAHH-NH2
    1054 Ac-ICou2IAQQLR$r5IGDStFNA$YAHH-NH2
    1055 Ac-AAIAQALR$IGD$FNAibFYAHH-NH2
    1056 Ac-AAIAQALR$IGD$FNAibFYA-NH2
    1057 Ac-IWIAQALR$IGD$FNAibFYAAAAa-NH2
    1058 Ac-IWIAQALR$IGD$FNAibAAAAAa-NH2
    1059 Ac-IWIAQALR$IGD$FNAibFYAHHAAAAa-NH2
    1060 Ac-IWIAQALA$IGD$FNAibFYAHH-NH2
    1061 Ac-IWIAQALR$IGD$FAAibFYA-NH2
    1062 Ac-IWIALALR$IGD$FAAibFYA-NH2
    1063 Ac-IWIALALR$IGD$FNAibFYA-NH2
    1064 Ac-IWIALALR$IGD$FAAibFYAHH-NH2
    1065 Ac-IWIALALR$IGD$FAAAAA-NH2
    1066 Ac-IWIALALR$IGD$FNAAAA-NH2
    1067 Ac-IWIALLLR$IGD$FAAibFYAHH-NH2
    1068 Ac-IWIALLLR$IGD$FNAibFYAHH-NH2
    1069 Ac-IWIALLLR$IGD$FNAibFYA-NH2
    1070 Ac-IWIALLLR$IGD$FNAibFYAAAAAa-NH2
    1071 Ac-RWIALQLR$r5IGDStFNA$YAHH-NH2
    1072 Ac-RWIAQQLR$r5IGDStFNA$YA-NH2
    1073 Ac-RWIAQQLR$r5IGDStFNA$YAAa-NH2
    1074 Ac-RWIALQLR$r5IGDStFNA$YAAa-NH2
    1075 Ac-RCou2IALQLR$r5IGDStFNA$YAHH-NH2
    1076 Ac-RCou2IAQQLR$r5IGDStFNA$YA-NH2
    1077 Ac-RCou2IAQQLR$r5IGDStFNA$YAAa-NH2
    1078 Ac-RCou2IALQLR$r5IGDStFNA$YAAa-NH2
    1079 Ac-RCou2IAQALR$5rn3IGDSta5FNA$5n3YAHH-NH2
    1080 RCou4IAQALR$5rn3IGDSta5FNA$5n3YAHH-NH2
    1081 5-FAM-BaRWIAQALR$r5IGDStFNA$YAHH-NH2
    1082 Ac-RCou2IAQQLRAibIGDAibFNAAibYAHH-NH2
    1083 Ac-RWIAQQLRAibIGDAibFNAAibYAHH-NH2
    1084 Ac-RCou2IAQELR$r5IGDStFNA$YAHH-NH2
    1085 Ac-RWIAQELR$r5IGDStFNA$YAHH-NH2
    1086 Ac-ICou2IAQELR$IGD$FNAYYARR-NH2
    1087 Ac-IWIAQALR4Me$5a5IGD$5n3FNAibFYAHH-NH2
    1088 Ac-IWIAQALR4Ph$5a5IGD$5n3FNAibFYAHH-NH2
    1089 Ac-NleWIAQALR$r5IGDStFNA$YAHH-NH2
    1090 Ac-KWIAQALR$r5IGDStFNA$YAHH-NH2
    1091 Ac-RWIAQALR$r5IGDStFNA$YQHH-NH2
    1092 Ac-IWIAQALR$r5IGDStFNA$YQHH-NH2
    1093 Ac-NleCou2IAQALR$r5IGDStFNA$YAHH-NH2
    1094 Ac-KCou2IAQALR$r5IGDStFNA$YAHH-NH2
    1095 Ac-IWIAQELRRIGDEF$AYY$RR-NH2
    1096 Ac-IWIAQELRRIGDEFN$YYA$R-NH2
    1097 Ac-IWIAQEL$r8RIGDEF$AYYARR-NH2
    1098 Ac-IWIAQELR$r8IGDEFN$YYARR-NH2
    1099 Ac-IWIAQELRRIGD$r8FNAYYA$R-NH2
    1100 Ac-I$IAQStLRRIGD$s8FNAYYARR-NH2
    1101 Ac-I$r8IAQELRStIGD$r5FNAYYARR-NH2
    1102 Ac-I$r8IAQELRStIGDEFN$s8YYARR-NH2
    1103 Ac-IWI$QELStRIGDEF$s8AYYARR-NH2
    1104 Ac-IWIA$ELRStIGD$r5FNAYYARR-NH2
    1105 Ac-IWIA$r5ELRStIGD$FNAYYARR-NH2
    1106 Ac-IWIA$ELRStIGDEFN$s8YYARR-NH2
    1107 Ac-IWIAQ$r8LRRIGDStFNAYYA$s8R-NH2
    1108 Ac-IWIAQEL$r8RIGDEFStAYY$r5RR-NH2
    1109 Ac-IWIAQELR$IGDStFNAYYA$s8R-NH2
    1110 Ac-IWIAQELR$r8IGDEFNStYYA$r5R-NH2
    1111 Ac-I$IAQ$LRRIGDEF$AYY$RR-NH2
    1112 Ac-I$IAQ$LRRIGDEFN$YYA$R-NH2
    1113 Ac-IWI$QEL$RIGDEF$AYY$RR-NH2
    1114 Ac-IWI$QEL$RIGDEFN$YYA$R-NH2
    1115 Ac-IWIA$ELR$IGDEF$AYY$RR-NH2
    1116 Ac-IWIA$ELR$IGDEFN$YYA$R-NH2
    1117 Ac-I$r8IAQELR$IGDEF$AYY$RR-NH2
    1118 Ac-I$r8IAQELR$IGDEFN$YYA$R-NH2
    1119 Ac-IWIAQ$r8LRRIGD$F$AYY$RR-NH2
    1120 Ac-IWIAQ$r8LRRIGD$FN$YYA$R-NH2
    1121 Ac-I$IAQ$L$r8RIGDEF$AYYARR-NH2
    1122 Ac-I$IAQ$LR$r8IGDEFN$YYARR-NH2
    1123 Ac-I$IAQ$LRRIGD$r8FNAYYA$R-NH2
    1124 Ac-IWI$QEL$RIGD$r8FNAYYA$R-NH2
    1125 Ac-IWIA$ELR$IGD$r8FNAYYA$R-NH2
    1126 5-FAM-BaIWIAQELRRIGDEFNAYYARR-NH2
    1127 5-FAM-BaIWIAQELR$IGD$FNAYYARR-NH2
    1128 5-FAM-BaNLWAAQRYGRELR$NleSD$FVDSFKK-NH2
    1129 5-FAM-BaKALETLR$VGD$VQRNHETAF-NH2
    1130 Ac-RCou2IAQALR$IGD$FNAFYARR-NH2
    1131 Ac-RCou2IAQALR$5rn3IGDSta5FNA$5n3YAHH-NH2
    1132 Ac-IWI$QEL$RIGDEF$AYY$RR-NH2
    1133 Ac-IWIAQ$r8LRRIGD$F$AYY$RR-NH2
    1134 Ac-IWIAQ$r8LRRIGD$FN$YYA$R-NH2
    1135 Ac-IWI$QEL$RIGD$r8FNAYYA$R-NH2
    1136 Ac-IWIA$ELR$IGD$r8FNAYYA$R-NH2
    1137 Ac-IWI$QELStRIGDEF$s8AYYARR-NH2
    1138 Ac-IWIAQ$r8LRRIGDStFNAYYA$s8R-NH2
    1139 Ac-IWIAQEL$r8RIGDEFStAYY$r5RR-NH2
    1140 Ac-I$r8IAQELR$IGDEF$AYY$RR-NH2
    1141 Ac-IWIAQ$r8LRRIGD$FNAYYARR-NH2
    1142 Ac-IWIAQELRRIGDEF$AYY$RR-NH2
    1143 Ac-IWIAQALR$r8IGDAFN$YYA-NH2
    1144 Ac-WIAQALR$r8IGDAFN$YYA-NH2
    1145 Ac-IAQALR$r8IGDAFN$YYA-NH2
    1146 Ac-IAAALR$r8IGDAFN$YYA-NH2
    1147 Ac-IAQALA$r8IGDAFN$YYA-NH2
    1148 Ac-IAQALR$r8IADAFN$YYA-NH2
    1149 Ac-IAQALR$r8IGDAAN$YYA-NH2
    1150 Ac-IAQALR$r8IGDAFA$YYA-NH2
    1151 Ac-IAQALR$r8IGDAFN$AYA-NH2
    1152 Ac-IAQALR$r8IGDAFN$YAA-NH2
    1153 Ac-IAQALRRIGDEFNAYYAHH-NH2
    1154 Ac-IAQALR$IGD$FNAYYAHH-NH2
    1155 Ac-IWIAQALRRIGDEFNAYYAHH-NH2
    1156 Ac-IWIAQALR$IGD$FNAYYAHH-NH2
    1157 Ac-I$IAQ$LR$IGD$FNAYYAHH-NH2
    1158 HepIAQ$LRRIGDEFNAYYAHH-NH2
    1159 HepIAQ$LR$IGD$FNAYYAHH-NH2
    1160 HepIA$ALRRIGDEFNAYYAHH-NH2
    1161 HepIA$ALR$IGD$FNAYYAHH-NH2
    1162 Ac-I$IAQ$LRRIGDEF$AYY$AA-NH2
    1163 Ac-I$IAQ$LRRIGDEF$AYY$A-NH2
    1164 Ac-I$IAA$LRRIGDEF$AYY$A-NH2
    1165 Ac-I$IAV$LRRIGDEF$AYY$A-NH2
    1166 Ac-I$IAL$LRRIGDEF$AYY$A-NH2
    1167 Ac-I$IAI$LRRIGDEF$AYY$A-NH2
    1168 Ac-I$IAF$LRRIGDEF$AYY$A-NH2
    1169 Ac-I$IAY$LRRIGDEF$AYY$A-NH2
    1170 Ac-I$IAG$LRRIGDEF$AYY$A-NH2
    1171 Ac-I$IAQ$LRAIGDAF$AYY$A-NH2
    1172 Ac-I$IAQ$LRAIGDAibF$AYY$A-NH2
    1173 Ac-I$IAQ$LRAibIGDAF$AYY$A-NH2
    1174 Ac-I$IAQ$LRAibIGDAibF$AYY$A-NH2
    1175 Ac-I$IAQ$LRNleIGDNleF$AYY$A-NH2
    1176 Ac-I$IAQ$LRNleIGDAibF$AYY$A-NH2
    1177 Ac-I$IAQ$LRAibIGDNleF$AYY$A-NH2
    1178 Ac-I$IAQ$LR$r8IGDEFN$YYA-NH2
    1179 Ac-I$IAA$LR$r8IGDEFN$YYA-NH2
    1180 Ac-I$IAV$LR$r8IGDEFN$YYA-NH2
    1181 Ac-I$IAL$LR$r8IGDEFN$YYA-NH2
    1182 Ac-I$IAI$LR$r8IGDEFN$YYA-NH2
    1183 Ac-I$IAF$LR$r8IGDEFN$YYA-NH2
    1184 Ac-I$IAY$LR$r8IGDEFN$YYA-NH2
    1185 Ac-I$IAG$LR$r8IGDEFN$YYA-NH2
    1186 Ac-I$IAQ$LR$r8IGDAFN$YYA-NH2
    1187 Ac-I$IAQ$LR$r8IGDNleFN$YYA-NH2
    1188 Ac-I$IAQ$LR$r8IGDAibFN$YYA-NH2
    1189 Ac-IWIA$ELR$IGD$r8FNAYYA$A-NH2
    1190 Ac-IWIA$ALR$IGD$r8FNAYYA$A-NH2
    1191 Ac-IWIA$VLR$IGD$r8FNAYYA$A-NH2
    1192 Ac-IWIA$LLR$IGD$r8FNAYYA$A-NH2
    1193 Ac-IWIA$ILR$IGD$r8FNAYYA$A-NH2
    1194 Ac-IWIA$FLR$IGD$r8FNAYYA$A-NH2
    1195 Ac-IWIA$YLR$IGD$r8FNAYYA$A-NH2
    1196 Ac-IWIA$GLR$IGD$r8FNAYYA$A-NH2
    1197 Ac-IWIA$SLR$IGD$r8FNAYYA$A-NH2
    1198 Ac-I$IAQ$LRRIGDEF$AYY$-NH2
    1199 Ac-IWIA$ELR$IGD$r8FNAYYA$-NH2
    1200 Ac-WIAQALR$r8IGDAFN$YYA-NH2
    1201 Ac-IAQALR$r8IGDAFN$YYA-NH2
    1202 Ac-IAAALR$r8IGDAFN$YYA-NH2
    1203 Ac-IAQALA$r8IGDAFN$YYA-NH2
    1204 Ac-IAQALR$r8IADAFN$YYA-NH2
    1205 Ac-IAQALR$r8IGDAAN$YYA-NH2
    1206 Ac-IAQALR$r8IGDAFA$YYA-NH2
    1207 Ac-IAQALR$r8IGDAFN$AYA-NH2
    1208 Ac-IAQALR$r8IGDAFN$YAA-NH2
    1209 Ac-I$IAL$LR$r8IGDAFN$YYA-NH2
    1210 Ac-I$IALALR$IGDAFN$YYA$A-NH2
    1211 Ac-IWIA$ALR$IGDAFN$YYA$A-NH2
    1212 Ac-IWIA$ALRStIGDAFN$s8YYA-NH2
    1213 Ac-IWIA$ALRStIGDNleFN$s8YYA-NH2
    1214 Ac-I$r8IALALRStIGDAFN$s8YYA-NH2
    1215 Ac-I$r8IALALRStIGD$r5FNAYYA-NH2
    1216 Ac-IWIALALR$IGD$FNAYYA-NH2
    1217 Ac-IWIAQALR$IGD$FNAYYA-NH2
    1218 Ac-I$IAA$LRAibIGDAibF$AYY$A-NH2
    1219 Ac-I$IAL$LRAibIGDAibF$AYY$A-NH2
    1220 Ac-I$r8IALALR$IGDAF$AYY$A-NH2
    1221 Ac-I$r8IAQELRStIGDAFN$s8YYARR-NH2
    1222 Ac-I$r8IAQALRStIGDAFN$s8YYA-NH2
    1223 HBS-IAAarALRRIGDEFNAYYAHH-NH2
    1224 HBS-IAAarALR$IGD$FNAYYAHH-NH2
    1225 HBS-IWAarAQALRRIGDEFNAYYAHH-NH2
    1226 HBS-IWAarAQALR$IGD$FNAYYAHH-NH2
    1227 HepIAQ$LRRIGDEFNAYYAHH-NH2
    1228 HepIAQ$LR$IGD$FNAYYAHH-NH2
    1229 HepIA$ALR$IGD$FNAYYAHH-NH2
    1230 Ac-I$IAQ$LR$r8IGDEFN$YYA-NH2
    1231 Ac-I$IAA$LR$r8IGDEFN$YYA-NH2
    1232 Ac-I$IAV$LR$r8IGDEFN$YYA-NH2
    1233 Ac-I$IAV$LR$r8IGDEFN$YYA-NH2
    1234 Ac-I$IAI$LR$r8IGDEFN$YYA-NH2
    1235 Ac-I$IAI$LR$r8IGDEFN$YYA-NH2
    1236 Ac-I$IAY$LR$r8IGDEFN$YYA-NH2
    1237 Ac-I$IAL$LR$r8IGDEFN$YYA-NH2
    1238 Ac-I$IAL$LR$r8IGDEFN$YYA-NH2
    1239 Ac-I$IAF$LR$r8IGDEFN$YYA-NH2
    1240 Ac-I$IAF$LR$r8IGDEFN$YYA-NH2
    1241 Ac-I$IAQ$LR$r8IGDAFN$YYA-NH2
    1242 Ac-I$IAQ$LR$r8IGDNleFN$YYA-NH2
    1243 Ac-I$IAQ$LR$r8IGDAibFN$YYA-NH2
    1244 Ac-I$IAQ$LRRIGDEF$AYY$-NH2
    1245 Ac-I$IAA$LRRIGDEF$AYY$-NH2
    1246 Ac-I$IAV$LRRIGDEF$AYY$-NH2
    1247 Ac-I$IAL$LRRIGDEF$AYY$-NH2
    1248 Ac-I$IAI$LRRIGDEF$AYY$-NH2
    1249 Ac-I$IAF$LRRIGDEF$AYY$-NH2
    1250 Ac-I$IAY$LRRIGDEF$AYY$-NH2
    1251 Ac-I$IAG$LRRIGDEF$AYY$-NH2
    1252 Ac-I$IAQ$LRAIGDAF$AYY$-NH2
    1253 Ac-I$IAQ$LRAIGDAibF$AYY$-NH2
    1254 Ac-I$IAQ$LRAibIGDAF$AYY$-NH2
    1255 Ac-I$IAQ$LRAibIGDAibF$AYY$-NH2
    1256 Ac-I$IAQ$LRNleIGDNleF$AYY$-NH2
    1257 Ac-I$IAQ$LRNleIGDAibF$AYY$-NH2
    1258 Ac-I$IAQ$LRAibIGDNleF$AYY$-NH2
    1259 Ac-IWIA$ALR$IGD$r8FNAYYA$-NH2
    1260 Ac-IWIA$VLR$IGD$r8FNAYYA$-NH2
    1261 Ac-IWIA$LLR$IGD$r8FNAYYA$-NH2
    1262 Ac-IWIA$ILR$IGD$r8FNAYYA$-NH2
    1263 Ac-IWIA$FLR$IGD$r8FNAYYA$-NH2
    1264 Ac-IWIA$YLR$IGD$r8FNAYYA$-NH2
    1265 Ac-IWIA$GLR$IGD$r8FNAYYA$-NH2
    1266 Ac-IWIA$SLR$IGD$r8FNAYYA$-NH2
    1267 Ac-I$r8IALALR$IGDAFN$YYA$A-NH2
    1268 Ac-IWIA$r5ALRStIGDNleFN$r8YYA-NH2
    1269 Ac-I$IAL$LR$r8IGDAFN$YYA-NH2
    1270 Ac-ICou2IAQALR$r5IGDStFNA$YAHH-NH2
    1271 Ac-I$IAQ$LRAIGDAF$AYY$-NH2
    1272 Ac-I$IAQ$LRAIGDAibF$AYY$-NH2
    1273 Ac-I$IAQ$LRAIGDAibF$AYY$-NH2
    1274 Ac-I$IAQ$LRAibIGDAF$AYY$-NH2
    1275 Ac-I$IAQ$LRAibIGDAF$AYY$-NH2
    1276 Ac-I$IAQ$LRAibIGDAibF$AYY$-NH2
    1277 Ac-I$IAQ$LRAibIGDAibF$AYY$-NH2
    1278 Ac-I$IAQ$LRNleIGDNleF$AYY$-NH2
    1279 Ac-I$IAQ$LRNleIGDNleF$AYY$-NH2
    1280 Ac-I$IAQ$LRNleIGDAibF$AYY$-NH2
    1281 Ac-I$IAQ$LRNleIGDAibF$AYY$-NH2
    1282 Ac-IWIA$VLR$IGD$r8FNAYYA$-NH2
    1283 Ac-IWIA$LLR$IGD$r8FNAYYA$-NH2
    1284 Ac-IWIA$FLR$IGD$r8FNAYYA$-NH2
    1285 Ac-IWIA$SLR$IGD$r8FNAYYA$-NH2
    1286 Ac-IWIA$ELR$IGD$r8FNAYYA$-NH2
    1287 Ac-IWIA$ALR$IGD$r8FNAYYA$-NH2
    1288 Ac-I$IAA$LRRIGDEF$AYY$-NH2
    1289 Ac-I$IAA$LRRIGDEF$AYY$-NH2
    1290 Ac-I$IAL$LRRIGDEF$AYY$RR-NH2
    1291 Ac-I$IAQ$LRAibIGDAF$AYY$RR-NH2
    1292 Ac-I$IAL$LRAibIGDAF$AYY$RR-NH2
    1293 Ac-I$IAL$LRRIGDEF$AYY$R-NH2
    1294 Ac-I$IAQ$LRAibIGDAF$AYY$R-NH2
    1295 Ac-I$IAL$LRAibIGDAF$AYY$R-NH2
    1296 Ac-I$IAY$LR$r8IGDEFN$YYARR-NH2
    1297 Ac-I$IAL$LR$r8IGDEFN$YYARR-NH2
    1298 Ac-I$IAF$LR$r8IGDEFN$YYARR-NH2
    1299 Ac-I$IAQ$LR$r8IGDEFN$YYAR-NH2
    1300 Ac-I$IAY$LR$r8IGDEFN$YYAR-NH2
    1301 Ac-I$IAL$LR$r8IGDEFN$YYAR-NH2
    1302 Ac-I$IAF$LR$r8IGDEFN$YYAR-NH2
    1303 Ac-IWIA$ALR$IGD$r8FNAYYA$R-NH2
    1304 Ac-IWIALALR$r8IGDEFN$YYARR-NH2
    1305 Ac-IWIAYALR$r8IGDEFN$YYARR-NH2
    1306 Ac-IWIAQALR$r8IGDEFN$YYAR-NH2
    1307 Ac-IWIALALR$r8IGDEFN$YYAR-NH2
    1308 Ac-IWIAYALR$r8IGDEFN$YYAR-NH2
    1309 Ac-IWIALALR$IGD$FNAYYARR-NH2
    1310 Ac-IWIAYALR$IGD$FNAYYARR-NH2
    1311 Ac-IWIALALR$IGD$FNAYYAR-NH2
    1312 Ac-IWIAYALR$IGD$FNAYYAR-NH2
    1313 Ac-IWIALALR$IGD$FNAYYAH-NH2
    1314 Ac-IWIAQALR%r8IGDAFN%YYA-NH2
    1315 Ac-I$IAL$LRRIGDEF$AYY$RR-NH2
    1316 Ac-I$IAL$LRRIGDEF$AYY$R-NH2
    1317 Ac-I$IAQ$LRAibIGDAF$AYY$R-NH2
    1318 Ac-I$IAL$LRAibIGDAF$AYY$R-NH2
    1319 Ac-I$IAY$LR$r8IGDEFN$YYARR-NH2
    1320 Ac-I$IAL$LR$r8IGDEFN$YYARR-NH2
    1321 Ac-IWIA$ALR$IGD$r8FNAYYA$R-NH2
    1322 Ac-I$IAY$LR$r8IGDEFN$YYAR-NH2
    1323 Ac-I$IAL$LR$r8IGDEFN$YYAR-NH2
    1324 Ac-I$IAF$LR$r8IGDEFN$YYAR-NH2
    1325 Ac-I$IAQ$LR$r8IGDAFN$YYARR-NH2
    1326 Ac-I$IAY$LR$r8IGDAFN$YYARR-NH2
    1327 Ac-I$IAL$LR$r8IGDAFN$YYARR-NH2
    1328 Ac-I$IAF$LR$r8IGDAFN$YYARR-NH2
    1329 Ac-I$IAQ$LR$r8IGDAFN$YYAR-NH2
    1330 Ac-I$IAY$LR$r8IGDAFN$YYAR-NH2
    1331 Ac-I$IAL$LR$r8IGDAFN$YYAR-NH2
    1332 Ac-I$IAF$LR$r8IGDAFN$YYAR-NH2
    1333 Ac-IWIAQALR$r8IGDEFN$YYA-NH2
    1334 Ac-IWIAQALR$r8IGDQFN$YYA-NH2
    1335 Ac-IWIAAALR$r8IGDEFN$YYA-NH2
    1336 Ac-IWIAAALR$r8IGDQFN$YYA-NH2
    1337 Ac-IWIAAALR$r8IGDAFN$YYA-NH2
    1338 Ac-IWIAQALR$r8IGDEFA$YYA-NH2
    1339 Ac-IWIAQALR$r8IGDQFA$YYA-NH2
    1340 Ac-IWIAQALR$r8IGDAFA$YYA-NH2
    1341 Ac-IWIAQALCit$r8IGDAFN$YYA-NH2
    1342 Ac-IWIAQALCit$r8IGDQFN$YYA-NH2
    1343 Ac-IWIAQALH$r8IGDAFN$YYA-NH2
    1344 Ac-IWIAQALH$r8IGDQFN$YYA-NH2
    1345 Ac-IWIAQALQ$r8IGDAFN$YYA-NH2
    1346 Ac-IWIAQALQ$r8IGDQFN$YYA-NH2
    1347 Ac-IWIAQALR$r8IGDAAN$YYA-NH2
    1348 Ac-IWIAQALR$r8IGDQAN$YYA-NH2
    1349 Ac-IWIAQALR$r8IGDAIN$YYA-NH2
    1350 Ac-IWIAQALR$r8IGDQIN$YYA-NH2
    1351 Ac-IWIAQAAR$r8IGDAAN$YYA-NH2
    1352 Ac-IWIAQALR$r8IADAFN$YYA-NH2
    1353 Ac-IWIAQALR$r8IADQFN$YYA-NH2
    1354 Ac-IWIAQALR$r8AGDAFN$YYA-NH2
    1355 Ac-IWIAQALR$r8AGDQFN$YYA-NH2
    1356 Ac-IWIAQALR$r8FGDAFN$YYA-NH2
    1357 Ac-IWIAQALR$r8FGDQFN$YYA-NH2
    1358 Ac-IWFAQALR$r8IGDAFN$YYA-NH2
    1359 Ac-IWFAQALR$r8IGDQFN$YYA-NH2
    1360 Ac-IAIAQALR$r8IGDAFN$YYA-NH2
    1361 Ac-IWIAQALA$r8IGDAFN$YYA-NH2
    1362 Ac-IWIAQALR$r8IGNAFN$YYA-NH2
    1363 Ac-IWIAQAAR$r8IGDAFN$YYA-NH2
    1364 FITC-BaIWIAQALR$r8IGDAFN$YYA-NH2
    1365 5-FAM-BaIWIAQALR$r8IGDAFN$YYA-NH2
    1366 5-FAM-BaIWIAQALR$r8IGDEFN$YYA-NH2
    1367 Ac-WLAQLLR$IGD$IN-NH2
    1368 Ac-ICou2IALALR$IGD$FNAYYA-NH2
    1369 Ac-ICou2IALALR$IGD$FNAibFYA-NH2
    1370 Ac-I$IAY$LR$r8IGDAFN$YYARR-NH2
    1371 Ac-I$IAL$LR$r8IGDAFN$YYARR-NH2
    1372 Ac-I$IAF$LR$r8IGDAFN$YYARR-NH2
    1373 Ac-I$IAQ$LR$r8IGDAFN$YYAR-NH2
    1374 Ac-I$IAY$LR$r8IGDAFN$YYAR-NH2
    1375 Ac-I$IAL$LR$r8IGDAFN$YYAR-NH2
    1376 Ac-I$IAF$LR$r8IGDAFN$YYAR-NH2
    1377 Ac-IAIAQALR$r8IGDAFN$YYA-NH2
    1378 Ac-IWIAQALR$r8IGDEFN$YYA-NH2
    1379 Ac-IWIAQALR$r8IGDQFN$YYA-NH2
    1380 Ac-IWIAAALR$r8IGDEFN$YYA-NH2
    1381 Ac-IWIAAALR$r8IGDQFN$YYA-NH2
    1382 Ac-IWIAAALR$r8IGDAFN$YYA-NH2
    1383 Ac-IWIAQALR$r8IGDAFA$YYA-NH2
    1384 Ac-IWIAQALCit$r8IGDAFN$YYA-NH2
    1385 Ac-IWIAQALCit$r8IGDQFN$YYA-NH2
    1386 Ac-IWIAQALH$r8IGDAFN$YYA-NH2
    1387 Ac-IWIAQALH$r8IGDQFN$YYA-NH2
    1388 Ac-IWIAQALQ$r8IGDAFN$YYA-NH2
    1389 Ac-IWIAQALQ$r8IGDQFN$YYA-NH2
    1390 Ac-IWIAQALR$r8IGDAAN$YYA-NH2
    1391 Ac-IWIAQALR$r8IGDAIN$YYA-NH2
    1392 Ac-IWIAQALR$r8IGDQIN$YYA-NH2
    1393 Ac-IWIAQAAR$r8IGDAAN$YYA-NH2
    1394 Ac-IWIAQALR$r8IADAFN$YYA-NH2
    1395 Ac-IWIAQALR$r8IADQFN$YYA-NH2
    1396 Ac-IWIAQALR$r8AGDAFN$YYA-NH2
    1397 Ac-IWIAQALR$r8AGDQFN$YYA-NH2
    1398 Ac-IWIAQALR$r8FGDAFN$YYA-NH2
    1399 Ac-IWIAQALR$r8FGDQFN$YYA-NH2
    1400 Ac-IWFAQALR$r8IGDAFN$YYA-NH2
    1401 Ac-IWFAQALR$r8IGDQFN$YYA-NH2
    1402 Ac-IWIAQALA$r8IGDAFN$YYA-NH2
    1403 Ac-IWIAQALR$r8IGNAFN$YYA-NH2
    1404 Ac-IWIAQAAR$r8IGDAFN$YYA-NH2
    1405 Ac-IWIALALG$IGD$VNAYYA-NH2
    1406 Ac-IWIALALG$IGD$INAYYA-NH2
    1407 Ac-IWIALALG$IGN$VNAYYA-NH2
    1408 Ac-IWIALALG$IGN$INAYYA-NH2
    1409 Ac-IWIALALN$IGD$VNAYYA-NH2
    1410 Ac-IWIALALN$IGD$INAYYA-NH2
    1411 Ac-IWIALALN$IGN$VNAYYA-NH2
    1412 Ac-IWIALALN$IGN$INAYYA-NH2
    1413 Ac-IWIALALR$IGD$VNAFYA-NH2
    1414 Ac-IWIALALR$IGD$VNAYYA-NH2
    1415 Ac-IWIALALR$IGD$VNAibFYA-NH2
    1416 Ac-IWIALALR$IGD$VNAibYYA-NH2
    1417 Ac-IWFALALR$IGD$FNAYYA-NH2
    1418 Ac-IWYALALR$IGD$FNAYYA-NH2
    1419 Ac-IWVALALR$IGD$FNAYYA-NH2
    1420 Ac-IWLALALR$IGD$FNAYYA-NH2
    1421 Ac-IWIAQALR$IGD$VNAYYA-NH2
    1422 Ac-IWIAQALR$IGD$INAYYA-NH2
    1423 Ac-IWIALALR$IGD$INAYYA-NH2
    1424 Ac-IWIALLLR$IGD$VNAYYA-NH2
    1425 Ac-IWIALLLR$IGD$INAYYA-NH2
    1426 Ac-IWIALALG$IGD$FNAYYA-NH2
    1427 Ac-IWIALALS$IGD$FNAYYA-NH2
    1428 Ac-IWIALALH$IGD$FNAYYA-NH2
    1429 Ac-IWIALALN$IGD$FNAYYA-NH2
    1430 Ac-IWIALAIG$IGD$VNAYYA-NH2
    1431 Ac-IWIALAIG$IGD$INAYYA-NH2
    1432 Ac-IWIALAIN$IGD$VNAYYA-NH2
    1433 Ac-IWIALAIN$IGD$INAYYA-NH2
    1434 Ac-IWIALALN$IGD$VNAYYAHH-NH2
    1435 Ac-IWIALALN$IGD$INAYYAHH-NH2
    1436 Ac-IWIALALN$IGN$VNAYYAHH-NH2
    1437 Ac-IWIALALN$IGN$INAYYAHH-NH2
    1438 Ac-IWIA$r5ALGStIGD$VNAYYA-NH2
    1439 Ac-IWIA$r5ALGStIGD$INAYYA-NH2
    1440 Ac-IWIA$r5ALGStIGN$VNAYYA-NH2
    1441 Ac-IWIA$r5ALGStIGN$INAYYA-NH2
    1442 Ac-IWIALALR$IGD$VNAAAA-NH2
    1443 Ac-IWIALALG$IGD$VNAAAA-NH2
    1444 Ac-IWIALALD$IGD$VNAAAA-NH2
    1445 Ac-IWIALALN$IGD$VNAAAA-NH2
    1446 Ac-IWIALALR$IGD$VN-NH2
    1447 Ac-IWIALALG$IGD$VN-NH2
    1448 Ac-IWIALALD$IGD$VN-NH2
    1449 Ac-IWIALALN$IGD$VN-NH2
    1450 5-FAM-BaIWIA$r5ALGStIGD$VNAYYA-NH2
    1451 5-FAM-BaIWIALALR$IGD$FNAibFYA-NH2
    1452 5-FAM-BaIWIA$r5ALGStIGN$INAYYA-NH2
    1453 5-FAM-BaIWIALALG$IGN$INAYYA-NH2
    1454 FITC-BaIWIA$r5ALGStIGD$VNAYYA-NH2
    1455 FITC-BaIWIALALR$IGD$FNAibFYA-NH2
    1456 5-FAM-BaIWIA$r5ALGStIGD$INAYYA-NH2
    1457 Ac-IWIAQALR$r8IGDQFA$YYA-NH2
    1458 Ac-RWIAQALR$IGD$LNAFYAHH-NH2
    1459 Ac-RWIAQELR$IGD$LNAibFYAHH-NH2
    1460 Ac-RWIAQALR$IGD$LNAibFYA-NH2
    1461 Ac-RWIAQAAR$IGD$LNAibFYAHH-NH2
    1462 Ac-RWIAQALA$IGD$LNAibFYAHH-NH2
    1463 Ac-RWIAQALR$IGN$LNAibFYAHH-NH2
    1464 Ac-RWIAQALCit$IGD$LNAibFYAHH-NH2
    1465 Ac-RWIAQALR$IGD$ANAibFYAHH-NH2
    1466 Ac-RCou2IAQAAR$IGD$LNAibFYAHH-NH2
    1467 Ac-RCou2IAQALA$IGD$LNAibFYAHH-NH2
    1468 Ac-RCou2IAQALR$IGN$LNAibFYAHH-NH2
    1469 Ac-RCou2IAQALCit$IGD$LNAibFYAHH-NH2
    1470 Ac-IWIAMOALCit$r8IGDAFN$YYA-NH2
    1471 Ac-IWIAMO2ALCit$r8IGDAFN$YYA-NH2
    1472 Ac-RWIAMOALR$IGD$LNAibFYAHH-NH2
    1473 Ac-RWIAMO2ALR$IGD$LNAibFYAHH-NH2
    1474 Ac-RWIAQALR$IGN$VNAibFYAHH-NH2
    1475 Ac-RWIAQAAR$IGD$VNAibFYAHH-NH2
    1476 Ac-RWIAQALA$IGD$VNAibFYAHH-NH2
    1477 Ac-RWIAQALCit$IGD$VNAibFYAHH-NH2
    1478 Ac-RCou2IAQALR$IGD$VNAibFYAHH-NH2
    1479 Ac-RCou2IAQALR$IGN$VNAibFYAHH-NH2
    1480 Ac-RCou2IAQAAR$IGD$VNAibFYAHH-NH2
    1481 Ac-RCou2IAQALA$IGD$VNAibFYAHH-NH2
    1482 Ac-RCou2IAQALCit$IGD$VNAibFYAHH-NH2
    1483 Ac-IWChaAQALR$r8IGDAFN$YYA-NH2
    1484 Ac-IWhhLAQALR$r8IGDAFN$YYA-NH2
    1485 Ac-IWAdmAQALR$r8IGDAFN$YYA-NH2
    1486 Ac-IWhChaAQALR$r8IGDAFN$YYA-NH2
    1487 Ac-IWhFAQALR$r8IGDAFN$YYA-NH2
    1488 Ac-IWIglAQALR$r8IGDAFN$YYA-NH2
    1489 Ac-IWF4CF3AQALR$r8IGDAFN$YYA-NH2
    1490 Ac-IWF4tBuAQALR$r8IGDAFN$YYA-NH2
    1491 Ac-IW2NalAQALR$r8IGDAFN$YYA-NH2
    1492 Ac-IWBipAQALR$r8IGDAFN$YYA-NH2
    1493 Ac-IWIAQAChaR$r8IGDAFN$YYA-NH2
    1494 Ac-IWIAQAhhLR$r8IGDAFN$YYA-NH2
    1495 Ac-IWIAQAAdmR$r8IGDAFN$YYA-NH2
    1496 Ac-IWIAQAhChaR$r8IGDAFN$YYA-NH2
    1497 Ac-IWIAQAhAdmR$r8IGDAFN$YYA-NH2
    1498 Ac-IWIAQAhFR$r8IGDAFN$YYA-NH2
    1499 Ac-IWIAQAIglR$r8IGDAFN$YYA-NH2
    1500 Ac-IWIAQAF4CF3R$r8IGDAFN$YYA-NH2
    1501 Ac-IWIAQAF4tBuR$r8IGDAFN$YYA-NH2
    1502 Ac-IWIAQA2NalR$r8IGDAFN$YYA-NH2
    1503 Ac-IWIAQABipR$r8IGDAFN$YYA-NH2
    1504 Ac-IWIAQALR$r8CbaGDAFN$YYA-NH2
    1505 Ac-IWIAQALR$r8hLGDAFN$YYA-NH2
    1506 Ac-IWIAQALR$r8ChaGDAFN$YYA-NH2
    1507 Ac-IWIAQALR$r8TbaGDAFN$YYA-NH2
    1508 Ac-IWIAQALR$r8hhLGDAFN$YYA-NH2
    1509 Ac-IAmWIAQALR$r8IGDAFN$YYA-NH2
    1510 Ac-IAibIAQALR$r8IGDAFN$YYA-NH2
    1511 Ac-AmLWIAQALR$r8IGDAFN$YYA-NH2
    1512 Ac-IWAmLAQALR$r8IGDAFN$YYA-NH2
    1513 Ac-IWIAibQALR$r8IGAmDAFN$YYA-NH2
    1514 Ac-IWIAAibALR$r8IGDAFN$YYA-NH2
    1515 Ac-IWIAQAAmLR$r8IGDAFN$YYA-NH2
    1516 Ac-IWIAQALR$r8IGAmDAFN$YYA-NH2
    1517 Ac-IWIAQALR$r8IGDAFN$F4FYA-NH2
    1518 Ac-IWIAQALR$r8IGDAFN$AYA-NH2
    1519 Ac-IWIAQALR$r8IGDAFN$YF4FA-NH2
    1520 Ac-IWIAQALR$r8IGDAFN$YYAib-NH2
    1521 Ac-I$r8IAQALRStIGDEFN$s8YYA-NH2
    1522 Ac-IWIA$ALRStIGDEFN$s8YYA-NH2
    1523 Ac-IWIAQALR$r8IGDEFNStYYA$r5A-NH2
    1524 Ac-IWIAQAACit$r8IGDAFN$YYA-NH2
    1525 Ac-IWIAQALCit$r8IGNAFN$YYA-NH2
    1526 Ac-IWIAQALCit$r8IGDAAN$YYA-NH2
    1527 Ac-IWIAQALCit$r8IGDAVN$YYA-NH2
    1528 Ac-RWIAQAChaR$IGD$LNAibFYAHH-NH2
    1529 Ac-RWIAQAhhLR$IGD$LNAibFYAHH-NH2
    1530 Ac-RWIAQAAdmR$IGD$LNAibFYAHH-NH2
    1531 Ac-RWIAQAhChaR$IGD$LNAibFYAHH-NH2
    1532 Ac-RWIAQAhFR$IGD$LNAibFYAHH-NH2
    1533 Ac-RWIAQAIglR$IGD$LNAibFYAHH-NH2
    1534 Ac-RWIAQAF4CF3R$IGD$LNAibFYAHH-NH2
    1535 Ac-RWIAQAF4tBuR$IGD$LNAibFYAHH-NH2
    1536 Ac-RWIAQA2NalR$IGD$LNAibFYAHH-NH2
    1537 Ac-RWIAQABipR$IGD$LNAibFYAHH-NH2
    1538 Ac-IWIAQ$r8LRRIGD$FNAYYA-NH2
    1539 Ac-IWIAQ$r8LRAIGD$FNAYYA-NH2
    1540 Ac-IWIAQ$r8LCitRIGD$FNAYYA-NH2
    1541 Ac-IWIAQ$r8LCitAIGD$FNAYYA-NH2
    1542 Ac-IWIAMOALCit$r8IGDAFN$YYA-NH2
    1543 Ac-IWIAMO2ALCit$r8IGDAFN$YYA-NH2
    1544 Ac-IWIAQALD$r8IGRAFN$YYA-NH2
    1545 Ac-RWIAQALD$IGR$LNAibFYAHH-NH2
    1546 Ac-RPEIWIAQAID$r8IGDAVN$YYAR-NH2
    1547 Ac-RPEIWIAQAID$IGD$VNAYYAR-NH2
    1548 Ac-DWIAQALR$r8IGDAFN$YYR-NH2
    1549 Ac-IWAAQALR$r8IGDAFN$YYA-NH2
    1550 Ac-IWTbaAQALR$r8IGDAFN$YYA-NH2
    1551 Ac-IWhLAQALR$r8IGDAFN$YYA-NH2
    1552 Ac-IWChgAQALR$r8IGDAFN$YYA-NH2
    1553 Ac-IWAc6cAQALR$r8IGDAFN$YYA-NH2
    1554 Ac-IWAc5cAQALR$r8IGDAFN$YYA-NH2
    1555 Ac-EWIAAALR$r8IGDAFN$YYA-NH2
    1556 Ac-RWIAAALR$r8IGDAFN$YYA-NH2
    1557 Ac-KWIAAALR$r8IGDAFN$YYA-NH2
    1558 Ac-HWIAAALR$r8IGDAFN$YYA-NH2
    1559 Ac-SWIAAALR$r8IGDAFN$YYA-NH2
    1560 Ac-QWIAAALR$r8IGDAFN$YYA-NH2
    1561 Ac-AWIAAALR$r8IGDAFN$YYA-NH2
    1562 Ac-AibWIAAALR$r8IGDAFN$YYA-NH2
    1563 Ac-FWIAAALR$r8IGDAFN$YYA-NH2
    1564 Ac-IDIAAALR$r8IGDAFN$YYA-NH2
    1565 Ac-IRIAAALR$r8IGDAFN$YYA-NH2
    1566 Ac-IHIAAALR$r8IGDAFN$YYA-NH2
    1567 Ac-ISIAAALR$r8IGDAFN$YYA-NH2
    1568 Ac-INIAAALR$r8IGDAFN$YYA-NH2
    1569 Ac-ILIAAALR$r8IGDAFN$YYA-NH2
    1570 Ac-IFIAAALR$r8IGDAFN$YYA-NH2
    1571 Ac-I2NalIAAALR$r8IGDAFN$YYA-NH2
    1572 Ac-IWISAALR$r8IGDAFN$YYA-NH2
    1573 Ac-IWILAALR$r8IGDAFN$YYA-NH2
    1574 Ac-IWIFAALR$r8IGDAFN$YYA-NH2
    1575 Ac-IWIALALR$r8IGDAFN$YYA-NH2
    1576 Ac-IWIAAALF4g$r8IGDAFN$YYA-NH2
    1577 Ac-IWIAAALK$r8IGDAFN$YYA-NH2
    1578 Ac-IWIAAALR$r8IAbuDAFN$YYA-NH2
    1579 Ac-IWIAAALR$r8IVDAFN$YYA-NH2
    1580 Ac-IWIAAALR$r8IGEAFN$YYA-NH2
    1581 Ac-IWIAAALR$r8IGDAGN$YYA-NH2
    1582 Ac-IWIAQALR$r8IGDAWN$YYA-NH2
    1583 Ac-IWIAQALR$r8IGDAhFN$YYA-NH2
    1584 Ac-IWIAQALR$r8IGDAF4CF3N$YYA-NH2
    1585 Ac-IWIAQALR$r8IGDAF4tBuN$YYA-NH2
    1586 Ac-IWIAQALR$r8IGDA2NalN$YYA-NH2
    1587 Ac-IWIAQALR$r8IGDABipN$YYA-NH2
    1588 Ac-IWIAAALR$r8IGDAFD$YYA-NH2
    1589 Ac-IWIAAALR$r8IGDAFE$YYA-NH2
    1590 Ac-IWIAAALR$r8IGDAFQ$YYA-NH2
    1591 Ac-IWIAAALR$r8IGDAFS$YYA-NH2
    1592 Ac-IWIAAALR$r8IGDAFH$YYA-NH2
    1593 Ac-IWIAAALR$r8IGDAFN$LYA-NH2
    1594 Ac-IWIAQALR$r8IGDAFN$YAA-NH2
    1595 Ac-IWIAQALR$r8IGDAFN$YLA-NH2
    1596 Ac-IWIAQALR$r8IGDAFN$YChaA-NH2
    1597 Ac-IWIAQALR$r8IGDAFN$YhFA-NH2
    1598 Ac-IWIAQALR$r8IGDAFN$YWA-NH2
    1599 Ac-IWIAQALR$r8IGDAFN$Y2NalA-NH2
    1600 Ac-IWIAAALR$r8IGDAFN$YYD-NH2
    1601 Ac-IWIAAALR$r8IGDAFN$YYE-NH2
    1602 Ac-IWIAAALR$r8IGDAFN$YYQ-NH2
    1603 Ac-IWIAAALR$r8IGDAFN$YYS-NH2
    1604 Ac-IWIAAALR$r8IGDAFN$YYH-NH2
    1605 Ac-IWIAAALR$r8IGDAFN$YYR-NH2
    1606 Ac-IWIAAALR$r8IGDAFN$YYK-NH2
    1607 Ac-IWIAQALR$rda6IGDAFN$da5YYA-NH2
    1608 Ac-IWIAQAAmLR$r8IGDAFN$YYA-NH2
    1609 Ac-IWIAQALR$r8IGAmDAFN$YYA-NH2
    1610 Ac-IWIAQALR$r8IGDAFN$F4FYA-NH2
    1611 Ac-IWIAQALR$r8IGDAFN$YYAib-NH2
    1612 Ac-IWIAQAACit$r8IGDAFN$YYA-NH2
    1613 Ac-IWIAQALCit$r8IGNAFN$YYA-NH2
    1614 Ac-IWIAQALCit$r8IGDAAN$YYA-NH2
    1615 Ac-IWIAQALCit$r8IGDAVN$YYA-NH2
    1616 Ac-IWIAQ$r8LRAIGD$FNAYYA-NH2
    1617 Ac-IWIAQ$r8LCitAIGD$FNAYYA-NH2
    1618 Ac-IWIAQALR$r8IGDAFN$AYA-NH2
    1619 Ac-IWIAQ$r8LRRIGD$FNAYYA-NH2
    1620 Ac-IWIAQALR$r8hLGDAFN$F4FYA-NH2
    1621 Ac-IWIAQALR$r8hLGDAFN$YF4FA-NH2
    1622 Ac-IWIAQALR$r8hLGDAFN$F4FF4FA-NH2
    1623 Ac-AWIAAALR$r8hLGDAFN$YF4FA-NH2
    1624 Ac-AWIAAALR$r8hLGDAFN$AF4FA-NH2
    1625 Ac-IWIAQAAR$r8hLGDAFN$F4FF4FA-NH2
  • In the sequences shown above and elsewhere, the following abbreviations are used: “Nle” represents norleucine, “Aib” represents 2-aminoisobutyric acid, “Ac” represents acetyl, and “Pr” represents propionyl. Amino acids represented as “$” are alpha-Me S5-pentenyl-alanine olefin amino acids connected by an all-carbon crosslinker comprising one double bond. Amino acids represented as “$r5” are alpha-Me R5-pentenyl-alanine olefin amino acids connected by an all-carbon comprising one double bond. Amino acids represented as “$s8” are alpha-Me S8-octenyl-alanine olefin amino acids connected by an all-carbon crosslinker comprising one double bond. Amino acids represented as “$r8” are alpha-Me R8-octenyl-alanine olefin amino acids connected by an all-carbon crosslinker comprising one double bond. “Ahx” represents an aminocyclohexyl linker. The crosslinkers are linear all-carbon crosslinker comprising eight or eleven carbon atoms between the alpha carbons of each amino acid. Amino acids represented as “$/” are alpha-Me S5-pentenyl-alanine olefin amino acids that are not connected by any crosslinker. Amino acids represented as “$/r5” are alpha-Me R5-pentenyl-alanine olefin amino acids that are not connected by any crosslinker. Amino acids represented as “$/s8” are alpha-Me S8-octenyl-alanine olefin amino acids that are not connected by any crosslinker. Amino acids represented as “$/r8” are alpha-Me R8-octenyl-alanine olefin amino acids that are not connected by any crosslinker. Amino acids represented as “Amw” are alpha-Me tryptophan amino acids. Amino acids represented as “Aml” are alpha-Me leucine amino acids. Amino acids represented as “Amf” are alpha-Me phenylalanine amino acids. Amino acids represented as “2ff” are 2-fluoro-phenylalanine amino acids. Amino acids represented as “3ff” are 3-fluoro-phenylalanine amino acids. Amino acids represented as “St” are amino acids comprising two pentenyl-alanine olefin side chains, each of which is crosslinked to another amino acid as indicated. Amino acids represented as “St//” are amino acids comprising two pentenyl-alanine olefin side chains that are not crosslinked. Amino acids represented as “%St” are amino acids comprising two pentenyl-alanine olefin side chains, each of which is crosslinked to another amino acid as indicated via fully saturated hydrocarbon crosslinks. Amino acids represented as “Ba” are beta-alanine. The lower-case character “e” or “z” within the designation of a crosslinked amino acid (e.g., “$er8” or “$zr8”) represents the configuration of the double bond (E or Z, respectively). In other contexts, lower-case letters such as “a” or “f” represent D amino acids (e.g., D-alanine, or D-phenylalanine , respectively). Amino acids designated as “NmW” represent N-methyltryptophan. Amino acids designated as “NmY” represent N-methyltyrosine. Amino acids designated as “NmA” represent N-methylalanine. “Kbio” represents a biotin group attached to the side chain amino group of a lysine residue. Amino acids designated as “Sar” represent sarcosine. Amino acids designated as “Cha” represent cyclohexyl alanine. Amino acids designated as “Cpg” represent cyclopentyl glycine. Amino acids designated as “Chg” represent cyclohexyl glycine. Amino acids designated as “Cba” represent cyclobutyl alanine. Amino acids designated as “F4I” represent 4-iodo phenylalanine. “7L” represents N15 isotopic leucine. Amino acids designated as “F3Cl” represent 3-chloro phenylalanine. Amino acids designated as “F4cooh” represent 4-carboxy phenylalanine. Amino acids designated as “F34F2” represent 3,4-difluoro phenylalanine. Amino acids designated as “6clW” represent 6-chloro tryptophan. Amino acids designated as “$rda6” represent alpha-Me R6-hexynyl-alanine alkynyl amino acids, crosslinked via a dialkyne bond to a second alkynyl amino acid. Amino acids designated as “$da5” represent alpha-Me S5-pentynyl-alanine alkynyl amino acids, wherein the alkyne forms one half of a dialkyne bond with a second alkynyl amino acid. Amino acids designated as “$ra9” represent alpha-Me R9-nonynyl-alanine alkynyl amino acids, crosslinked via an alkyne metathesis reaction with a second alkynyl amino acid. Amino acids designated as “$a6” represent alpha-Me S6-hexynyl-alanine alkynyl amino acids, crosslinked via an alkyne metathesis reaction with a second alkynyl amino acid. The designation “iso1” or “iso2” indicates that the peptidomimetic macrocycle is a single isomer. Amino acids designated as “Cit” represent citrulline.
  • Amino acids which are used in the formation of triazole crosslinkers are represented according to the legend indicated below. Stereochemistry at the alpha position of each amino acid is S unless otherwise indicated. For azide amino acids, the number of carbon atoms indicated refers to the number of methylene units between the alpha carbon and the terminal azide. For alkyne amino acids, the number of carbon atoms indicated is the number of methylene units between the alpha position and the triazole moiety plus the two carbon atoms within the triazole group derived from the alkyne.
  •
    $5a5 Alpha-Me alkyne 1,5 triazole (5 carbon)
    $5n3 Alpha-Me azide 1,5 triazole (3 carbon)
    $4rn6 Alpha-Me R- azide 1,4 triazole (6 carbon)
    $4a5 Alpha- Me alkyne 1,4 triazole (5 carbon)
  • In some embodiments, peptidomimetic macrocycles are provided which are derived from BIM. In some embodiments, the present invention provides a peptidomimetic macrocycle comprising an amino acid sequence which is at least about 60% identical to BIM, further comprising at least two macrocycle-forming linkers, wherein the first of said two macrocycle-forming linkers connects a first amino acid to a second amino acid, and the second of said two macrocycle-forming linkers connects a third amino acid to a fourth amino acid.
  • Two or more peptides can share a degree of homology. In some embodiments, the pair of peptides is a peptidomimetic macrocycle of the present disclosure and a peptide identical to BIM. A pair of peptides can have, for example, up to about 20% pairwise homology, up to about 25% pairwise homology, up to about 30% pairwise homology, up to about 35% pairwise homology, up to about 40% pairwise homology, up to about 45% pairwise homology, up to about 50% pairwise homology, up to about 55% pairwise homology, up to about 60% pairwise homology, up to about 65% pairwise homology, up to about 70% pairwise homology, up to about 75% pairwise homology, up to about 80% pairwise homology, up to about 85% pairwise homology, up to about 90% pairwise homology, up to about 95% pairwise homology, up to about 96% pairwise homology, up to about 97% pairwise homology, up to about 98% pairwise homology, up to about 99% pairwise homology, up to about 99.5% pairwise homology, or up to about 99.9% pairwise homology. A pair of peptides can have, for example, at least about 20% pairwise homology, at least about 25% pairwise homology, at least about 30% pairwise homology, at least about 35% pairwise homology, at least about 40% pairwise homology, at least about 45% pairwise homology, at least about 50% pairwise homology, at least about 55% pairwise homology, at least about 60% pairwise homology, at least about 65% pairwise homology, at least about 70% pairwise homology, at least about 75% pairwise homology, at least about 80% pairwise homology, at least about 85% pairwise homology, at least about 90% pairwise homology, at least about 95% pairwise homology, at least about 96% pairwise homology, at least about 97% pairwise homology, at least about 98% pairwise homology, at least about 99% pairwise homology, at least about 99.5% pairwise homology, at least about 99.9% pairwise homology.
  • Various methods and software programs can be used to determine the homology between two or more peptides, such as NCBI BLAST, Clustal W, MAFFT, Clustal Omega, AlignMe, Praline, or another suitable method or algorithm.
  • In some embodiments, a peptidomimetic macrocycle of the invention comprises a helix, for example an α-helix. In some embodiments, a peptidomimetic macrocycle of the invention comprises an α,α-disubstituted amino acid. In some embodiments, each amino acid connected by the macrocycle-forming linker is an α,α-disubstituted amino acid.
  • In some embodiments, a peptidomimetic macrocycle of the invention has the Formula (I):
  • Figure US20180340009A1-20181129-C00018
  • wherein:
  • each A, C, D, and E is independently an amino acid (including natural or non-natural amino acids and amino acid analogs) and the terminal D and E independently optionally include a capping group;
  • each B is independently an amino acid (including natural or non-natural amino acids and amino acid analogs),
  • Figure US20180340009A1-20181129-C00019
  • [—NH-L3-CO—], [-NH-L3-SO2—], or [—NH-L3-];
  • each R1 and R2 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, cycloalkylalkyl, heteroalkyl, or heterocycloalkyl, unsubstituted or substituted with halo-; or at least one of R1 and R2 forms a macrocycle-forming linker L′ connected to the alpha position of one of said D or E amino acids;
  • each R3 is independently hydrogen, alkyl, alkenyl, alkynyl, arylalkyl, heteroalkyl, cycloalkyl, heterocycloalkyl, cycloalkylalkyl, cycloaryl, or heterocycloaryl, optionally substituted with R5;
  • each L and L′ is independently a macrocycle-forming linker of the formula -L1-L2-,
  • Figure US20180340009A1-20181129-C00020
  • or -L1-S-L2-S-L3-;
  • each L1, L2 and L3 is independently alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, cycloarylene, heterocycloarylene, or [—R4—K—R4—]n, each being optionally substituted with R5; when L is not
  • Figure US20180340009A1-20181129-C00021
  • or -L1-S-L2-S-L3-, L1 and L2 are alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, cycloarylene, or heterocycloarylene;
  • each R4 is independently alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, arylene, or heteroarylene;
  • each K is independently O, S, SO, SO2, CO, CO2, or CONR3;
  • each R5 is independently halogen, alkyl, —OR6, —N(R6)2, —SR6, —SOR6, —SO2R6, —CO2R6, a fluorescent moiety, a radioisotope or a therapeutic agent;
  • each R6 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkylalkyl, heterocycloalkyl, a fluorescent moiety, a radioisotope or a therapeutic agent;
  • each R7 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, cycloaryl, or heterocycloaryl, optionally substituted with R5, or part of a cyclic structure with a D residue;
  • each R8 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, cycloaryl, or heterocycloaryl, optionally substituted with R5, or part of a cyclic structure with an E residue;
  • each R9 is independently absent, hydrogen, alkyl, alkenyl, alkynyl, aryl, cycloalkyl, cycloalkenyl, heteroaryl, or heterocyclyl group, unsubstituted or optionally substituted with Ra or Rb;
  • each Ra and Rb is independently alkyl, OCH3, CF3, NH2, CH2NH2, F, Br, I,
  • Figure US20180340009A1-20181129-C00022
  • each v and w is independently an integer from 0-1000, for example 0-500, 0-200, 0-100, 0-50, 0-30, 0-20, or 0-10;
  • u is an integer from 1-10, for example 1-5, 1-3 or 1-2;
  • each x, y and z is independently an integer from 0-10, for example the sum of x+y+z is 2, 3, or 6;
  • each n is independently an integer from 1-5; and
  • wherein A, B, C, D, and E, taken together with the crosslinked amino acids connected by the macrocycle-forming linker, -L1-L2-, form an amino acid sequence of the peptidomimetic macrocycle which is at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to BIM 1-44, BIM 1-29 or to an amino acid sequence chosen from the group consisting of the amino acid sequences in Table 1;
  • In some embodiments, u is 1.
  • In some embodiments, the sum of x+y+z is 2, 3, 6, or 10, for example 2, 3 or 6, for example 3 or 6.
  • In some embodiments, the sum of x+y+z is 3.
  • In some embodiments, each of v and w is independently an integer from 1 to 10, 1 to 15, 1 to 20, or 1 to 25.
  • In some embodiments, each of v and w is independently an integer from 1 to 15.
  • In some embodiments, v and w are integers from 1-30. In some embodiments, w is an integer from 3-1000, for example 3-500, 3-200, 3-100, 3-50, 3-30, 3-20, or 3-10. In some embodiments, the sum of x+y+z is 3 or 6. In some embodiments, the sum of x+y+z is 3. In other embodiments, the sum of x+y+z is 6.
  • In some embodiments, w is an integer from 3-10, for example 3-6, 3-8, 6-8, or 6-10. In some embodiments, w is 3. In other embodiments, w is 6. In some embodiments, v is an integer from 1-1000, for example 1-500, 1-200, 1-100, 1-50, 1-30, 1-20, or 1-10. In some embodiments, v is 2.
  • In some embodiments, L1 and L2 are independently alkylene, alkenylene or alkynylene.
  • In some embodiments, L1 and L2 are independently C3-C10 alkylene or alkenylene.
  • In some embodiments, L1 and L2 are independently C3-C6 alkylene or alkenylene.
  • In some embodiments, L or L′ is:
  • Figure US20180340009A1-20181129-C00023
  • In some embodiments, L or L′ is
  • Figure US20180340009A1-20181129-C00024
  • For example, L or L′ is
  • Figure US20180340009A1-20181129-C00025
  • In some embodiments, R1 and R2 are H.
  • In some embodiments, R1 and R2 are independently alkyl.
  • In some embodiments, R1 and R2 are methyl.
  • In some embodiments, the present invention provides a peptidomimetic macrocycle having the Formula (Ia):
  • Figure US20180340009A1-20181129-C00026
  • wherein:
  • R8′ is —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, cycloaryl, or heterocycloaryl, optionally substituted with R5, or part of a cyclic structure with a E residue;
  • v′ and w′ are independently integers from 0-100; and
  • x′, y′ and z′ are independently integers from 0-10, for example, x′+y′+z′ is 2, 3, 6 or 10.
  • In some embodiments, u is 2.
  • In some embodiments, the peptidomimetic macrocycle of Formula (I) has the Formula (Ib):
  • Figure US20180340009A1-20181129-C00027
  • wherein:
  • R7′ is —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, cycloaryl, or heterocycloaryl, optionally substituted with R5, or part of a cyclic structure with a D residue;
  • R8′ is —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, cycloaryl, or heterocycloaryl, optionally substituted with R5, or part of a cyclic structure with an E residue;
  • v′ and w′ are independently integers from 0-100; and
  • x′, y′ and z′ are independently integers from 0-10.
  • In some embodiments, the sum of x+y+z is 2, 3 or 6, for example 3 or 6.
  • In some embodiments, the sum of x′+y′+z′ is 2, 3 or 6, for example 3 or 6.
  • In some embodiments, each of v and w is independently an integer from 1 to 10, 1 to 15, 1 to 20, or 1 to 25.
  • In some embodiments, v and w are integers from 1-30. In some embodiments, w is an integer from 3-1000, for example 3-500, 3-200, 3-100, 3-50, 3-30, 3-20, or 3-10. In some embodiments, the sum of x+y+z is 3 or 6. In some embodiments, the sum of x+y+z is 3. In other embodiments, the sum of x+y+z is 6.
  • In some embodiments, w is an integer from 3-10, for example 3-6, 3-8, 6-8, or 6-10. In some embodiments, w is 3. In other embodiments, w is 6. In some embodiments, v is an integer from 1-1000, for example 1-500, 1-200, 1-100, 1-50, 1-30, 1-20, or 1-10. In some embodiments, v is 2.
  • In some embodiments, a peptidomimetic macrocycle of the invention comprises an amino acid sequence which is at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to an amino acid sequence of Table 1, and comprising at least one macrocycle-forming linker, wherein the macrocycle-forming linker connects amino acids 14 and 18.
  • In some embodiments, a peptidomimetic macrocycle of Formula (I) has Formula (Ic):
  • Figure US20180340009A1-20181129-C00028
  • wherein:
  • each A, C, D, and E is independently a natural or non-natural amino acid;
  • each B is independently a natural or non-natural amino acid, amino acid analog,
  • Figure US20180340009A1-20181129-C00029
  • [—NH-L3-CO—], [—NH-L3SO2—], or [—NH-L3];
  • each L is independently a macrocycle-forming linker;
  • each L′ is independently alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, arylene, or heteroarylene, each being optionally substituted with R5, or a bond, or together with R1 and the atom to which both R1 and L′ are bound forms a ring;
  • each L″ is independently alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, arylene, or heteroarylene, each being optionally substituted with R5, or a bond, or together with R2 and the atom to which both R2 and L″ are bound forms a ring;
  • each R1 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, cycloalkylalkyl, heteroalkyl, or heterocycloalkyl, unsubstituted or substituted with halo-, or together with L′ and the atom to which both R1 and L′ are bound forms a ring;
  • each R2 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, cycloalkylalkyl, heteroalkyl, or heterocycloalkyl, unsubstituted or substituted with halo-, or together with L″ and the atom to which both R2 and L″ are bound forms a ring;
  • each R3 is independently hydrogen, alkyl, alkenyl, alkynyl, arylalkyl, heteroalkyl, cycloalkyl, heterocycloalkyl, cycloalkylalkyl, aryl, or heteroaryl, optionally substituted with R5;
  • each L3 is independently alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, arylene, heteroarylene, or [—R4—K—R4—]n, each being optionally substituted with R5;
  • each R4 is independently alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, arylene, or heteroarylene;
  • each K is independently O, S, SO, SO2, CO, CO2, or CONR3;
  • n is an integer from 1-5;
  • each R5 is independently halogen, alkyl, —OR6, —N(R6)2, —SR6, —SOR6, —SO2R6, —CO2R6, a fluorescent moiety, a radioisotope or a therapeutic agent;
  • each R6 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkylalkyl, heterocycloalkyl, a fluorescent moiety, a radioisotope or a therapeutic agent;
  • each R7 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, aryl, or heteroaryl, optionally substituted with R5, or part of a cyclic structure with a D residue;
  • each R8 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, aryl, or heteroaryl, optionally substituted with R5, or part of a cyclic structure with an E residue;
  • each v and w is independently an integer from 1-1000, for example 1-500, 1-200, 1-100, 1-50, 1-40, 1-25, 1-20, 1-15, or 1-10;
  • u is an integer from 1-10; and
  • each x, y and z is independently an integer from 0-10.
  • In some embodiments, the peptidomimetic macrocycle comprises two crosslinks, wherein a first crosslink is of a first pair of amino acid residues, and a second crosslink is of a second pair of amino acid residues. In some embodiments, the first pair of amino acid residues and the second pair of amino acid residues do not share a common amino acid residue. In some embodiments, the first pair of amino acid residues and the second pair of amino acid residues share one common amino acid residue.
  • In some embodiments, w is at least about 1, at least about 2, at least about 3, at least about 4, at least about 5, at least about 6, at least about 7, at least about 8, at least about 9, or at least about 10. In some embodiments, w is from about 1 to about 2, from about 2 to about 3, from about 3 to about 4, from about 4 to about 5, from about 5 to about 6, from about 6 to about 7, from about 7 to about 8, from about 8 to about 9, or from about 9 to about 10.
  • In some embodiments, w is at least 2 and at least one of the last two E residues is a His residue. In some embodiments, w is at least 2 and at least one of the last two E residues is an Arg residue. In some embodiments, w is at least 2 and both of the last two E residues are His residues. In some embodiments, w is at least 2 and both of the last two E residues are Arg residues. The number of His residues at the peptide C-terminus, or at the E variable, can be 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10. The His residues can be contiguous, or interrupted by a gap of i, i+1, i+2, i+3, or i+4.
  • In some embodiments, the peptidomimetic macrocycle comprises a helix. In some embodiments, the peptidomimetic macrocycle comprises an α-helix. In some embodiments, each of v and w is independently an integer from 1 to 15. In some embodiments, each of v and w is independently an integer from 3 to 10. In some embodiments, v is 8. In some embodiments, w is 6. In some embodiments, the crosslinked amino acid residues are at positions 9 and 13 of the peptidomimetic macrocycle.
  • In some embodiments, L is
  • Figure US20180340009A1-20181129-C00030
  • In some embodiments, R1 and R2 are H. In some embodiments, R1 and R2 are independently alkyl. In some embodiments, R1 and R2 are methyl.
  • In some embodiments, the peptidomimetic macrocycles have the Formula (I):
  • Figure US20180340009A1-20181129-C00031
  • wherein:
  • each A, C, D, and E is independently a natural or non-natural amino acid;
  • each B is independently a natural or non-natural amino acid, amino acid analog,
  • Figure US20180340009A1-20181129-C00032
  • [—NH-L3-CO—], [—NH-L3-SO2—], or [—NH-L3-];
  • each R1 and R2 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, cycloalkylalkyl, heteroalkyl, or heterocycloalkyl, unsubstituted or substituted with halo-;
  • each R3 is independently hydrogen, alkyl, alkenyl, alkynyl, arylalkyl, heteroalkyl, cycloalkyl, heterocycloalkyl, cycloalkylalkyl, aryl, or heteroaryl, optionally substituted with R5;
  • each L is independently a macrocycle-forming linker of the formula
  • Figure US20180340009A1-20181129-C00033
  • each L1, L2 and L3 is independently alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, arylene, heteroarylene, or [—R4—K—R4—]n, each being optionally substituted with R5;
  • each R4 is independently alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, arylene, or heteroarylene;
  • each K is independently O, S, SO, SO2, CO, CO2, or CONR3; each R5 is independently halogen, alkyl, —OR6, —N(R6)2, —SR6, —SOR6, —SO2R6, —CO2R6, a fluorescent moiety, a radioisotope or a therapeutic agent;
  • each R6 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkylalkyl, heterocycloalkyl, a fluorescent moiety, a radioisotope or a therapeutic agent;
  • each R7 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, aryl, or heteroaryl, optionally substituted with R5, or part of a cyclic structure with a D residue;
  • each R8 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, aryl, or heteroaryl, optionally substituted with R5, or part of a cyclic structure with an E residue;
  • each v and w is independently an integer from 1-1000;
  • u is an integer from 1-10;
  • each x, y and z is independently an integer from 0-10; and
  • n is an integer from 1-5.
  • In other embodiments, provided are peptidomimetic macrocycles comprising Formula (II) or (IIa):
  • Figure US20180340009A1-20181129-C00034
  • wherein:
  • each A, C, D, and E is independently a natural or non-natural amino acid, and the terminal D and E independently optionally include a capping group;
  • each B is independently a natural or non-natural amino acid, amino acid analog,
  • Figure US20180340009A1-20181129-C00035
  • [—NH-L3-CO—], [—NH-L3-SO2—], or [—NH-L3—];
  • each R1 and R2 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, cycloalkylalkyl, heteroalkyl, or heterocycloalkyl, unsubstituted or substituted with halo-; or at least one of R1 and R2 forms a macrocycle-forming linker L′ connected to the alpha position of one of said D or E amino acids;
  • each R3 is independently hydrogen, alkyl, alkenyl, alkynyl, arylalkyl, heteroalkyl, cycloalkyl, heterocycloalkyl, cycloalkylalkyl, cycloaryl, or heterocycloaryl, optionally substituted with R5;
  • each L1, L2, and L3 is independently alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, cycloarylene, heterocycloarylene, or [—R4—K—R4—]n, each being optionally substituted with R5;
  • each R4 is independently alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, arylene, or heteroarylene;
  • each K is independently O, S, SO, SO2, CO, CO2, or CONR3; each R5 is independently halogen, alkyl, —OR6, —N(R6)2, —SR6, —SOR6, —SO2R6, —CO2R6, a fluorescent moiety, a radioisotope or a therapeutic agent;
  • each R6 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkylalkyl, heterocycloalkyl, a fluorescent moiety, a radioisotope or a therapeutic agent;
  • each R7 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, cycloaryl, or heterocycloaryl, optionally substituted with R5;
  • each v and w is independently an integer from 0-100;
  • u is an integer from 1-10;
  • each x, y and z is independently an integer from 0-10;
  • n is an integer from 1-5; and
  • A, B, C, and E, taken together with the crosslinked amino acids connected by the macrocycle-forming linker -L1-L2-, form an amino acid sequence of the peptidomimetic macrocycle which is at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical to a sequence of Table 1.
  • In some embodiments, a peptidomimetic macrocycle comprises Formula (IIIa) or (IIIb):
  • Figure US20180340009A1-20181129-C00036
  • wherein:
  • each A, C, D and E is independently an amino acid, and the terminal D and E independently optionally include a capping group;
  • each B is independently an amino acid,
  • Figure US20180340009A1-20181129-C00037
  • [—NH-L3-CO—], [—NH-L3-SO2—], or [—NH-L3—];
  • each R1′ and R2 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, cycloalkylalkyl, heteroalkyl, or heterocycloalkyl, unsubstituted or substituted with halo-; or R2 forms a macrocycle-forming linker L′ connected to the alpha position of one of said E amino acids;
  • each R3 is independently hydrogen, alkyl, alkenyl, alkynyl, arylalkyl, heteroalkyl, cycloalkyl, heterocycloalkyl, cycloalkylalkyl, cycloaryl, or heterocycloaryl, optionally substituted with R5;
  • each L and L′ is independently a macrocycle-forming linker of the formula -L1-L2-,
  • Figure US20180340009A1-20181129-C00038
  • or -L1-S-L2-S-L3-;
  • each L1, L2 and L3 is independently alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, cycloarylene, heterocycloarylene, or [—R4-K-R4—]n, each being optionally substituted with R5;
  • each R4 is independently alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, arylene, or heteroarylene;
  • each K is independently O, S, SO, SO2, CO, CO2, or CONR3; each R5 is independently halogen, alkyl, —OR6, —N(R6)2, —SR6, —SOR6, —SO2R6, —CO2R6, a fluorescent moiety, a radioisotope or a therapeutic agent;
  • each R6 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkylalkyl, heterocycloalkyl, a fluorescent moiety, a radioisotope or a therapeutic agent;
  • each R7 or R7′ is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, cycloaryl, or heterocycloaryl, optionally substituted with R5, or part of a cyclic structure with a D residue;
  • each R8 or R8′ is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, cycloaryl, or heterocycloaryl, optionally substituted with R5, or part of a cyclic structure with an E residue;
  • each R9 is independently absent, hydrogen, alkyl, alkenyl, alkynyl, aryl, cycloalkyl, cycloalkenyl, heteroaryl, or heterocyclyl group, unsubstituted or optionally substituted with Ra or Rb;
  • each Ra and Rb is independently alkyl, OCH3, CF3, NH2, CH2NH2, F, Br, I,
  • Figure US20180340009A1-20181129-C00039
  • each v′ and w is independently an integer from 0-1000, for example 0-500, 0-200, 0-100, 0-50, 0-30, 0-20, or 0-10;
  • u is an integer from 1-10, for example 1-5, 1-3 or 1-2;
  • each x, y, z, x′, y′ and z′ is independently an integer from 0-10, for example the sum of x+y+z is 2, 3, 6 or 10, or the sum of x′+y′+z′ is 2, 3, 6, or 10;
  • n is an integer from 1-5;
  • X is C═O, CHRc, or C═S;
  • Rc is alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, cycloalkylalkyl, heteroalkyl, or heterocycloalkyl; and
  • A, B, C, and E, taken together with the crosslinked amino acids connected by the macrocycle-forming linker -L1-L2-, form an amino acid sequence of the peptidomimetic macrocycle which is at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical to a sequence of Table 1.
  • In some embodiments, the peptidomimetic macrocycle has the Formula:
  • Figure US20180340009A1-20181129-C00040
  • wherein:
  • each R1′ or R2′ is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, cycloalkylalkyl, heteroalkyl, or heterocycloalkyl, unsubstituted or substituted with halo-; and
  • each v, w, v′ or w′ is independently an integer from 0-100.
  • In some embodiments, the notation “Hep” is used for a macrocycle of Formula Ma, which represents an N-terminal heptenoic capping group of the following formula:
  • Figure US20180340009A1-20181129-C00041
  • wherein AA1, AA2, AA3 and AA4 are amino acids.
  • In other embodiments, a C-terminal macrocycle of Formula IIIb forms the structure:
  • Figure US20180340009A1-20181129-C00042
  • In some embodiments, the peptidomimetic macrocycle has the Formula IV:
  • Figure US20180340009A1-20181129-C00043
  • wherein:
  • each A, C, D, and E is independently an amino acid;
  • each B is independently an amino acid,
  • Figure US20180340009A1-20181129-C00044
  • [—NH-L4-CO—], [—NH-L4-SO2—], or [—NH-L4—];
  • each R1 and R2 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, cycloalkylalkyl, heteroalkyl, or heterocycloalkyl, unsubstituted or substituted with halo-; or at least one of R1 and R2 forms a macrocycle-forming linker L′ connected to the alpha position of one of said D or E amino acids;
  • each R3 is independently hydrogen, alkyl, alkenyl, alkynyl, arylalkyl, heteroalkyl, cycloalkyl, heterocycloalkyl, cycloalkylalkyl, cycloaryl, or heterocycloaryl, optionally substituted with R5;
  • each L1, L2, L3 and L4 is independently alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, cycloarylene, heterocycloarylene or [—R4—K—R4—]n, each being unsubstituted or substituted with R5;
  • each K is independently O, S, SO, SO2, CO, CO2, or CONR3;
  • each R4 is independently alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, arylene, or heteroarylene;
  • each R5 is independently halogen, alkyl, —OR6, —N(R6)2, —SR6, —SOR6, —SO2R6, —CO2R6, a fluorescent moiety, a radioisotope or a therapeutic agent;
  • each R6 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkylalkyl, heterocycloalkyl, a fluorescent moiety, a radioisotope or a therapeutic agent;
  • each R7 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, cycloaryl, or heterocycloaryl, optionally substituted with R5, or part of a cyclic structure with a D residue;
  • each R8 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, cycloaryl, or heterocycloaryl, optionally substituted with R5, or part of a cyclic structure with an E residue;
  • each v and w is independently an integer from 1-1000, for example 1-500, 1-200, 1-100, 1-50, 1-30, 1-20 or 1-10;
  • u is an integer from 1-10, for example 1-5, 1-3 or 1-2;
  • each x, y and z is independently an integer from 0-10, for example the sum of x+y+z is 2, 3, 6 or 10, for example sum of x+y+z is 2, 3or 6; and
  • n is an integer from 1-5.
  • In some embodiments, the peptidomimetic macrocycle has the Formula (V):
  • Figure US20180340009A1-20181129-C00045
  • wherein:
  • each D and E is independently an amino acid residue;
  • R1 and R2 are independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, cycloalkylalkyl, heteroalkyl, or heterocycloalkyl, each being optionally substituted with halo-; or at least one of R1 and R2 forms a macrocycle-forming linker L′ connected to the alpha position of one of the D or E amino acid residues;
  • each L or L′ is independently a macrocycle-forming linker of the formula -L1-L2-or -L1-L2-L3-;
  • each L1, L2, and L3 is independently alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, arylene, heteroarylene, or [—R4—K—R4—]n, each being optionally substituted with R5;
  • each R3 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, aryl, or heteroaryl, each being optionally substituted with R5;
  • each R4 is independently alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, arylene, or heteroarylene, each being optionally substituted with R5;
  • each K is independently O, S, SO, SO2, CO, CO2, or CONR3; each R5 is independently halogen, alkyl, —OR6, —N(R6)2, —SR6, —SOR6, —SO2R6, —CO2R6, a fluorescent moiety, a radioisotope, or a therapeutic agent;
  • each R6 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkylalkyl, heterocycloalkyl, a fluorescent moiety, a radioisotope, or a therapeutic agent;
  • R7 is —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, aryl, or heteroaryl, each being optionally substituted with R5, or part of a cyclic structure with a D residue;
  • R8 is —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, aryl, or heteroaryl, each being optionally substituted with R5, or part of a cyclic structure with an E residue;
  • each of Xaa1 and Xaa2 is independently an amino acid residue or absent;
  • Xaa3 is Ala, Aib, Asp, Asn, Cys, Glu, Gln, His, Ile, Lys, Leu, Met, Arg, Ser, Thr, Val, Trp, Tyr, or an analogue of any of the foregoing;
  • v is an integer from 1-1000;
  • w is an integer from 0-1000; and
  • n is an integer from 1-5.
  • In some embodiments, the peptidomimetic macrocycle of Formula (V) comprises two crosslinks, wherein a first crosslink is of a first pair of amino acid residues, and a second crosslink is of a second pair of amino acid residues. In some embodiments, the first pair of amino acid residues and the second pair of amino acid residues do not share a common amino acid residue. In some embodiments, the first pair of amino acid residues and the second pair of amino acid residues share one common amino acid residue. In some embodiments, one of Xaa1 and Xaa2 is His. In some embodiments, both of Xaa1 and Xaa2 are His. In some embodiments, one of Xaa1 and Xaa2 is Arg. In some embodiments, both of Xaa1 and Xaa2 are Arg. In some embodiments, one of Xaa1 and Xaa2 is absent. In some embodiments, both of Xaa1 and Xaa2 are absent.
  • In some embodiments, the peptidomimetic macrocycle comprises a helix. In some embodiments, the peptidomimetic macrocycle comprises an α-helix. In some embodiments, v is an integer from 1 to 15. In some embodiments, v is an integer from 3 to 10. In some embodiments, v is 8. In some embodiments, w is an integer from 0 to 15. In some embodiments, w is an integer from 0 to 5. In some embodiments, w is an integer from 0 to 3. In some embodiments, wherein w is 0.
  • In some embodiments, v and w are integers from 1-30. In some embodiments, w is an integer from 3-1000, for example 3-500, 3-200, 3-100, 3-50, 3-30, 3-20, or 3-10. In some embodiments, the sum of x+y+z is 3 or 6. In some embodiments, the sum of x+y+z is 3. In other embodiments, the sum of x+y+z is 6.
  • In some embodiments, w is an integer from 3-10, for example 3-6, 3-8, 6-8, or 6-10. In some embodiments, w is 3. In other embodiments, w is 6. In some embodiments, v is an integer from 1-1000, for example 1-500, 1-200, 1-100, 1-50, 1-30, 1-20, or 1-10. In some embodiments, v is 2.
  • In some embodiments, L is the formula -L1-L2-, and L1 and L2 are independently alkylene, alkenylene, or alkynylene. In some embodiments, wherein L is the formula -L1-L2-, and L1 and L2 are independently C3-C10 alkylene or C3-C10 alkenylene. In some embodiments, wherein L is the formula -L1-L2-, and L1 and L2 are independently C3-C6 alkylene or C3-C6 alkenylene. In some embodiments, L is
  • Figure US20180340009A1-20181129-C00046
  • In some embodiments, L is the formula -L1-L2-L3-, and L1 and L3 are independently alkylene, alkenylene, or alkynylene, and L2 is arylene or heteroarylene. In some embodiments, L is the formula -L1-L2-L3-, and L1 and L3 are independently C3-C10 alkylene, and L2 is heteroarylene. In some embodiments, L is the formula -L1-L2-L3-, and L1 and L3 are independently C3-C6 alkylene, and L2 is heteroarylene.
  • In some embodiments, R1 and R2 are H. In some embodiments, R1 and R2 are independently alkyl. In some embodiments, R1 and R2 are methyl.
  • In some embodiments, the peptidomimetic macrocycle has the Formula (VI) (SEQ ID NO: 1783):
  • Figure US20180340009A1-20181129-C00047
  • wherein:
  • each D and E is independently an amino acid residue;
  • R1 and R2 are independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, cycloalkylalkyl, heteroalkyl, or heterocycloalkyl, each being optionally substituted with halo-; or at least one of R1 and R2 forms a macrocycle-forming linker L′ connected to the alpha position of one of the D or E amino acid residues;
  • each L or L′ is independently a macrocycle-forming linker of the formula -L1-L2-or -L1-L2-L3-;
  • each L1, L2, and L3 is independently alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, arylene, heteroarylene, or [—R4—K—R4—]n, each being optionally substituted with R5;
  • each R3 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, aryl, or heteroaryl, each being optionally substituted with R5;
  • each R4 is independently alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, arylene, or heteroarylene, each being optionally substituted with R5;
  • each K is independently O, S, SO, SO2, CO, CO2, or CONR3; each R5 is independently halogen, alkyl, —OR6, —N(R6)2, —SR6, —SOR6, —SO2R6, —CO2R6, a fluorescent moiety, a radioisotope, or a therapeutic agent;
  • each R6 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkylalkyl, heterocycloalkyl, a fluorescent moiety, a radioisotope, or a therapeutic agent;
  • R7 is —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, aryl, or heteroaryl, each being optionally substituted with R5, or part of a cyclic structure with a D residue;
  • R8 is —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, aryl, or heteroaryl, each being optionally substituted with R5, or part of a cyclic structure with an E residue;
  • each of Xaa1 and Xaa2 is independently an amino acid residue or absent;
  • v is an integer from 1-1000;
  • w is an integer from 0-1000; and
  • n is an integer from 1-5.
  • In some embodiments, the peptidomimetic macrocycle of Formula (VI) comprises two crosslinks, wherein a first crosslink is of a first pair of amino acid residues, and a second crosslink is of a second pair of amino acid residues. In some embodiments, the first pair of amino acid residues and the second pair of amino acid residues do not share a common amino acid residue. In some embodiments, the first pair of amino acid residues and the second pair of amino acid residues share one common amino acid residue. In some embodiments, one of Xaa1 and Xaa2 is His. In some embodiments, both of Xaa1 and Xaa2 are His. In some embodiments, one of Xaa1 and Xaa2 is Arg. In some embodiments, both of Xaa1 and Xaa2 are Arg. In some embodiments, one of Xaa1 and Xaa2 is absent. In some embodiments, both of Xaa1 and Xaa2 are absent.
  • In some embodiments, the peptidomimetic macrocycle comprises a helix. In some embodiments, the peptidomimetic macrocycle comprises an α-helix. In some embodiments, v is an integer from 1 to 15. In some embodiments, v is an integer from 3 to 10. In some embodiments, v is 8. In some embodiments, w is an integer from 0 to 15. In some embodiments, w is an integer from 0 to 5. In some embodiments, w is an integer from 0 to 3. In some embodiments, wherein w is 0.
  • In some embodiments, v and w are integers from 1-30. In some embodiments, w is an integer from 3-1000, for example 3-500, 3-200, 3-100, 3-50, 3-30, 3-20, or 3-10. In some embodiments, the sum of x+y+z is 3 or 6. In some embodiments, the sum of x+y+z is 3. In other embodiments, the sum of x+y+z is 6.
  • In some embodiments, w is an integer from 3-10, for example 3-6, 3-8, 6-8, or 6-10. In some embodiments, w is 3. In other embodiments, w is 6. In some embodiments, v is an integer from 1-1000, for example 1-500, 1-200, 1-100, 1-50, 1-30, 1-20, or 1-10. In some embodiments, v is 2.
  • In some embodiments, L is the formula -L1-L2-, and L1 and L2 are independently alkylene, alkenylene, or alkynylene. In some embodiments, wherein L is the formula -L1-L2-, and L1 and L2 are independently C3-C10 alkylene or C3-C10 alkenylene. In some embodiments, wherein L is the formula -L1-L2-, and L1 and L2 are independently C3-C6 alkylene or C3-C6 alkenylene. In some embodiments, L is
  • Figure US20180340009A1-20181129-C00048
  • In some embodiments, L is the formula -L1-L2-L3-, and L1 and L3 are independently alkylene, alkenylene, or alkynylene, and L2 is arylene or heteroarylene. In some embodiments, L is the formula -L1-L2-L3-, and L1 and L3 are independently C3-C10 alkylene, and L2 is heteroarylene. In some embodiments, L is the formula -L1-L2-L3-, and L1 and L3 are independently C3-C6 alkylene, and L2 is heteroarylene.
  • In some embodiments, R1 and R2 are H. In some embodiments, R1 and R2 are independently alkyl. In some embodiments, R1 and R2 are methyl.
  • In one example, at least one of R1 and R2 is alkyl, unsubstituted or substituted with halo-. In another example, both R1 and R2 are independently alkyl, unsubstituted or substituted with halo-. In some embodiments, at least one of R1 and R2 is methyl. In other embodiments, R1 and R2 are methyl.
  • In some embodiments of the invention, the sum of the sum of x+y+z is at least 3, or the sum of x′+y′+z′ is at least 3. In other embodiments of the invention, the sum of the sum of x+y+z is 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 (for example 2, 3 or 6) or the sum of x′+y′+z′ is 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 (for example 2, 3 or 6).
  • Each occurrence of A, B, C, D or E in a macrocycle or macrocycle precursor of the invention is independently selected. For example, a sequence represented by the formula [A]x, when x is 3, encompasses embodiments where the amino acids are not identical, e.g. Gln-Asp-Ala as well as embodiments where the amino acids are identical, e.g. Gln-Gln-Gln. This applies for any value of x, y, or z in the indicated ranges Similarly, when u is greater than 1, each compound of the invention may encompass peptidomimetic macrocycles which are the same or different. For example, a compound of the invention may comprise peptidomimetic macrocycles comprising different linker lengths or chemical compositions.
  • In some embodiments, the peptidomimetic macrocycle of the invention comprises a secondary structure which is an α-helix and R8 is —H, allowing intrahelical hydrogen bonding. In some embodiments, at least one of A, B, C, D or E is an α,α-disubstituted amino acid. In one example, B is an α,α-disubstituted amino acid. For instance, at least one of A, B, C, D or E is 2-aminoisobutyric acid. In other embodiments, at least one of A, B, C, D or E is
  • Figure US20180340009A1-20181129-C00049
  • In other embodiments, the length of the macrocycle-forming linker L as measured from a first Cα to a second Cα is selected to stabilize a desired secondary peptide structure, such as an cc-helix formed by residues of the peptidomimetic macrocycle including, but not necessarily limited to, those between the first Cα to a second Cα.
  • In one embodiment, the peptidomimetic macrocycle of Formula (I) is:
  • Figure US20180340009A1-20181129-C00050
  • wherein each R1 and R2 is independently independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, cycloalkylalkyl, heteroalkyl, or heterocycloalkyl, unsubstituted or substituted with halo-.
  • In related embodiments, the peptidomimetic macrocycle comprises a structure of Formula (I) which is:
  • Figure US20180340009A1-20181129-C00051
  • In other embodiments, the peptidomimetic macrocycle of Formula (I) is a compound of any of the formulas shown below:
  • Figure US20180340009A1-20181129-C00052
    Figure US20180340009A1-20181129-C00053
    Figure US20180340009A1-20181129-C00054
    Figure US20180340009A1-20181129-C00055
  • wherein “AA” represents any natural or non-natural amino acid side chain and “
    Figure US20180340009A1-20181129-P00002
    ” is [D]v, [E]w as defined above, and n is an integer between 0 and 20, 50, 100, 200, 300, 400 or 500. In some embodiments, the substituent “n” shown in the preceding paragraph is 0. In other embodiments, the substituent “n” shown in the preceding paragraph is less than 50, 40, 30, 20, 10, or 5.
  • Exemplary embodiments of the macrocycle-forming linker L are shown below.
  • Figure US20180340009A1-20181129-C00056
  • In other embodiments, D or E in the compound of Formula I are further modified in order to facilitate cellular uptake. In some embodiments, lipidating or PEGylating a peptidomimetic macrocycle facilitates cellular uptake, increases bioavailability, increases blood circulation, alters pharmacokinetics, decreases immunogenicity or decreases the needed frequency of administration.
  • In other embodiments, at least one of [D] and [E] in the compound of Formula I represents a moiety comprising an additional macrocycle-forming linker such that the peptidomimetic macrocycle comprises at least two macrocycle-forming linkers. In a specific embodiment, a peptidomimetic macrocycle comprises two macrocycle-forming linkers.
  • In the peptidomimetic macrocycles of the invention, any of the macrocycle-forming linkers described herein may be used in any combination with any of the sequences shown in Tables 1-2 and also with any of the R— substituents indicated herein.
  • In some embodiments, the peptidomimetic macrocycle comprises at least one α-helix motif. For example, A, B or C in the compound of Formula I include one or more α-helices. As a general matter, α-helices include between 3 and 4 amino acid residues per turn. In some embodiments, the α-helix of the peptidomimetic macrocycle includes 1 to 5 turns and, therefore, 3 to 20 amino acid residues. In specific embodiments, the α-helix includes 1 turn, 2 turns, 3 turns, 4 turns, or 5 turns. In some embodiments, the macrocycle-forming linker stabilizes an α-helix motif included within the peptidomimetic macrocycle. Thus, in some embodiments, the length of the macrocycle-forming linker L from a first Cα to a second Cα is selected to increase the stability of an α-helix. In some embodiments, the macrocycle-forming linker spans from 1 turn to 5 turns of the α-helix. In some embodiments, the macrocycle-forming linker spans approximately 1 turn, 2 turns, 3 turns, 4 turns, or 5 turns of the α-helix. In some embodiments, the length of the macrocycle-forming linker is approximately 5 Å to 9 Å per turn of the α-helix, or approximately 6 Å to 8 Å per turn of the α-helix. Where the macrocycle-forming linker spans approximately 1 turn of an α-helix, the length is equal to approximately 5 carbon-carbon bonds to 13 carbon-carbon bonds, approximately 7 carbon-carbon bonds to 11 carbon-carbon bonds, or approximately 9 carbon-carbon bonds. Where the macrocycle-forming linker spans approximately 2 turns of an α-helix, the length is equal to approximately 8 carbon-carbon bonds to 16 carbon-carbon bonds, approximately 10 carbon-carbon bonds to 14 carbon-carbon bonds, or approximately 12 carbon-carbon bonds. Where the macrocycle-forming linker spans approximately 3 turns of an α-helix, the length is equal to approximately 14 carbon-carbon bonds to 22 carbon-carbon bonds, approximately 16 carbon-carbon bonds to 20 carbon-carbon bonds, or approximately 18 carbon-carbon bonds. Where the macrocycle-forming linker spans approximately 4 turns of an α-helix, the length is equal to approximately 20 carbon-carbon bonds to 28 carbon-carbon bonds, approximately 22 carbon-carbon bonds to 26 carbon-carbon bonds, or approximately 24 carbon-carbon bonds. Where the macrocycle-forming linker spans approximately 5 turns of an α-helix, the length is equal to approximately 26 carbon-carbon bonds to 34 carbon-carbon bonds, approximately 28 carbon-carbon bonds to 32 carbon-carbon bonds, or approximately 30 carbon-carbon bonds. Where the macrocycle-forming linker spans approximately 1 turn of an α-helix, the linkage contains approximately 4 atoms to 12 atoms, approximately 6 atoms to 10 atoms, or approximately 8 atoms. Where the macrocycle-forming linker spans approximately 2 turns of the α-helix, the linkage contains approximately 7 atoms to 15 atoms, approximately 9 atoms to 13 atoms, or approximately 11 atoms. Where the macrocycle-forming linker spans approximately 3 turns of the α-helix, the linkage contains approximately 13 atoms to 21 atoms, approximately 15 atoms to 19 atoms, or approximately 17 atoms. Where the macrocycle-forming linker spans approximately 4 turns of the α-helix, the linkage contains approximately 19 atoms to 27 atoms, approximately 21 atoms to 25 atoms, or approximately 23 atoms. Where the macrocycle-forming linker spans approximately 5 turns of the α-helix, the linkage contains approximately 25 atoms to 33 atoms, approximately 27 atoms to 31 atoms, or approximately 29 atoms. Where the macrocycle-forming linker spans approximately 1 turn of the α-helix, the resulting macrocycle forms a ring containing approximately 17 members to 25 members, approximately 19 members to 23 members, or approximately 21 members. Where the macrocycle-forming linker spans approximately 2 turns of the α-helix, the resulting macrocycle forms a ring containing approximately 29 members to 37 members, approximately 31 members to 35 members, or approximately 33 members. Where the macrocycle-forming linker spans approximately 3 turns of the α-helix, the resulting macrocycle forms a ring containing approximately 44 members to 52 members, approximately 46 members to 50 members, or approximately 48 members. Where the macrocycle-forming linker spans approximately 4 turns of the α-helix, the resulting macrocycle forms a ring containing approximately 59 members to 67 members, approximately 61 members to 65 members, or approximately 63 members. Where the macrocycle-forming linker spans approximately 5 turns of the α-helix, the resulting macrocycle forms a ring containing approximately 74 members to 82 members, approximately 76 members to 80 members, or approximately 78 members.
  • In some embodiments, L is a macrocycle-forming linker of the formula
  • Figure US20180340009A1-20181129-C00057
  • Exemplary embodiments of such macrocycle-forming linkers L are shown below.
  • Figure US20180340009A1-20181129-C00058
    Figure US20180340009A1-20181129-C00059
    Figure US20180340009A1-20181129-C00060
    Figure US20180340009A1-20181129-C00061
    Figure US20180340009A1-20181129-C00062
    Figure US20180340009A1-20181129-C00063
    Figure US20180340009A1-20181129-C00064
    Figure US20180340009A1-20181129-C00065
    Figure US20180340009A1-20181129-C00066
    Figure US20180340009A1-20181129-C00067
  • In some embodiments, the peptidomimetic macrocycle comprises an amino acid sequence of formula:

  • X1-X2-X3-X4-X5-X6-X7-X8-X9-X10-X11-X12-X13-X14-X15-X16-X17-X18-X19-X20- X21
  • wherein:
  • In some embodiments, X1 is Ile, Arg, Ala, Lys, Pro, Leu, Asp, Glu, His, Ser, Gln, Phe, an analog thereof, or absent.
  • In some embodiments, X2 is Trp, Arg, Ala, Asn, Phe, Pro, Leu, Ser, Lys, Tyr, His, Cou, Cou2, Cou4, Cou7, an analog thereof, a crosslinked amino acid, or absent.
  • In some embodiments, X3 is Ile, Ala, Leu, Phe, Tyr,Val, Asp, Trp, Pro, Gln, Chg, Ac5c, Ac6c, Tba, Bip, Cha, Adm, hCha, an analog thereof, or absent.
  • In some embodiments, X4 is Ala, Gln, Asp, Val, Gly, Ser, Leu, Phe, Cha, A4, an analog, thereof, a crosslinked amino acid, or absent.
  • In some embodiments, X5 is Gln, Ala, Leu, Phe, Tyr, Gly, Ile, Val, Arg, Glu, Pro, Asp, MO, M02, an analog thereof, a crosslinked amino acid, or absent.
  • In some embodiments, X6 is Glu, Gln, His, Ala, Ser, Arg, Ile, Leu, Thr, Phe, Val, Tyr, Gly, Nle, St, an analog thereof, or absent.
  • In some embodiments, X7 is Ala, Leu, Phe, Ile, 2Nal, 1Nal, 3cf, Chg, Cha, Adm, hCha, Igl, Bip, an analog thereof, or absent.
  • In some embodiments, X8 is Arg, Ala, Asp, Glu, Thr, His, Gln, Gly, Asn, Phe, Cit, St, an analog thereof, a crosslinked amino acid, or absent.
  • In some embodiments, X9 is Arg, Ala, Asp, Lys, Asn, Gly, Ser, Gln, Cys, Nle, St, an analog thereof, or a crosslinked amino acid.
  • In some embodiments, X10 is Ile, Val, Ala, Asp, Asn, Phe, Tba, hL, hhL, Nle, Chg, Cha, an analog thereof, or a crosslinked amino acid.
  • In some embodiments, X11 is Gly, Val, Ala, Leu, Ile, Asp, Glu, Cha, Aib, Abu, an analog thereof, or a crosslinked amino acid.
  • In some embodiments, X12 is Asp, Ala, Asn, Gly, Arg, Glu, Lys, Leu, Nle, an analog thereof, or a crosslinked amino acid.
  • In some embodiments, X13 is Ala, Glu, Gln, Leu, Lys, Asp, Tyr, Ile, Ser, Cys, St, Sta5, Aib, Nle, an analog thereof, or a crosslinked amino acid.
  • In some embodiments, X14 is Phe, Ala, Leu, Val, Tyr, Glu, His, Ile, Nle, 1Nal, 2Nal, Chg, Cha, BiP, an analog thereof, or a crosslinked amino acid.
  • In some embodiments, X15 is Asn, Gln, Ser, His, Glu, Asp, Ala, Leu, Ile, St, Nle, Aib, an analog thereof, a crosslinked amino acid, or absent.
  • In some embodiments, X16 is Ala, Glu, Asp, Arg, Lys, Phe, Gly, Gln, Aib, Cha, St, an analog thereof, a crosslinked amino acid, or absent.
  • In some embodiments, X17 is Phe, Tyr, Ala, Leu, Asn, Ser, Gln, Arg, His, Thr, Cou2, Cou3, Cou7, Dpr, Amf, Damf, Amye, an analog thereof, a crosslinked amino acid, or absent.
  • In some embodiments, X18 is Tyr, Ala, Ile, Phe, His, Arg, Lys, Trp, Orn, Amf, Amye, Cha, 2Nal, an analog thereof, or absent.
  • In some embodiments, X19 is Ala, Lys, Arg, His, Ser, Gln, Glu, Asp, Thr, Aib, Cha, an analog thereof, a crosslinked amino acid, or absent.
  • In some embodiments, X20 is Arg, His, Ala, Thr, Lys, Amr, an analog thereof, a crosslinked amino acid, or absent.
  • In some embodiments, X21 is Arg, His, Ala, Amr, an analog thereof, or absent.
  • In some embodiments, the peptidomimetic macrocycle comprises a helix.
  • In some embodiments, the peptidomimetic macrocycle comprises an α-helix.
  • In some embodiments, the peptidomimetic macrocycle comprises an α,α-disubstituted amino acid.
  • In some embodiments, each amino acid connected by the macrocycle-forming linker is an α,α-disubstituted amino acid.
    • Preparation of Peptidomimetic Macrocycles
  • Peptidomimetic macrocycles of the invention may be prepared by any of a variety of methods known in the art. For example, any of the residues indicated by “X”, “Z” or “XX” in Tables 1 or 2 may be substituted with a residue capable of forming a crosslinker with a second residue in the same molecule or a precursor of such a residue.
  • Various methods to effect formation of peptidomimetic macrocycles are known in the art. For example, the preparation of peptidomimetic macrocycles of Formula I is described in Schafmeister et al., J. Am. Chem. Soc. 122:5891-5892 (2000); Schafmeister & Verdin, J. Am. Chem. Soc. 122:5891 (2005); Walensky et al., Science 305:1466-1470 (2004); U.S. Pat. No. 7,192,713 and PCT application WO 2008/121767. The α,α-disubstituted amino acids and amino acid precursors disclosed in the cited references may be employed in synthesis of the peptidomimetic macrocycle precursor polypeptides. For example, the “S5-olefin amino acid” is (S)-α-(2′-pentenyl) alanine and the “R8 olefin amino acid” is (R)-α-(2′-octenyl) alanine. Following incorporation of such amino acids into precursor polypeptides, the terminal olefins are reacted with a metathesis catalyst, leading to the formation of the peptidomimetic macrocycle. In various embodiments, the following amino acids may be employed in the synthesis of the peptidomimetic macrocycle:
  • Figure US20180340009A1-20181129-C00068
  • In some embodiments, x+y+z is 3, and A, B and C are independently natural or non-natural amino acids. In other embodiments, x+y+z is 6, and A, B and C are independently natural or non-natural amino acids.
  • In some embodiments, the contacting step is performed in a solvent selected from the group consisting of protic solvent, aqueous solvent, organic solvent, and mixtures thereof. For example, the solvent may be chosen from the group consisting of H2O, THF, THF/H2O, tBuOH/H2O, DMF, DIPEA, CH3CN or CH2Cl2, ClCH2CH2Cl or a mixture thereof. The solvent may be a solvent which favors helix formation.
  • Alternative but equivalent protecting groups, leaving groups or reagents are substituted, and certain of the synthetic steps are performed in alternative sequences or orders to produce the desired compounds. Synthetic chemistry transformations and protecting group methodologies (protection and deprotection) useful in synthesizing the compounds described herein include, for example, those such as described in Larock, Comprehensive Organic Transformations, VCH Publishers (1989); Greene and Wuts, Protective Groups in Organic Synthesis, 2d. Ed., John Wiley and Sons (1991); Fieser and Fieser, Fieser and Fieser's Reagents for Organic Synthesis, John Wiley and Sons (1994); and Paquette, ed., Encyclopedia of Reagents for Organic Synthesis, John Wiley and Sons (1995), and subsequent editions thereof.
  • The peptidomimetic macrocycles disclosed herein are made, for example, by chemical synthesis methods, such as described in Fields et al., Chapter 3 in Synthetic Peptides: A User's Guide, ed. Grant, W. H. Freeman & Co., New York, N. Y., 1992, p. 77. Hence, for example, peptides are synthesized using the automated Merrifield techniques of solid phase synthesis with the amine protected by either tBoc or Fmoc chemistry using side chain protected amino acids on, for example, an automated peptide synthesizer (e.g., Applied Biosystems (Foster City, Calif.), Model 430A, 431, or 433).
  • One manner of producing the peptidomimetic precursors and peptidomimetic macrocycles described herein uses solid phase peptide synthesis (SPPS). The C-terminal amino acid is attached to a cross-linked polystyrene resin via an acid labile bond with a linker molecule. This resin is insoluble in the solvents used for synthesis, making it relatively simple and fast to wash away excess reagents and by-products. The N-terminus is protected with the Fmoc group, which is stable in acid, but removable by base. Side chain functional groups are protected as necessary with base stable, acid labile groups.
  • Longer peptidomimetic precursors are produced, for example, by conjoining individual synthetic peptides using native chemical ligation. Alternatively, the longer synthetic peptides are biosynthesized by well known recombinant DNA and protein expression techniques. Such techniques are provided in well-known standard manuals with detailed protocols. To construct a gene encoding a peptidomimetic precursor of this invention, the amino acid sequence is reverse translated to obtain a nucleic acid sequence encoding the amino acid sequence, preferably with codons that are optimum for the organism in which the gene is to be expressed. Next, a synthetic gene is made, typically by synthesizing oligonucleotides which encode the peptide and any regulatory elements, if necessary. The synthetic gene is inserted in a suitable cloning vector and transfected into a host cell. The peptide is then expressed under suitable conditions appropriate for the selected expression system and host. The peptide is purified and characterized by standard methods.
  • The peptidomimetic precursors are made, for example, in a high-throughput, combinatorial fashion using, for example, a high-throughput polychannel combinatorial synthesizer (e.g., Thuramed TETRAS multichannel peptide synthesizer from CreoSalus, Louisville, Ky. or Model Apex 396 multichannel peptide synthesizer from AAPPTEC, Inc., Louisville, Ky.).
  • In some embodiments, the peptidomimetic macrocyles of the invention comprise triazole macrocycle-forming linkers. For example, the synthesis of such peptidomimetic macrocycles involves a multi-step process that features the synthesis of a peptidomimetic precursor containing an azide moiety and an alkyne moiety; followed by contacting the peptidomimetic precursor with a macrocyclization reagent to generate a triazole-linked peptidomimetic macrocycle. Such a process is described, for example, in US Application 12/037,041, filed on February 25, 2008. Macrocycles or macrocycle precursors are synthesized, for example, by solution phase or solid-phase methods, and can contain both naturally-occurring and non-naturally-occurring amino acids. See, for example, Hunt, “The Non-Protein Amino Acids” in Chemistry and Biochemistry of the Amino Acids, edited by G. C. Barrett, Chapman and Hall, 1985.
  • In some embodiments, an azide is linked to the α-carbon of a residue and an alkyne is attached to the α-carbon of another residue. In some embodiments, the azide moieties are azido-analogs of amino acids L-lysine, D-lysine, alpha-methyl-L-lysine, alpha-methyl-D-lysine, L-ornithine, D-ornithine, alpha-methyl-L-ornithine or alpha-methyl-D-ornithine. In another embodiment, the alkyne moiety is L-propargylglycine. In yet other embodiments, the alkyne moiety is an amino acid selected from the group consisting of L-propargylglycine, D-propargylglycine, (S)-2-amino-2-methyl-4-pentynoic acid, (R)-2-amino-2-methyl-4-pentynoic acid, (S)-2-amino-2-methyl-5-hexynoic acid, (R)-2-amino-2-methyl-5-hexynoic acid, (S)-2-amino-2-methyl-6-heptynoic acid, (R)-2-amino-2-methyl-6-heptynoic acid, (S)-2-amino-2-methyl-7-octynoic acid, (R)-2-amino-2-methyl-7-octynoic acid, (S)-2-amino-2-methyl-8-nonynoic acid and (R)-2-amino-2-methyl-8-nonynoic acid.
  • The following synthetic schemes are provided solely to illustrate the present invention and are not intended to limit the scope of the invention, as described herein. To simplify the drawings, the illustrative schemes depict azido amino acid analogs ε-azido-α-methyl-L-lysine and ε-azido-α-methyl-D-lysine, and alkyne amino acid analogs L-propargylglycine, (S)-2-amino-2-methyl-4-pentynoic acid, and (S)-2-amino-2-methyl-6-heptynoic acid. Thus, in the following synthetic schemes, each R1, R2, R7 and R8 is —H; each L1 is —(CH2)4—; and each L2 is —(CH2)—. However, as noted throughout the detailed description above, many other amino acid analogs can be employed in which R1, R2, R7, R8, L1 and L2 can be independently selected from the various structures disclosed herein.
  • Figure US20180340009A1-20181129-C00069
    Figure US20180340009A1-20181129-C00070
    Figure US20180340009A1-20181129-C00071
  • Synthetic Scheme 1 describes the preparation of several compounds of the invention. Ni(II) complexes of Schiff bases derived from the chiral auxiliary (S)-2-[N-(N′-benzylprolyl)amino]benzophenone (BPB) and amino acids such as glycine or alanine are prepared as described in Belokon et al. (1998), Tetrahedron Asymm. 9:4249-4252. The resulting complexes are subsequently reacted with alkylating reagents comprising an azido or alkynyl moiety to yield enantiomerically enriched compounds of the invention. If desired, the resulting compounds can be protected for use in peptide synthesis.
  • Figure US20180340009A1-20181129-C00072
  • In the general method for the synthesis of peptidomimetic macrocycles shown in Synthetic Scheme 2, the peptidomimetic precursor contains an azide moiety and an alkyne moiety and is synthesized by solution-phase or solid-phase peptide synthesis (SPPS) using the commercially available amino acid N-α-Fmoc-L-propargylglycine and the N-α-Fmoc-protected forms of the amino acids (S)-2-amino-2-methyl-4-pentynoic acid, (S)-2-amino-6-heptynoic acid, (S)-2-amino-2-methyl-6-heptynoic acid, N-methyl-ε-azido-L-lysine, and N-methyl-ε-azido-D-lysine. The peptidomimetic precursor is then deprotected and cleaved from the solid-phase resin by standard conditions (e.g., strong acid such as 95% TFA). The peptidomimetic precursor is reacted as a crude mixture or is purified prior to reaction with a macrocyclization reagent such as a Cu(I) in organic or aqueous solutions (Rostovtsev et al. (2002), Angew. Chem. Int. Ed. 41:2596-2599; Tornoe et al. (2002), J. Org. Chem. 67:3057-3064; Deiters et al. (2003), J. Am. Chem. Soc. 125:11782-11783; Punna et al. (2005), Angew. Chem. Int. Ed. 44:2215-2220). In one embodiment, the triazole forming reaction is performed under conditions that favor α-helix formation. In one embodiment, the macrocyclization step is performed in a solvent chosen from the group consisting of H2O, THF, CH3CN, DMF , DIPEA, tBuOH or a mixture thereof. In another embodiment, the macrocyclization step is performed in DMF. In some embodiments, the macrocyclization step is performed in a buffered aqueous or partially aqueous solvent.
  • Figure US20180340009A1-20181129-C00073
  • In the general method for the synthesis of peptidomimetic macrocycles shown in Synthetic Scheme 3, the peptidomimetic precursor contains an azide moiety and an alkyne moiety and is synthesized by solid-phase peptide synthesis (SPPS) using the commercially available amino acid N-α-Fmoc-L-propargylglycine and the N-α-Fmoc-protected forms of the amino acids (S)-2-amino-2-methyl-4-pentynoic acid, (S)-2-amino-6-heptynoic acid, (S)-2-amino-2-methyl-6-heptynoic acid, N-methyl-ε-azido-L-lysine, and N-methyl-ε-azido-D-lysine. The peptidomimetic precursor is reacted with a macrocyclization reagent such as a Cu(I) reagent on the resin as a crude mixture (Rostovtsev et al. (2002), Angew. Chem. Int. Ed. 41:2596-2599; Tornoe et al. (2002), J. Org. Chem. 67:3057-3064; Deiters et al. (2003), J. Am. Chem. Soc. 125:11782-11783; Punna et al. (2005), Angew. Chem. Int. Ed. 44:2215-2220). The resultant triazole-containing peptidomimetic macrocycle is then deprotected and cleaved from the solid-phase resin by standard conditions (e.g., strong acid such as 95% TFA). In some embodiments, the macrocyclization step is performed in a solvent chosen from the group consisting of CH2Cl2, ClCH2CH2Cl, DMF, THF, NMP, DIPEA, 2,6-lutidine, pyridine, DMSO, H2O or a mixture thereof. In some embodiments, the macrocyclization step is performed in a buffered aqueous or partially aqueous solvent.
  • Figure US20180340009A1-20181129-C00074
  • In the general method for the synthesis of peptidomimetic macrocycles shown in Synthetic Scheme 4, the peptidomimetic precursor contains an azide moiety and an alkyne moiety and is synthesized by solution-phase or solid-phase peptide synthesis (SPPS) using the commercially available amino acid N-α-Fmoc-L-propargylglycine and the N-α-Fmoc-protected forms of the amino acids (S)-2-amino-2-methyl-4-pentynoic acid, (S)-2-amino-6-heptynoic acid, (S)-2-amino-2-methyl-6-heptynoic acid, N-methyl-ε-azido-L-lysine, and N-methyl-ε-azido-D-lysine. The peptidomimetic precursor is then deprotected and cleaved from the solid-phase resin by standard conditions (e.g., strong acid such as 95% TFA). The peptidomimetic precursor is reacted as a crude mixture or is purified prior to reaction with a macrocyclization reagent such as a Ru(II) reagents, for example Cp*RuCl(PPh3)2 or [Cp*RuCl]4 (Rasmussen et al. (2007), Org. Lett. 9:5337-5339; Zhang et al. (2005), J. Am. Chem. Soc. 127:15998-15999). In some embodiments, the macrocyclization step is performed in a solvent chosen from the group consisting of DMF, CH3CN and THF.
  • Figure US20180340009A1-20181129-C00075
  • In the general method for the synthesis of peptidomimetic macrocycles shown in Synthetic Scheme 5, the peptidomimetic precursor contains an azide moiety and an alkyne moiety and is synthesized by solid-phase peptide synthesis (SPPS) using the commercially available amino acidN-α-Fmoc-L-propargylglycine and the N-α-Fmoc-protected forms of the amino acids (S)-2-amino-2-methyl-4-pentynoic acid, (S)-2-amino-6-heptynoic acid, (S)-2-amino-2-methyl-6-heptynoic acid, N-methyl-ε-azido-L-lysine, and N-methyl-ε-azido-D-lysine. The peptidomimetic precursor is reacted with a macrocyclization reagent such as a Ru(II) reagent on the resin as a crude mixture. For example, the reagent can be Cp*RuCl(PPh3)2 or [Cp*RuCl]4 (Rasmussen et al. (2007), Org. Lett. 9:5337-5339; Zhang et al. (2005), J. Am. Chem. Soc. 127:15998-15999). In some embodiments, the macrocyclization step is performed in a solvent chosen from the group consisting of CH2Cl2, ClCH2CH2Cl, CH3CN, DMF, and THF.
  • In some embodiments, a peptidomimetic macrocycle of Formula I comprises a halogen group substitution on a triazole moiety, for example an iodo substitution. Such peptidomimetic macrocycles may be prepared from a precursor having the partial structure and using the cross-linking methods taught herein. Crosslinkers of any length, as described herein, may be prepared comprising such substitutions. In one embodiment, the peptidomimetic macrocycle is prepared according to the scheme shown below. The reaction is peformed, for example, in the presence of CuI and an amine ligand such as TEA or TTTA. See, e.g., Hein et al. Angew. Chem., Int. Ed. 2009, 48, 8018-8021.
  • Figure US20180340009A1-20181129-C00076
  • In other embodiments, an iodo-substituted triazole is generated according to the scheme shown below. For example, the second step in the reaction scheme below is performed using, for example, CuI and N-bromosuccinimide (NBS) in the presence of THF (see, e.g. Zhang et al., J. Org. Chem. 2008, 73, 3630-3633). In other embodiments, the second step in the reaction scheme shown below is performed, for example, using CuI and an iodinating agent such as ICl (see, e.g. Wu et al., Synthesis 2005, 1314-1318.)
  • Figure US20180340009A1-20181129-C00077
  • In some embodiments, an iodo-substituted triazole moiety is used in a cross-coupling reaction, such as a Suzuki or Sonogashira coupling, to afford a peptidomimetic macrocycle comprising a substituted crosslinker. Sonogashira couplings using an alkyne as shown below may be performed, for example, in the presence of a palladium catalyst such as Pd(PPh3)2Cl2, CuI, and in the presence of a base such as triethylamine. Suzuki couplings using an arylboronic or substituted alkenyl boronic acid as shown below may be performed, for example, in the presence of a catalyst such as Pd(PPh3)4, and in the presence of a base such as K2CO3.
  • Figure US20180340009A1-20181129-C00078
  • Any suitable triazole substituent groups which reacts with the iodo-substituted triazole can be used in Suzuki couplings described herein. Example triazole substituents for use in Suzuki couplings are shown below:
  • Figure US20180340009A1-20181129-C00079
  • wherein “Cyc” is a suitable aryl, cycloalkyl, cycloalkenyl, heteroaryl, or heterocyclyl group, unsubstituted or optionally substituted with an Ra or Rb group as described below.
  • In some embodiments, the substituent is:
  • Figure US20180340009A1-20181129-C00080
  • Any suitable substituent group which reacts with the iodo-substituted triazole can be used in Sonogashira couplings described herein. Example triazole substituents for use in Sonogashira couplings are shown below:
  • Figure US20180340009A1-20181129-C00081
  • wherein “Cyc” is a suitable aryl, cycloalkyl, cycloalkenyl, heteroaryl, or heterocyclyl group, unsubstituted or optionally substituted with an Ra or Rb group as described below.
  • In some embodiments, the triazole substituent is:
  • Figure US20180340009A1-20181129-C00082
  • In some embodiments, the Cyc group shown above is further substituted by at least one Ra or Rb substituent. In some embodiments, at least one of Ra and Rb is independently:
  • Figure US20180340009A1-20181129-C00083
  • In other embodiments, the triazole substituent is
  • Figure US20180340009A1-20181129-C00084
  • and at least one of Ra and Rb is alkyl (including hydrogen, methyl, or ethyl), or:
  • Figure US20180340009A1-20181129-C00085
  • The present invention contemplates the use of non-naturally-occurring amino acids and
  • The present invention contemplates the use of non-naturally-occurring amino acids and amino acid analogs in the synthesis of the peptidomimetic macrocycles described herein. Any amino acid or amino acid analog amenable to the synthetic methods employed for the synthesis of stable triazole containing peptidomimetic macrocycles can be used in the present invention. For example, L-propargylglycine is contemplated as a useful amino acid in the present invention. However, other alkyne-containing amino acids that contain a different amino acid side chain are also useful in the invention. For example, L-propargylglycine contains one methylene unit between the α-carbon of the amino acid and the alkyne of the amino acid side chain. The invention also contemplates the use of amino acids with multiple methylene units between the α-carbon and the alkyne. Also, the azido-analogs of amino acids L-lysine, D-lysine, alpha-methyl-L-lysine, and alpha-methyl-D-lysine are contemplated as useful amino acids in the present invention. However, other terminal azide amino acids that contain a different amino acid side chain are also useful in the invention. For example, the azido-analog of L-lysine contains four methylene units between the α-carbon of the amino acid and the terminal azide of the amino acid side chain. The invention also contemplates the use of amino acids with fewer than or greater than four methylene units between the α-carbon and the terminal azide. Table 2 shows some amino acids useful in the preparation of peptidomimetic macrocycles disclosed herein.
  • TABLE 2
    Figure US20180340009A1-20181129-C00086
    Figure US20180340009A1-20181129-C00087
    Figure US20180340009A1-20181129-C00088
    Figure US20180340009A1-20181129-C00089
    Figure US20180340009A1-20181129-C00090
    Figure US20180340009A1-20181129-C00091
    Figure US20180340009A1-20181129-C00092
    Figure US20180340009A1-20181129-C00093
    Figure US20180340009A1-20181129-C00094
    Figure US20180340009A1-20181129-C00095
    Figure US20180340009A1-20181129-C00096
  • In some embodiments the amino acids and amino acid analogs are of the D-configuration. In other embodiments they are of the L-configuration. In some embodiments, some of the amino acids and amino acid analogs contained in the peptidomimetic are of the D-configuration while some of the amino acids and amino acid analogs are of the L-configuration. In some embodiments the amino acid analogs are α,α-disubstituted, such as α-methyl-L-propargylglycine, α-methyl-D-propargylglycine, ε-azido-alpha-methyl-L-lysine, and ε-azido-alpha-methyl-D-lysine. In some embodiments the amino acid analogs are N-alkylated, e.g., N-methyl-L-propargylglycine, N-methyl-D-propargylglycine, N-methyl-ε-azido-L-lysine, and N-methyl-ε-azido-D-lysine.
  • In some embodiments, the —NH moiety of the amino acid is protected using a protecting group, including without limitation -Fmoc and -Boc. In other embodiments, the amino acid is not protected prior to synthesis of the peptidomimetic macrocycle.
  • In some embodiments, the —NH moiety of the amino acid is protected using a protecting group, including without limitation -Fmoc and -Boc. In other embodiments, the amino acid is not protected prior to synthesis of the peptidomimetic macrocycle.
  • The preparation of macrocycles of Formula IV is described, for example, in U.S. application Ser. No. 11/957,325, filed on Dec. 17, 2007 and herein incorporated by reference. Synthetic Schemes 6-9 describe the preparation of such compounds of Formula IV. To simplify the drawings, the illustrative schemes depict amino acid analogs derived from L-or D-cysteine, in which L1 and L3 are both —(CH2)—. However, as noted throughout the detailed description above, many other amino acid analogs can be employed in which L1 and L3 can be independently selected from the various structures disclosed herein. The symbols “[AA]m”, “[AA]n”, “[AA]o” represent a sequence of amide bond-linked moieties such as natural or unnatural amino acids. As described previously, each occurrence of “AA” is independent of any other occurrence of “AA”, and a formula such as “[AA]m” encompasses, for example, sequences of non-identical amino acids as well as sequences of identical amino acids.
  • Figure US20180340009A1-20181129-C00097
  • In Scheme 6, the peptidomimetic precursor contains two —SH moieties and is synthesized by solid-phase peptide synthesis (SPPS) using commercially available N-α-Fmoc amino acids such as N-α-Fmoc-S-trityl-L-cysteine or N-α-Fmoc-S-trityl-D-cysteine. Alpha-methylated versions of D-cysteine or L-cysteine are generated by known methods (Seebach et al. (1996), Angew. Chem. Int. Ed. Engl. 35:2708-2748, and references therein) and then converted to the appropriately protected N-α-Fmoc-S-trityl monomers by known methods (“Bioorganic Chemistry: Peptides and Proteins”, Oxford University Press, New York: 1998, the entire contents of which are incorporated herein by reference). The precursor peptidomimetic is then deprotected and cleaved from the solid-phase resin by standard conditions (e.g., strong acid such as 95% TFA). The precursor peptidomimetic is reacted as a crude mixture or is purified prior to reaction with X-L2-Y in organic or aqueous solutions. In some embodiments the alkylation reaction is performed under dilute conditions (i.e. 0.15 mmol/L) to favor macrocyclization and to avoid polymerization. In some embodiments, the alkylation reaction is performed in organic solutions such as liquid NH3 (Mosberg et al. (1985), J. Am.Chem. Soc. 107:2986-2987; Szewczuk et al. (1992), Int. J. Peptide Protein Res. 40 :233-242), NH3/MeOH, or NH3/DMF (Or et al. (1991), J. Org. Chem. 56:3146-3149). In other embodiments, the alkylation is performed in an aqueous solution such as 6M guanidinium HCL, pH 8 (Brunel et al. (2005), Chem. Commun. (20):2552-2554). In other embodiments, the solvent used for the alkylation reaction is DMF or dichloroethane.
  • Figure US20180340009A1-20181129-C00098
  • In Scheme 7, the precursor peptidomimetic contains two or more —SH moieties, of which two are specially protected to allow their selective deprotection and subsequent alkylation for macrocycle formation. The precursor peptidomimetic is synthesized by solid-phase peptide synthesis (SPPS) using commercially available N-α-Fmoc amino acids such as N-α-Fmoc-S-p-methoxytrityl-L-cysteine or N-α-Fmoc-S-p-methoxytrityl-D-cysteine. Alpha-methylated versions of D-cysteine or L-cysteine are generated by known methods (Seebach et al. (1996), Angew. Chem. Int. Ed. Engl. 35:2708-2748, and references therein) and then converted to the appropriately protected N-α-Fmoc-S-p-methoxytrityl monomers by known methods (Bioorganic Chemistry: Peptides and Proteins, Oxford University Press, New York: 1998, the entire contents of which are incorporated herein by reference). The Mmt protecting groups of the peptidomimetic precursor are then selectively cleaved by standard conditions (e.g., mild acid such as 1% TFA in DCM). The precursor peptidomimetic is then reacted on the resin with X-L2-Y in an organic solution. For example, the reaction takes place in the presence of a hindered base such as diisopropylethylamine. In some embodiments, the alkylation reaction is performed in organic solutions such as liquid NH3 (Mosberg et al. (1985), J. Am. Chem. Soc. 107:2986-2987; Szewczuk et al. (1992), Int. J. Peptide Protein Res. 40 :233-242), NH3/MeOH or NH3/DMF (Or et al. (1991), J. Org. Chem. 56:3146-3149). In other embodiments, the alkylation reaction is performed in DMF or dichloroethane. The peptidomimetic macrocycle is then deprotected and cleaved from the solid-phase resin by standard conditions (e.g., strong acid such as 95% TFA).
  • Figure US20180340009A1-20181129-C00099
  • In Scheme 8, the peptidomimetic precursor contains two or more —SH moieties, of which two are specially protected to allow their selective deprotection and subsequent alkylation for macrocycle formation. The peptidomimetic precursor is synthesized by solid-phase peptide synthesis (SPPS) using commercially available N-α-Fmoc amino acids such as N-α-Fmoc-S-p-methoxytrityl-L-cysteine, N-α-Fmoc-S-p-methoxytrityl-D-cysteine, N-α-Fmoc-S-S-t-butyl-L-cysteine, and N-α-Fmoc-S-S-t-butyl-D-cysteine. Alpha-methylated versions of D-cysteine or L-cysteine are generated by known methods (Seebach et al. (1996), Angew. Chem. Int. Ed. Engl. 35:2708-2748, and references therein) and then converted to the appropriately protected N-α-Fmoc-S-p-methoxytrityl or N-α-Fmoc-S-S-t-butyl monomers by known methods (Bioorganic Chemistry: Peptides and Proteins, Oxford University Press, New York: 1998, the entire contents of which are incorporated herein by reference). The S-S-tButyl protecting group of the peptidomimetic precursor is selectively cleaved by known conditions (e.g., 20% 2-mercaptoethanol in DMF, reference: Galande et al. (2005), J. Comb. Chem. 7:174-177). The precursor peptidomimetic is then reacted on the resin with a molar excess of X-L2-Y in an organic solution. For example, the reaction takes place in the presence of a hindered base such as diisopropylethylamine. The Mmt protecting group of the peptidomimetic precursor is then selectively cleaved by standard conditions (e.g., mild acid such as 1% TFA in DCM). The peptidomimetic precursor is then cyclized on the resin by treatment with a hindered base in organic solutions. In some embodiments, the alkylation reaction is performed in organic solutions such as NH3/MeOH or NH3/DMF (Or et al. (1991), J. Org. Chem. 56:3146-3149). The peptidomimetic macrocycle is then deprotected and cleaved from the solid-phase resin by standard conditions (e.g., strong acid such as 95% TFA).
  • Figure US20180340009A1-20181129-C00100
  • In Scheme 9, the peptidomimetic precursor contains two L-cysteine moieties. The peptidomimetic precursor is synthesized by known biological expression systems in living cells or by known in vitro, cell-free, expression methods. The precursor peptidomimetic is reacted as a crude mixture or is purified prior to reaction with X-L2-Y in organic or aqueous solutions. In some embodiments the alkylation reaction is performed under dilute conditions (i.e. 0.15 mmol/L) to favor macrocyclization and to avoid polymerization. In some embodiments, the alkylation reaction is performed in organic solutions such as liquid NH3 (Mosberg et al. (1985), J. Am.Chem. Soc. 107:2986-2987; Szewczuk et al. (1992), Int. J. Peptide Protein Res. 40 :233-242), NH3/MeOH, or NH3/DMF (Or et al. (1991), J. Org. Chem. 56:3146-3149). In other embodiments, the alkylation is performed in an aqueous solution such as 6M guanidinium HCL, pH 8 (Brunel et al. (2005), Chem. Commun. (20):2552-2554). In other embodiments, the alkylation is performed in DMF or dichloroethane. In another embodiment, the alkylation is performed in non-denaturing aqueous solutions, and in yet another embodiment the alkylation is performed under conditions that favor α-helical structure formation. In yet another embodiment, the alkylation is performed under conditions that favor the binding of the precursor peptidomimetic to another protein, so as to induce the formation of the bound α-helical conformation during the alkylation.
  • Various embodiments for X and Y are envisioned which are suitable for reacting with thiol groups. In general, each X or Y is independently be selected from the general category shown in Table 3. For example, X and Y are halides such as —Cl, —Br or —I. Any of the macrocycle-forming linkers described herein may be used in any combination with any of the sequences shown and also with any of the R— substituents indicated herein.
  • TABLE 3
    Examples of Reactive Groups Capable of Reacting
    with Thiol Groups and Resulting Linkages
    Resulting Covalent
    X or Y Linkage
    acrylamide Thioether
    halide (e.g. alkyl or aryl halide) Thioether
    sulfonate Thioether
    aziridine Thioether
    epoxide Thioether
    haloacetamide Thioether
    maleimide Thioether
    sulfonate ester Thioether
  • The present invention contemplates the use of both naturally occurring and non-naturally-occurring amino acids and amino acid analogs in the synthesis of the peptidomimetic macrocycles of Formula IV. Any amino acid or amino acid analog amenable to the synthetic methods employed for the synthesis of stable bis-sulfhydryl containing peptidomimetic macrocycles can be used in the present invention. For example, cysteine is contemplated as a useful amino acid in the present invention. However, sulfur containing amino acids other than cysteine that contain a different amino acid side chain are also useful. For example, cysteine contains one methylene unit between the α-carbon of the amino acid and the terminal —SH of the amino acid side chain. The invention also contemplates the use of amino acids with multiple methylene units between the α-carbon and the terminal —SH. Non-limiting examples include α-methyl-L-homocysteine and α-methyl-D-homocysteine. In some embodiments the amino acids and amino acid analogs are of the D-configuration. In other embodiments they are of the L-configuration. In some embodiments, some of the amino acids and amino acid analogs contained in the peptidomimetic are of the D-configuration while some of the amino acids and amino acid analogs are of the L-configuration. In some embodiments the amino acid analogs are α,α-disubstituted, such as α-methyl-L-cysteine and α-methyl-D-cysteine.
  • The invention includes macrocycles in which macrocycle-forming linkers are used to link two or more —SH moieties in the peptidomimetic precursors to form the peptidomimetic macrocycles disclosed herein. As described above, the macrocycle-forming linkers impart conformational rigidity, increased metabolic stability or increased cell penetrability. Furthermore, in some embodiments, the macrocycle-forming linkages stabilize the α-helical secondary structure of the peptidomimetic macrocyles. The macrocycle-forming linkers are of the formula X-L2-Y, wherein both X and Y are the same or different moieties, as defined above. Both X and Y have the chemical characteristics that allow one macrocycle-forming linker -L2- to bis alkylate the bis-sulfhydryl containing peptidomimetic precursor. As defined above, the linker -L2- includes alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, cycloarylene, or heterocycloarylene, or —R4—K—R4—, all of which can be optionally substituted with an R5 group, as defined above. Furthermore, one to three carbon atoms within the macrocycle-forming linkers -L2-, other than the carbons attached to the —SH of the sulfhydryl containing amino acid, are optionally substituted with a heteroatom such as N, S or O.
  • The L2 component of the macrocycle-forming linker X-L2-Y may be varied in length depending on, among other things, the distance between the positions of the two amino acid analogs used to form the peptidomimetic macrocycle. Furthermore, as the lengths of L1 or L3 components of the macrocycle-forming linker are varied, the length of L2 can also be varied in order to create a linker of appropriate overall length for forming a stable peptidomimetic macrocycle. For example, if the amino acid analogs used are varied by adding an additional methylene unit to each of L1 and L3, the length of L2 are decreased in length by the equivalent of approximately two methylene units to compensate for the increased lengths of L1 and L3.
  • In some embodiments, L2 is an alkylene group of the formula —(CH2)n—, where n is an integer between about 1 and about 15. For example, n is 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10. In other embodiments, L2 is an alkenylene group. In still other embodiments, L2 is an aryl group.
  • Table 4 shows additional embodiments of X-L2-Y groups.
  • TABLE 4
    Exemplary X—L2—Y groups.
    Figure US20180340009A1-20181129-C00101
    Figure US20180340009A1-20181129-C00102
    Figure US20180340009A1-20181129-C00103
    Figure US20180340009A1-20181129-C00104
    Figure US20180340009A1-20181129-C00105
    Figure US20180340009A1-20181129-C00106
    Figure US20180340009A1-20181129-C00107
    Figure US20180340009A1-20181129-C00108
    Figure US20180340009A1-20181129-C00109
    Figure US20180340009A1-20181129-C00110
    Figure US20180340009A1-20181129-C00111
    Figure US20180340009A1-20181129-C00112
    Figure US20180340009A1-20181129-C00113
    Figure US20180340009A1-20181129-C00114
    Figure US20180340009A1-20181129-C00115
    Figure US20180340009A1-20181129-C00116
    Figure US20180340009A1-20181129-C00117
    Figure US20180340009A1-20181129-C00118
    Figure US20180340009A1-20181129-C00119
    Figure US20180340009A1-20181129-C00120
    Figure US20180340009A1-20181129-C00121
    Figure US20180340009A1-20181129-C00122
    Figure US20180340009A1-20181129-C00123
    Figure US20180340009A1-20181129-C00124
    Figure US20180340009A1-20181129-C00125
    Figure US20180340009A1-20181129-C00126
    Figure US20180340009A1-20181129-C00127
    Figure US20180340009A1-20181129-C00128
    Figure US20180340009A1-20181129-C00129
    Figure US20180340009A1-20181129-C00130
    Figure US20180340009A1-20181129-C00131
    Figure US20180340009A1-20181129-C00132
    Figure US20180340009A1-20181129-C00133
    Figure US20180340009A1-20181129-C00134
    Each X and Y in this Table, is, for example, independently Cl—, Br— or I—.
  • Additional methods of forming peptidomimetic macrocycles which are envisioned as suitable to perform the present invention include those disclosed by Mustapa, M. Firouz Mohd et al., J. Org. Chem (2003), 68, pp. 8193-8198; Yang, Bin et al. Bioorg Med. Chem. Lett. (2004), 14, pp. 1403-1406; U.S. Pat. No. 5,364,851; U.S. Pat. No. 5,446,128; U.S. Pat. No. 5,824,483; U.S. Pat. No. 6,713,280; and U.S. Pat. No. 7,202,332. In such embodiments, amino acid precursors are used containing an additional substituent R— at the alpha position. Such amino acids are incorporated into the macrocycle precursor at the desired positions, which may be at the positions where the crosslinker is substituted or, alternatively, elsewhere in the sequence of the macrocycle precursor. Cyclization of the precursor is then performed according to the indicated method.
  • For example, a peptidomimetic macrocycle of Formula (II) is prepared as indicated:
  • Figure US20180340009A1-20181129-C00135
  • wherein each AA1, AA2, AA3 is independently an amino acid side chain.
  • In other embodiments, a peptidomimetic macrocycle of Formula (II) is prepared as indicated:
  • Figure US20180340009A1-20181129-C00136
  • wherein each AA1, AA2, AA3 is independently an amino acid side chain.
  • In some embodiments, a peptidomimetic macrocycle is obtained in more than one isomer, for example due to the configuration of a double bond within the structure of the crosslinker (E vs Z). Such isomers can or can not be separable by conventional chromatographic methods. In some embodiments, one isomer has improved biological properties relative to the other isomer. In one embodiment, an E crosslinker olefin isomer of a peptidomimetic macrocycle has better solubility, better target affinity, better in vivo or in vitro efficacy, higher helicity, or improved cell permeability relative to its Z counterpart. In another embodiment, a Z crosslinker olefin isomer of a peptidomimetic macrocycle has better solubility, better target affinity, better in vivo or in vitro efficacy, higher helicity, or improved cell permeability relative to its E counterpart.
  • A compound described herein can be at least 1% pure, at least 2% pure, at least 3% pure, at least 4% pure, at least 5% pure, at least 6% pure, at least 7% pure, at least 8% pure, at least 9% pure, at least 10% pure, at least 11% pure, at least 12% pure, at least 13% pure, at least 14% pure, at least 15% pure, at least 16% pure, at least 17% pure, at least 18% pure, at least 19% pure, at least 20% pure, at least 21% pure, at least 22% pure, at least 23% pure, at least 24% pure, at least 25% pure, at least 26% pure, at least 27% pure, at least 28% pure, at least 29% pure, at least 30% pure, at least 31% pure, at least 32% pure, at least 33% pure, at least 34% pure, at least 35% pure, at least 36% pure, at least 37% pure, at least 38% pure, at least 39% pure, at least 40% pure, at least 41% pure, at least 42% pure, at least 43% pure, at least 44% pure, at least 45% pure, at least 46% pure, at least 47% pure, at least 48% pure, at least 49% pure, at least 50% pure, at least 51% pure, at least 52% pure, at least 53% pure, at least 54% pure, at least 55% pure, at least 56% pure, at least 57% pure, at least 58% pure, at least 59% pure, at least 60% pure, at least 61% pure, at least 62% pure, at least 63% pure, at least 64% pure, at least 65% pure, at least 66% pure, at least 67% pure, at least 68% pure, at least 69% pure, at least 70% pure, at least 71% pure, at least 72% pure, at least 73% pure, at least 74% pure, at least 75% pure, at least 76% pure, at least 77% pure, at least 78% pure, at least 79% pure, at least 80% pure, at least 81% pure, at least 82% pure, at least 83% pure, at least 84% pure, at least 85% pure, at least 86% pure, at least 87% pure, at least 88% pure, at least 89% pure, at least 90% pure, at least 91% pure, at least 92% pure, at least 93% pure, at least 94% pure, at least 95% pure, at least 96% pure, at least 97% pure, at least 98% pure, at least 99% pure, at least 99.1% pure, at least 99.2% pure, at least 99.3% pure, at least 99.4% pure, at least 99.5% pure, at least 99.6% pure, at least 99.7% pure, at least 99.8% pure, or at least 99.9% pure on a chemical, optical, isomeric, enantiomeric, or diastereomeric basis. Purity can be assessed, for example, by HPLC, MS, LC/MS, melting point, or NMR.
    • Assays
  • The properties of the peptidomimetic macrocycles of the invention are assayed, for example, by using the methods described below. In some embodiments, a peptidomimetic macrocycle of the invention has improved biological properties relative to a corresponding polypeptide lacking the substituents described herein.
  • In some embodiments, a peptidomimetic macrocycle disclosed herein binds MCL-1 selectively over another protein that has a BH3 domain. In some embodiments, the selectivity is a ratio of about 2 to about 1, about 3 to about 1, about 4 to about 1, about 5 to about 1, about 6 to about 1, about 7 to about 1, about 8 to about 1, about 9 to about 1, about 10 to about 1, about 20 to about 1, about 30 to about 1, about 40 to about 1, about 50 to about 1, about 60 to about 1, about 70 to about 1, about 80 to about 1, about 90 to about 1, about 100 to about 1, about 200 to about 1, about 300 to about 1, about 400 to about 1, about 500 to about 1, about 600 to about 1, about 700 to about 1, about 800 to about 1, about 900 to about 1, or about 1000 to about 1.
  • In some embodiments, a peptidomimetic macrocycle disclosed herein non-selectively binds additional types of proteins that have a BH3 domain. In some embodiments, the non-selectivity is at least about 2 types of proteins, at least about 3 types of proteins, at least about 4 types of proteins, at least about 5 types of proteins, at least about 6 types of proteins, at least about 7 types of proteins, at least about 8 types of proteins, at least about 9 types of proteins, at least about 10 types of proteins, at least about 11 types of protein, at least about 12 types of proteins, at least about 13 types of proteins, at least about 14 types of proteins, at least about 15 types of proteins, at least about 16 types of proteins, at least about 17 types of proteins, at least about 18 types of proteins, at least about 19 types of proteins, or at least about 20 types of proteins. In some embodiments, the non-selectivity is from about 2 types of protein to about 3 types of protein, from about 3 types of protein to about 4 types of protein, from about 4 types of protein to about 5 types of protein, from about 5 types of protein to about 6 types of protein, from about 6 types of protein to about 7 types of protein, from about 7 types of protein to about 8 types of protein, from about 8 types of protein to about 9 types of protein, from about 9 types of protein to about 10 types of protein, from about 10 types of protein to about 11 types of protein, from about 11 types of protein to about 12 types of protein, from about 12 types of protein to about 13 types of protein, from about 13 types of protein to about 14 types of protein, from about 14 types of protein to about 15 types of protein, from about 15 types of protein to about 16 types of protein, from about 16 types of protein to about 17 types of protein, from about 17 types of protein to about 18 types of protein, from about 18 types of protein to about 19 types of protein, or from about 19 types of protein to about 20 types of protein.
    • Assay to Determine α-Helicity.
  • In solution, the secondary structure of polypeptides with α-helical domains will reach a dynamic equilibrium between random coil structures and α-helical structures, often expressed as a “percent helicity”. Thus, for example, alpha-helical domains are predominantly random coils in solution, with α-helical content usually under 25%. Peptidomimetic macrocycles with optimized linkers, on the other hand, possess, for example, an alpha-helicity that is at least two-fold greater than that of a corresponding uncrosslinked polypeptide. In some embodiments, macrocycles of the invention will possess an alpha-helicity of greater than 50%. To assay the helicity of peptidomimetic macrocyles of the invention, the compounds are dissolved in an aqueous solution (e.g. 50 mM potassium phosphate solution at pH 7, or distilled H2O, to concentrations of 25-50 μM). Circular dichroism (CD) spectra are obtained on a spectropolarimeter (e.g., Jasco J-710) using standard measurement parameters (e.g. temperature, 20° C.; wavelength, 190-260 nm; step resolution, 0.5 nm; speed, 20 nm/sec; accumulations, 10; response, 1 sec; bandwidth, 1 nm; path length, 0.1 cm). The α-helical content of each peptide is calculated by dividing the mean residue ellipticity (e.g. [Φ]222obs) by the reported value for a model helical decapeptide (Yang et al. (1986), Methods Enzymol. 130:208)).
    • Assay to Determine Melting Temperature (Tm).
  • A peptidomimetic macrocycle of the invention comprising a secondary structure such as an α-helix exhibits, for example, a higher melting temperature than a corresponding uncrosslinked polypeptide. Typically peptidomimetic macrocycles of the invention exhibit Tm of >60° C. representing a highly stable structure in aqueous solutions. To assay the effect of macrocycle formation on melting temperature, peptidomimetic macrocycles or unmodified peptides are dissolved in distilled H2 2O (e.g. at a final concentration of 50 μM) and the Tm is determined by measuring the change in ellipticity over a temperature range (e.g. 4 to 95° C.) on a spectropolarimeter (e.g., Jasco J-710) using standard parameters (e.g. wavelength 222 nm; step resolution, 0.5 nm; speed, 20 nm/sec; accumulations, 10; response, 1 sec; bandwidth, 1 nm; temperature increase rate: 1° C./min; path length, 0.1 cm).
    • Protease Resistance Assay.
  • The amide bond of the peptide backbone is susceptible to hydrolysis by proteases, thereby rendering peptidic compounds vulnerable to rapid degradation in vivo. Peptide helix formation, however, typically buries the amide backbone and therefore may shield it from proteolytic cleavage. The peptidomimetic macrocycles of the present invention may be subjected to in vitro trypsin proteolysis to assess for any change in degradation rate compared to a corresponding uncrosslinked polypeptide. For example, the peptidomimetic macrocycle and a corresponding uncrosslinked polypeptide are incubated with trypsin agarose and the reactions quenched at various time points by centrifugation and subsequent HPLC injection to quantitate the residual substrate by ultraviolet absorption at 280 nm. Briefly, the peptidomimetic macrocycle and peptidomimetic precursor (5 mcg) are incubated with trypsin agarose (Pierce) (S/E˜125) for 0, 10, 20, 90, and 180 minutes. Reactions are quenched by tabletop centrifugation at high speed; remaining substrate in the isolated supernatant is quantified by HPLC-based peak detection at 280 nm. The proteolytic reaction displays first order kinetics and the rate constant, k, is determined from a plot of ln[S] versus time (k=−1×slope).
  • Ex Vivo Stability Assay.
  • Peptidomimetic macrocycles with optimized linkers possess, for example, an ex vivo half-life that is at least two-fold greater than that of a corresponding uncrosslinked polypeptide, and possess an ex vivo half-life of 12 hours or more. For ex vivo serum stability studies, a variety of assays may be used. For example, a peptidomimetic macrocycle and a corresponding uncrosslinked polypeptide (2 mcg) are incubated with fresh mouse, rat or human serum (2 mL) at 37° C. for 0, 1, 2, 4, 8, and 24 hours. To determine the level of intact compound, the following procedure may be used: The samples are extracted by transferring 100 μl of sera to 2 ml centrifuge tubes followed by the addition of 10 μL of 50% formic acid and 500 μL acetonitrile and centrifugation at 14,000 RPM for 10 min at 4±2° C. The supernatants are then transferred to fresh 2 ml tubes and evaporated on Turbovap under N2<10 psi, 37° C. The samples are reconstituted in 100 μL of 50:50 acetonitrile:water and submitted to LC-MS/MS analysis.
  • In vitro Binding Assays.
  • To assess the binding and affinity of peptidomimetic macrocycles and peptidomimetic precursors to acceptor proteins, a fluorescence polarization assay (FPA) isused, for example. The FPA technique measures the molecular orientation and mobility using polarized light and fluorescent tracer. When excited with polarized light, fluorescent tracers (e.g., FITC) attached to molecules with high apparent molecular weights (e.g. FITC-labeled peptides bound to a large protein) emit higher levels of polarized fluorescence due to their slower rates of rotation as compared to fluorescent tracers attached to smaller molecules (e.g. FITC-labeled peptides that are free in solution).
  • For example, fluoresceinated peptidomimetic macrocycles (25 nM) are incubated with the acceptor protein (25-1000 nM) in binding buffer (140 mM NaCl, 50 mM Tris-HCL, pH 7.4) for 30 minutes at room temperature. Binding activity is measured, for example, by fluorescence polarization on a luminescence spectrophotometer (e.g. Perkin-Elmer LS50B). Kd values may be determined by nonlinear regression analysis using, for example, Graphpad Prism software (GraphPad Software, Inc., San Diego, Calif.). A peptidomimetic macrocycle of the invention shows, in some instances, similar or lower Kd than a corresponding uncrosslinked polypeptide.
  • In vitro Displacement Assays to Characterize Antagonists of Peptide-Protein Interactions.
  • To assess the binding and affinity of compounds that antagonize the interaction between a peptide and an acceptor protein, a fluorescence polarization assay (FPA) utilizing a fluoresceinated peptidomimetic macrocycle derived from a peptidomimetic precursor sequence is used, for example. The FPA technique measures the molecular orientation and mobility using polarized light and fluorescent tracer. When excited with polarized light, fluorescent tracers (e.g., FITC) attached to molecules with high apparent molecular weights (e.g. FITC-labeled peptides bound to a large protein) emit higher levels of polarized fluorescence due to their slower rates of rotation as compared to fluorescent tracers attached to smaller molecules (e.g. FITC-labeled peptides that are free in solution). A compound that antagonizes the interaction between the fluoresceinated peptidomimetic macrocycle and an acceptor protein will be detected in a competitive binding FPA experiment.
  • For example, putative antagonist compounds (1 nM to 1 mM) and a fluoresceinated peptidomimetic macrocycle (25 nM) are incubated with the acceptor protein (50 nM) in binding buffer (140mM NaCl, 50 mM Tris-HCL, pH 7.4) for 30 minutes at room temperature. Antagonist binding activity is measured, for example, by fluorescence polarization on a luminescence spectrophotometer (e.g. Perkin-Elmer LS50B). Kd values may be determined by nonlinear regression analysis using, for example, Graphpad Prism software (GraphPad Software, Inc., San Diego, Calif.).
  • Any class of molecule, such as small organic molecules, peptides, oligonucleotides or proteins can be examined as putative antagonists in this assay.
    • Assay for Protein-Ligand Binding by Affinity Selection-Mass Spectrometry.
  • To assess the binding and affinity of test compounds for proteins, an affinity-selection mass spectrometry assay is used, for example. Protein-ligand binding experiments are conducted according to the following representative procedure outlined for a system-wide control experiment using 1 μM peptidomimetic macrocycle plus 5 μM target protein. A 1 μL DMSO aliquot of a 40 μM stock solution of peptidomimetic macrocycle is dissolved in 19 μL of PBS (Phosphate-buffered saline: 50 mM, pH 7.5 Phosphate buffer containing 150 mM NaCl). The resulting solution is mixed by repeated pipetting and clarified by centrifugation at 10 000 g for 10 min. To a 4 μL aliquot of the resulting supernatant is added 4 μL of 10 μM target protein in PBS. Each 8.0 μL experimental sample thus contains 40 pmol (1.5 μg) of protein at 5.0 μM concentration in PBS plus 1 μM peptidomimetic macrocycle and 2.5% DMSO. Duplicate samples thus prepared for each concentration point are incubated for 60 min at room temperature, and then chilled to 4° C. prior to size-exclusion chromatography-LC-MS analysis of 5.0 μL injections. Samples containing a target protein, protein-ligand complexes, and unbound compounds are injected onto an SEC column, where the complexes are separated from non-binding component by a rapid SEC step. The SEC column eluate is monitored using UV detectors to confirm that the early-eluting protein fraction, which elutes in the void volume of the SEC column, is well resolved from unbound components that are retained on the column. After the peak containing the protein and protein-ligand complexes elutes from the primary UV detector, it enters a sample loop where it is excised from the flow stream of the SEC stage and transferred directly to the LC-MS via a valving mechanism. The (M+3H)3+ ion of the peptidomimetic macrocycle is observed by ESI-MS at the expected m/z, confirming the detection of the protein-ligand complex.
    • Assay for Protein-Ligand Kd Titration Experiments.
  • To assess the binding and affinity of test compounds for proteins, a protein-ligand Kd titration experiment is performed. Protein-ligand Kd titrations experiments are conducted as follows: 2 μL DMSO aliquots of a serially diluted stock solution of titrant peptidomimetic macrocycle (5, 2.5, . . . , 0.098 mM) are prepared then dissolved in 38 μL of PBS. The resulting solutions are mixed by repeated pipetting and clarified by centrifugation at 10 000 g for 10 min. To 4.0 μL aliquots of the resulting supernatants is added 4.0 μL of 10 μM target protein in PBS. Each 8.0 μL experimental sample thus contains 40 pmol (1.5 μg) of protein at 5.0 μM concentration in PBS, varying concentrations (125, 62.5, . . . , 0.24 μM) of the titrant peptide, and 2.5% DMSO. Duplicate samples thus prepared for each concentration point are incubated at room temperature for 30 min, then chilled to 4° C. prior to SEC-LC-MS analysis of 2.0 μL injections. The (M+H)1+, (M+2H)2+, (M+3H)3+, or (M+Na)1+ ion is observed by ESI-MS; extracted ion chromatograms are quantified, then fit to equations to derive the binding affinity Kd as described in “A General Technique to Rank Protein-Ligand Binding Affinities and Determine Allosteric vs. Direct Binding Site Competition in Compound Mixtures.” Annis, D. A.; Nazef, N.; Chuang, C. C.; Scott, M. P.; Nash, H. M. J. Am. Chem. Soc. 2004, 126, 15495-15503; also in “ALIS: An Affinity Selection-Mass Spectrometry System for the Discovery and Characterization of Protein-Ligand Interactions” D. A. Annis, C.-C. Chuang, and N. Nazef. In Mass Spectrometry in Medicinal Chemistry. Edited by Wanner K, Höfner G: Wiley-VCH; 2007:121-184. Mannhold R, Kubinyi H, Folkers G (Series Editors): Methods and Principles in Medicinal Chemistry.
    • Assay for Competitive Binding Experiments by Affinity Selection-Mass Spectrometry.
  • To determine the ability of test compounds to bind competitively to proteins, an affinity selection mass spectrometry assay is performed, for example. A mixture of ligands at 40 μM per component is prepared by combining 2 μL aliquots of 400 μM stocks of each of the three compounds with 14 μL of DMSO. Then, 1 μL aliquots of this 40 μM per component mixture are combined with 1 μL DMSO aliquots of a serially diluted stock solution of titrant peptidomimetic macrocycle (10, 5, 2.5, . . . , 0.078 mM). These 2 μL samples are dissolved in 38 μL of PBS. The resulting solutions were mixed by repeated pipetting and clarified by centrifugation at 10 000 g for 10 min. To 4.0 μL aliquots of the resulting supernatants is added 4.0 μL of 10 μM target protein in PBS. Each 8.0 μL experimental sample thus contains 40 pmol (1.5 μg) of protein at 5.0 μM concentration in PBS plus 0.5 μM ligand, 2.5% DMSO, and varying concentrations (125, 62.5, . . . , 0.98 μM) of the titrant peptidomimetic macrocycle. Duplicate samples thus prepared for each concentration point are incubated at room temperature for 60 min, then chilled to 4° C. prior to SEC-LC-MS analysis of 2.0 μL injections. Additional details on these and other methods are provided in “A General Technique to Rank Protein-Ligand Binding Affinities and Determine Allosteric vs. Direct Binding Site Competition in Compound Mixtures.” Annis, D. A.; Nazef, N.; Chuang, C. C.; Scott, M. P.; Nash, H. M. J. Am. Chem. Soc. 2004, 126, 15495-15503; also in “ALIS: An Affinity Selection-Mass Spectrometry System for the Discovery and Characterization of Protein-Ligand Interactions” D. A. Annis, C.-C. Chuang, and N. Nazef. In Mass Spectrometry in Medicinal Chemistry. Edited by Wanner K, Höfner G: Wiley-VCH; 2007:121-184. Mannhold R, Kubinyi H, Folkers G (Series Editors): Methods and Principles in Medicinal Chemistry.
    • Binding Assays in Intact Cells.
  • It is possible to measure binding of peptides or peptidomimetic macrocycles to their natural acceptors in intact cells by immunoprecipitation experiments. For example, intact cells are incubated with fluoresceinated (FITC-labeled) compounds for 4 hrs in the absence of serum, followed by serum replacement and further incubation that ranges from 4-18 hrs. Cells are then pelleted and incubated in lysis buffer (50 mM Tris [pH 7.6], 150 mM NaCl, 1% CHAPS and protease inhibitor cocktail) for 10 minutes at 4° C. Extracts are centrifuged at 14,000 rpm for 15 minutes and supernatants collected and incubated with 10 μl goat anti-FITC antibody for 2 hrs, rotating at 4° C. followed by further 2 hrs incubation at 4° C. with protein A/G Sepharose (50 μl of 50% bead slurry). After quick centrifugation, the pellets are washed in lysis buffer containing increasing salt concentration (e.g., 150, 300, 500 mM). The beads are then re-equilibrated at 150 mM NaCl before addition of SDS-containing sample buffer and boiling. After centrifugation, the supernatants are optionally electrophoresed using 4%-12% gradient Bis-Tris gels followed by transfer into Immobilon-P membranes. After blocking, blots are optionally incubated with an antibody that detects FITC and also with one or more antibodies that detect proteins that bind to the peptidomimetic macrocycle.
    • Cellular Penetrability Assays.
  • To measure the cell penetrability of peptidomimetic macrocycles and corresponding uncrosslinked macrocycle, intact cells are incubated with fluoresceinated peptidomimetic macrocycles or corresponding uncrosslinked macrocycle (10 μM) for 4 hrs in serum free media at 37° C., washed twice with media and incubated with trypsin (0.25%) for 10 min at 37° C. The cells are washed again and resuspended in PBS. Cellular fluorescence is analyzed, for example, by using either a FACSCalibur flow cytometer or Cellomics' KineticScan® HCS Reader.
    • In Vivo Stability Assays.
  • To investigate the in vivo stability of the peptidomimetic macrocycles, the compounds are, for example, administered to mice or rats by IV, IP, PO or inhalation routes at concentrations ranging from 0.1 to 50 mg/kg and blood specimens withdrawn at 0′, 5′, 15′, 30′, 1 hr, 4 hrs, 8 hrs and 24 hours post-injection. Levels of intact compound in 25 μL of fresh serum are then measured by LC-MS/MS as above.
    • Clinical Trials.
  • To determine the suitability of the peptidomimetic macrocycles of the invention for treatment of humans, clinical trials are performed. For example, patients diagnosed with a muscle wasting disease or lipodystrophy and in need of treatment are selected and separated in treatment and one or more control groups, wherein the treatment group is administered a peptidomimetic macrocycle of the invention, while the control groups receive a placebo or a known BH3 mimetic. The treatment safety and efficacy of the peptidomimetic macrocycles of the invention can thus be evaluated by performing comparisons of the patient groups with respect to factors such as survival and quality-of-life. In this example, the patient group treated with a peptidomimetic macrocycle show improved long-term survival compared to a patient control group treated with a placebo.
    • Pharmaceutical Compositions and Routes of Administration
  • In some embodiments, the present invention provides a pharmaceutical composition comprising a peptidomimetic macrocycle of the invention and a pharmaceutically acceptable carrier.
  • The peptidomimetic macrocycles of the invention also include pharmaceutically acceptable derivatives or prodrugs thereof. A “pharmaceutically acceptable derivative” means any pharmaceutically acceptable salt, ester, salt of an ester, pro-drug or other derivative of a compound of this invention which, upon administration to a recipient, is capable of providing (directly or indirectly) a compound of this invention. Particularly favored pharmaceutically acceptable derivatives are those that increase the bioavailability of the compounds of the invention when administered to a mammal (e.g., by increasing absorption into the blood of an orally administered compound) or which increases delivery of the active compound to a biological compartment (e.g., the brain or lymphatic system) relative to the parent species. Some pharmaceutically acceptable derivatives include a chemical group which increases aqueous solubility or active transport across the gastrointestinal mucosa.
  • In some embodiments, the peptidomimetic macrocycles of the invention are modified by covalently or non-covalently joining appropriate functional groups to enhance selective biological properties. Such modifications include those which increase biological penetration into a given biological compartment (e.g., blood, lymphatic system, central nervous system), increase oral availability, increase solubility to allow administration by injection, alter metabolism, and alter rate of excretion.
  • Pharmaceutically acceptable salts of the compounds of this invention include those derived from pharmaceutically acceptable inorganic and organic acids and bases. Examples of suitable acid salts include acetate, adipate, benzoate, benzenesulfonate, butyrate, citrate, digluconate, dodecylsulfate, formate, fumarate, glycolate, hemisulfate, heptanoate, hexanoate, hydrochloride, hydrobromide, hydroiodide, lactate, maleate, malonate, methanesulfonate, 2-naphthalenesulfonate, nicotinate, nitrate, palmoate, phosphate, picrate, pivalate, propionate, salicylate, succinate, sulfate, tartrate, tosylate and undecanoate. Salts derived from appropriate bases include alkali metal (e.g., sodium), alkaline earth metal (e.g., magnesium), ammonium and N-(alkyl)4 + salts.
  • For preparing pharmaceutical compositions from the compounds of the present invention, pharmaceutically acceptable carriers include either solid or liquid carriers. Solid form preparations include powders, tablets, pills, capsules, cachets, suppositories, and dispersible granules. A solid carrier can be one or more substances, which also acts as diluents, flavoring agents, binders, preservatives, tablet disintegrating agents, or an encapsulating material. Details on techniques for formulation and administration are well described in the scientific and patent literature, see, e.g., the latest edition of Remington's Pharmaceutical Sciences, Maack Publishing Co, Easton Pa.
  • In powders, the carrier is a finely divided solid, which is in a mixture with the finely divided active component. In tablets, the active component is mixed with the carrier having the necessary binding properties in suitable proportions and compacted in the shape and size desired.
  • Suitable solid excipients are carbohydrate or protein fillers include, but are not limited to sugars, including lactose, sucrose, mannitol, or sorbitol; starch from corn, wheat, rice, potato, or other plants; cellulose such as methyl cellulose, hydroxypropylmethyl-cellulose, or sodium carboxymethylcellulose; and gums including arabic and tragacanth; as well as proteins such as gelatin and collagen. If desired, disintegrating or solubilizing agents are added, such as the cross-linked polyvinyl pyrrolidone, agar, alginic acid, or a salt thereof, such as sodium alginate.
  • Liquid form preparations include solutions, suspensions, and emulsions, for example, water or water/propylene glycol solutions. For parenteral injection, liquid preparations can be formulated in solution in aqueous polyethylene glycol solution.
  • The pharmaceutical preparation is preferably in unit dosage form. In such form the preparation is subdivided into unit doses containing appropriate quantities of the active component. The unit dosage form can be a packaged preparation, the package containing discrete quantities of preparation, such as packeted tablets, capsules, and powders in vials or ampoules. Also, the unit dosage form can be a capsule, tablet, cachet, or lozenge itself, or it can be the appropriate number of any of these in packaged form.
  • When the compositions of this invention comprise a combination of a peptidomimetic macrocycle and one or more additional therapeutic or prophylactic agents, both the compound and the additional agent should be present at dosage levels of between about 1 to 100%, and more preferably between about 5 to 95% of the dosage normally administered in a monotherapy regimen. In some embodiments, the additional agents are administered separately, as part of a multiple dose regimen, from the compounds of this invention. Alternatively, those agents are part of a single dosage form, mixed together with the compounds of this invention in a single composition.
  • In some embodiments, the compositions are present as unit dosage forms that can deliver, for example, from about 0.0001 mg to about 1,000 mg of the peptidomimetic macrocycles, salts thereof, prodrugs thereof, derivatives thereof, or any combination of these. Thus, the unit dosage forms can deliver, for example, in some embodiments, from about 1 mg to about 900 mg, from about 1 mg to about 800 mg, from about 1 mg to about 700 mg, from about 1 mg to about 600 mg, from about 1 mg to about 500 mg, from about 1 mg to about 400 mg, from about 1 mg to about 300 mg, from about 1 mg to about 200 mg, from about 1 mg to about 100 mg, from about 1 mg to about 10 mg, from about 1 mg to about 5 mg, from about 0.1 mg to about 10 mg, from about 0.1 mg to about 5 mg, from about 10 mg to about 1,000 mg, from about 50 mg to about 1,000 mg, from about 100 mg to about 1,000 mg, from about 200 mg to about 1,000 mg, from about 300 mg to about 1,000 mg, from about 400 mg to about 1,000 mg, from about 500 mg to about 1,000 mg, from about 600 mg to about 1,000 mg, from about 700 mg to about 1,000 mg, from about 800 mg to about 1,000 mg, from about 900 mg to about 1,000 mg, from about 10 mg to about 900 mg, from about 100 mg to about 800 mg, from about 200 mg to about 700 mg, or from about 300 mg to about 600 mg of the peptidomimetic macrocycles, salts thereof, prodrugs thereof, derivatives thereof, or any combination of these.
  • In some embodiments, the compositions are present as unit dosage forms that can deliver, for example, about 1 mg, about 2 mg, about 3 mg, about 4 mg, about 5 mg, about 6 mg, about 7 mg, about 8 mg, about 9 mg, about 10 mg, about 20 mg, about 30 mg, about 40 mg, about 50 mg, about 60 mg, about 70 mg, about 80 mg, about 90 mg, about 100 mg, about 150 mg, about 200 mg, about 250 mg, about 300 mg, about 350 mg, about 400 mg, about 500 mg, about 600 mg, about 700 mg, about 800 mg, or about 1000 mg of peptidomimetic macrocycles, salts thereof, prodrugs thereof, derivatives thereof, or any combination of these.
  • Suitable routes of administration include, but are not limited to, oral, intravenous, rectal, aerosol, parenteral, ophthalmic, pulmonary, transmucosal, transdermal, vaginal, otic, nasal, and topical administration. In addition, by way of example only, parenteral delivery includes intramuscular, subcutaneous, intravenous, intramedullary injections, as well as intrathecal, direct intraventricular, intraperitoneal, intralymphatic, and intranasal injections.
  • In certain embodiments, a composition as described herein is administered in a local rather than systemic manner, for example, via injection of the compound directly into an organ. In specific embodiments, long acting formulations are administered by implantation (for example subcutaneously or intramuscularly) or by intramuscular injection. Furthermore, in other embodiments, the drug is delivered in a targeted drug delivery system, for example, in a liposome coated with organ-specific antibody. In such embodiments, the liposomes are targeted to and taken up selectively by the organ. In yet other embodiments, the compound as described herein is provided in the form of a rapid release formulation, in the form of an extended release formulation, or in the form of an intermediate release formulation. In yet other embodiments, the compound described herein is administered topically.
  • In another embodiment, compositions described herein are formulated for oral administration. Compositions described herein are formulated by combining a peptidomimetic macrocycle with, e.g., pharmaceutically acceptable carriers or excipients. In various embodiments, the compounds described herein are formulated in oral dosage forms that include, by way of example only, tablets, powders, pills, dragees, capsules, liquids, gels, syrups, elixirs, slurries, suspensions and the like.
  • In certain embodiments, pharmaceutical preparations for oral use are obtained by mixing one or more solid excipient with one or more of the peptidomimetic macrocycles described herein, optionally grinding the resulting mixture, and processing the mixture of granules, after adding suitable auxiliaries, if desired, to obtain tablets or dragee cores. Suitable excipients are, in particular, fillers such as sugars, including lactose, sucrose, mannitol, or sorbitol; cellulose preparations such as: for example, maize starch, wheat starch, rice starch, potato starch, gelatin, gum tragacanth, methylcellulose, microcrystalline cellulose, hydroxypropylmethylcellulose, sodium carboxymethylcellulose; or others such as: polyvinylpyrrolidone (PVP or povidone) or calcium phosphate. In specific embodiments, disintegrating agents are optionally added. Disintegrating agents include, by way of example only, cross-linked croscarmellose sodium, polyvinylpyrrolidone, agar, or alginic acid or a salt thereof such as sodium alginate.
  • In one embodiment, dosage forms, such as dragee cores and tablets, are provided with one or more suitable coating. In specific embodiments, concentrated sugar solutions are used for coating the dosage form. The sugar solutions, optionally contain additional components, such as by way of example only, gum arabic, talc, polyvinylpyrrolidone, carbopol gel, polyethylene glycol, or titanium dioxide, lacquer solutions, and suitable organic solvents or solvent mixtures. Dyestuffs or pigments are also optionally added to the coatings for identification purposes. Additionally, the dyestuffs or pigments are optionally utilized to characterize different combinations of active compound doses.
  • In certain embodiments, therapeutically effective amounts of at least one of the peptidomimetic macrocycles described herein are formulated into other oral dosage forms. Oral dosage forms include push-fit capsules made of gelatin, as well as soft, sealed capsules made of gelatin and a plasticizer, such as glycerol or sorbitol. In specific embodiments, push-fit capsules contain the active ingredients in admixture with one or more filler. Fillers include, by way of example only, lactose, binders such as starches, or lubricants such as talc or magnesium stearate and, optionally, stabilizers. In other embodiments, soft capsules, contain one or more active compound that is dissolved or suspended in a suitable liquid. Suitable liquids include, by way of example only, one or more fatty oil, liquid paraffin, or liquid polyethylene glycol. In addition, stabilizers are optionally added.
  • In other embodiments, therapeutically effective amounts of at least one of the peptidomimetic macrocycles described herein are formulated for buccal or sublingual administration. Formulations suitable for buccal or sublingual administration include, by way of example only, tablets, lozenges, or gels. In still other embodiments, the peptidomimetic macrocycles described herein are formulated for parenteral injection, including formulations suitable for bolus injection or continuous infusion. In specific embodiments, formulations for injection are presented in unit dosage form (e.g., in ampoules) or in multi-dose containers. Preservatives are, optionally, added to the injection formulations. In still other embodiments, pharmaceutical compositions are formulated in a form suitable for parenteral injection as a sterile suspensions, solutions or emulsions in oily or aqueous vehicles. Parenteral injection formulations optionally contain formulatory agents such as suspending, stabilizing or dispersing agents. In specific embodiments, pharmaceutical formulations for parenteral administration include aqueous solutions of the active compounds in water-soluble form. In additional embodiments, suspensions of the active compounds are prepared as appropriate oily injection suspensions. Suitable lipophilic solvents or vehicles for use in the pharmaceutical compositions described herein include, by way of example only, fatty oils such as sesame oil, or synthetic fatty acid esters, such as ethyl oleate or triglycerides, or liposomes. In certain specific embodiments, aqueous injection suspensions contain substances which increase the viscosity of the suspension, such as sodium carboxymethyl cellulose, sorbitol, or dextran. Optionally, the suspension contains suitable stabilizers or agents which increase the solubility of the compounds to allow for the preparation of highly concentrated solutions. Alternatively, in other embodiments, the active ingredient is in powder form for constitution with a suitable vehicle, e.g., sterile pyrogen-free water, before use.
  • Pharmaceutical compositions herein can be administered, for example, once or twice or three or four or five or six times per day, or once or twice or three or four or five or six times per week, and can be administered, for example, for a day, a week, a month, 3 months, six months, a year, five years, or for example ten years. In some embodiments, a pharmaceutical formulation of the invention is administered no more frequently than once daily, no more frequently than every other day, no more frequently than twice weekly, no more frequently than three times weekly, no more frequently than four times weekly, no more frequently than five times weekly, or no more frequently than every other week. In some embodiments, a pharmaceutical formulation of the invention is administered no more than once weekly. In some embodiments, a pharmaceutical formulation of the invention is administered no more than twice weekly. In some embodiments, a pharmaceutical formulation of the invention is administered no more than three times weekly. In some embodiments, a pharmaceutical formulation of the invention is administered no more than four times weekly. In some embodiments, a pharmaceutical formulation of the invention is administered no more than five times weekly.
    • Methods of Use
  • As used herein, the term “treatment” is defined as the application or administration of a therapeutic agent to a patient, or application or administration of a therapeutic agent to an isolated tissue or cell line from a patient, who has a disease, a symptom of disease or a predisposition toward a disease, with the purpose to cure, heal, alleviate, relieve, alter, remedy, ameliorate, improve or affect the disease, the symptoms of disease or the predisposition toward disease. In some embodiments, a peptidomimetic macrocycle disclosed herein is used for treating a disease or condition in a subject in need thereof. In some embodiments, a peptidomimetic macrocycle disclosed herein is used for manufacture of a medicament for treating a disease or condition in a subject in need thereof.
  • In one aspect, the present invention provides novel peptidomimetic macrocycles that are useful in competitive binding assays to identify agents which bind to a natural ligand of the proteins or peptides upon which the peptidomimetic macrocycles are modeled. For example, labeled peptidomimetic macrocycles based on BIM can be used in a binding assay along with small molecules that competitively bind to MCL-1. Competitive binding studies allow for rapid in vitro evaluation and determination of drug candidates specific the BIM/MCL-1 interaction. Such binding studies may be performed with any of the peptidomimetic macrocycles disclosed herein and their binding partners.
  • The invention further provides for the generation of antibodies against the peptidomimetic macrocycles. In some embodiments, these antibodies specifically bind both the peptidomimetic macrocycle and the precursor peptides, such as BIM, to which the peptidomimetic macrocycles are related. Such antibodies, for example, disrupt the native protein-protein interactions, for example, between BIM and MCL-1.
  • In another aspect, the present invention provides methods to inhibit MCL-1, thereby stimulating death of a cell or tissue. In some embodiments, a subject suffering from a condition of suppressed cell death, such as B-cell lymphoma, is treated using pharmaceutical compositions of the invention.
  • In yet another aspect, the present invention provides methods for treating a disease driven by over-expression of MCL-1. In some embodiments, the disease driven by over-expression is a cancer. The cancer can be a liquid cancer or a solid cancer. Non-limiting examples of a liquid cancer include leukemia, lymphoma, myeloma, and myeloid dysplasia. Non-limiting examples of a solid cancer include lung cancer, breast cancer, colon cancer, brain cancer, liver cancer, soft-tissue sarcoma, pancreatic cancer, and melanoma. In some embodiments, the cancer is resistant, non-responsive, or determined unlikely to respond to a BCL-2 inhibitor. In some embodiments, the BCL-2 inhibitor is a BH3 mimetic. In some embodiments, the BCL-2 inhibitor is navitoclax (ABT-263) or obatoclax (GX15-070). These methods comprise administering an effective amount of a compound of the invention to a warm blooded animal, including a human. In some embodiments, a pharmaceutical composition provided herein used in the treatment of an MCL-1 over-expressing cancer is administered no more frequently than once daily, no more frequently than every other day, no more frequently than twice weekly, no more frequently than weekly, or no more frequently than every other week.
  • In some embodiments, provided herein are methods for treating neurodegenerative disorders. Many neurodegenerative diseases are a result of neurodegenerative processes including progressive loss of structure or function of neurons. These methods comprise administering an effective amount of at least one peptidomimetic macrocycles of the invention or a pharmaceutical composition thereof to a warm blooded animal, including a human. Non limiting neurodegenerative disorders that may be treated by the methods of the present invention include Parkinson's disease, Alzheimer's, Amyotrophic lateral sclerosis (ALS) and Huntington's disease.
  • In some embodiments, provided herein are methods for treating cardiac disorders. These methods comprise administering an effective amount of at least one peptidomimetic macrocycles of the invention or a pharmaceutical composition thereof to a warm blooded animal, including a human. Non limiting examples of cardiac disorders that may be treated by the methods of the present invention include coronary heart disease (also known as isohaemic heart disease or coronary artery disease), cardiomyopathy (diseases of cardiac muscle), hypertensive heart disease (diseases of the heart secondary to high blood pressure), heart failure, cor pulmonale (failure of the right side of the heart), cardiac dysrhythmias (abnormalities of heart rhythm), inflammatory heart disease, endocarditis (inflammation of the inner layer of the heart, the endocardium), inflammatory cardiomegaly, myocarditis (inflammation of the myocardium, the muscular part of the heart), valvular heart disease, cerebrovascular disease (disease of blood vessels that supplies to the brain such as stroke), peripheral arterial disease (disease of blood vessels that supplies to the arms and legs), congenital heart disease, and rheumatic heart disease. In some embodiments, the methods of the present invention may be used for the treatment of acute myocardial infarction or chromic ischemic heart disease.
  • Also provided herein are methods for promoting cardiac regeneration in a subject in need thereof. These methods comprise administering an effective amount of at least one peptidomimetic macrocycles of the invention or a pharmaceutical composition thereof to a warm blooded animal, including a human.
  • In some embodiments, provided herein are methods for treating diabetes or diabetes mellitus. Diabetes is a group of metabolic diseases in which a person has high blood sugar, either because the pancreas does not produce enough insulin, or because cells do not respond to the insulin that is produced. The diabetes may be Type 1 diabetes mellitus, type 2 diabetes, gestational diabetes, congenital diabetes, cystic fibrosis-related diabetes or several forms of monogenic diabetes. Treatment of diabetes may be by islet/beta cell transplantation.
  • In another aspect the invention provides methods of treating a subject by administering to the subject a beta cell, wherein the beta cell has been treated with an effective amount of a peptidomimetic macrocycle of the invention or a pharmaceutical composition thereof. Similarly, In another aspect the invention provides methods of treating a subject by administering to the subject a islet cell, wherein the islet cell has been treated with an effective amount of a peptidomimetic macrocycle of the invention or a pharmaceutical composition thereof.
  • In some embodiments, provided herein are methods for treating cancer. These methods comprise administering an effective amount of at least one peptidomimetic macrocycles of the invention or a pharmaceutical composition thereof to a warm blooded animal, including a human. Non-limiting examples of cancers that may be treated by the methods of the present invention include breast cancer such as a ductal carcinoma in duct tissue in a mammary gland, medullary carcinomas, colloid carcinomas, tubular carcinomas, and inflammatory breast cancer; ovarian cancer, including epithelial ovarian tumors such as adenocarcinoma in the ovary and an adenocarcinoma that has migrated from the ovary into the abdominal cavity; uterine cancer; cervical cancer such as adenocarcinoma in the cervix epithelial including squamous cell carcinoma and adenocarcinomas; prostate cancer, such as a prostate cancer selected from the following: an adenocarcinoma or an adenocarinoma that has migrated to the bone; pancreatic cancer such as epitheliod carcinoma in the pancreatic duct tissue and an adenocarcinoma in a pancreatic duct; bladder cancer such as a transitional cell carcinoma in urinary bladder, urothelial carcinomas (transitional cell carcinomas), tumors in the urothelial cells that line the bladder, squamous cell carcinomas, adenocarcinomas, and small cell cancers; leukemia such as acute myeloid leukemia (AML), acute lymphocytic leukemia, chronic lymphocytic leukemia, chronic myeloid leukemia, hairy cell leukemia, myelodysplasia, myeloproliferative disorders, acute myelogenous leukemia (AML), chronic myelogenous leukemia (CML), mastocytosis, chronic lymphocytic leukemia (CLL), multiple myeloma (MM), and myelodysplastic syndrome (MDS); bone cancer; lung cancer such as non-small cell lung cancer (NSCLC), which is divided into squamous cell carcinomas, adenocarcinomas, and large cell undifferentiated carcinomas, and small cell lung cancer; skin cancer such as basal cell carcinoma, melanoma, squamous cell carcinoma and actinic keratosis, which is a skin condition that sometimes develops into squamous cell carcinoma; eye retinoblastoma; cutaneous or intraocular (eye) melanoma; primary liver cancer (cancer that begins in the liver); kidney cancer; thyroid cancer such as papillary, follicular, medullary and anaplastic; AIDS-related lymphoma such as diffuse large B-cell lymphoma, B-cell immunoblastic lymphoma and small non-cleaved cell lymphoma; Kaposi's Sarcoma; viral-induced cancers including hepatitis B virus (HBV), hepatitis C virus (HCV), and hepatocellular carcinoma; human lymphotropic virus-type 1 (HTLV-1) and adult T-cell leukemia/lymphoma; and human papilloma virus (HPV) and cervical cancer; central nervous system cancers (CNS) such as primary brain tumor, which includes gliomas (astrocytoma, anaplastic astrocytoma, or glioblastoma multiforme), Oligodendroglioma, Ependymoma, Meningioma, Lymphoma, Schwannoma, and Medulloblastoma; peripheral nervous system (PNS) cancers such as acoustic neuromas and malignant peripheral nerve sheath tumor (MPNST) including neurofibromas and schwannomas, malignant fibrous cytoma, malignant fibrous histiocytoma, malignant meningioma, malignant mesothelioma, and malignant mixed Müllerian tumor; oral cavity and oropharyngeal cancer such as, hypopharyngeal cancer, laryngeal cancer, nasopharyngeal cancer, and oropharyngeal cancer; stomach cancer such as lymphomas, gastric stromal tumors, and carcinoid tumors; testicular cancer such as germ cell tumors (GCTs), which include seminomas and nonseminomas, and gonadal stromal tumors, which include Leydig cell tumors and Sertoli cell tumors; thymus cancer such as to thymomas, thymic carcinomas, Hodgkin disease, non-Hodgkin lymphomas carcinoids or carcinoid tumors; rectal cancer; and colon cancer.
  • In some embodiments, a peptidomimetic macrocycle disclosed herein is administered in combination with an additional therapy to treat a cancer. Non-limiting examples of the additional therapy include surgery, radiation therapy, chemotherapy, or immunotherapy. In some embodiments, the combination of the peptidomimetic macrocycle and surgery is on an adjuvant basis or a neo-adjuvant basis.
  • Non-limiting examples of chemotherapy include alkylating agents, angiogenesis inhibitors, antimetabolites, Bcr-Abl kinase inhibitors, cyclin-dependent kinase inhibitors, cyclooxygenase-2 inhibitors, epidermal growth factor receptor (EGFR) inhibitors, leukemia viral oncogene homolog (ErbB2) receptor inhibitors, histone deacetylase (HDAC) inhibitors, heat shock protein (HSP)-90 inhibitors, inhibitors of inhibitors of apoptosis proteins (IAPs), antibody drug conjugates, activators of death receptor pathway, kinesin inhibitors, JAK-2 inhibitors, mitogen-activated extracellular signal-regulated kinase (MEK) inhibitors, mammalian target of rapamycin (mTOR) inhibitors, non-steroidal anti-inflammatory drugs (NSAIDs), platelet-derived growth factor receptor (PDGFR) inhibitors, platinum chemotherapeutics, polo-like kinase (Plk) inhibitors, phosphoinositide-3 kinase (PI3K) inhibitors, thrombospondin analogs, vascular endothelial growth factor receptor (VEGFR) inhibitors, intercalating antibiotics, topoisomerase inhibitors, antibodies, hormonal therapies, deltoids and retinoids, poly ADP (adenosine diphosphate)-ribose polymerase (PARP) inhibitors, plant alkaloids, proteasome inhibitors, biologic response modifiers, pyrimidine analogs, purine analogs, antimitotics, taxanes, and ubiquitin ligase inhibitors.
  • Non-limiting examples of alkylating agents include: altretamine, AMD-473, AP-5280, apaziquone, bendamustine, brostallicin, busulfan, carboquone, carmustine, chlorambucil, laromustine, cyclophosphamide, decarbazine, estramustine, fotemustine, glufosfamide, ifosfamide, KW-2170, lomustine, mafosfamide, melphalan, mitobronitol, mitolactol, nimustine, nitrogen mustard N-oxide, ranimustine, temozolomide, thiotepa, bendamustine, treosulfan, and rofosfamide.
  • Non-limiting examples of angiogenesis inhibitors include: endothelial-specific receptor tyrosine kinase (Tie-2) inhibitors, epidermal growth factor receptor (EGFR) inhibitors, insulin growth factor-2 receptor (IGFR-2) inhibitors, matrix metalloproteinase-2 (MMP-2) inhibitors, matrix metalloproteinase-9 (MMP-9) inhibitors, platelet-derived growth factor receptor (PDGFR) inhibitors, thrombospondin analogs, and vascular endothelial growth factor receptor tyrosine kinase (VEGFR) inhibitors.
  • Non-limiting examples of antimetabolites include: pemetrexed disodium, 5-azacitidine, capecitabine, carmofur, cladribine, clofarabine, cytarabine, cytarabine ocfosfate, cytosine arabinoside, decitabine, deferoxamine, doxifluridine, eflornithine, EICAR, enocitabine, ethnylcytidine, fludarabine, 5-fluorouracil, leucovorin, gemcitabine, hydroxyurea, melphalan, mercaptopurine, 6-mercaptopurine riboside, methotrexate, mycophenolic acid, nelarabine, nolatrexed, ocfosfate, pelitrexol, pentostatin, raltitrexed, Ribavirin, triapine, trimetrexate, S-1, tiazofurin, tegafur, TS-1, vidarabine, and UFT.
  • Non-limiting examples of Bcr-Abl kinase inhibitors include: dasatinib, nilotinib, and imatinib.
  • Non-limiting examples of CDK inhibitors include: AZD-5438, BMI-1040, BMS-032, BMS-387, CVT-2584, flavopyridol, GPC-286199, MCS-5A, PD0332991, PHA-690509, seliciclib, and ZK-304709.
  • Non-limiting examples of COX-2. inhibitors include: ABT-963, etoricoxib, valdecoxib, BMS347070, celecoxib, lumiracoxib, CT-3, deracoxib, JTE-522, 4-methyl-2-(3,4-dimethylphenyl)-1-(4-sulfamoylphenyl-1H-pyrrole), etoricoxib, NS-398, parecoxib, RS-57067, SC-58125, SD-8381, SVT-2016, S-2474, T-614, and rofecoxib.
  • Non-limiting examples of EGFR inhibitors include: ABX-EGF, anti-EGFR immunoliposomes, EGF-vaccine, EMD-7200, cauximab, HR3, IgA antibodies, gefitinib, erlotinib, TP-38, EGER fusion protein, and lapatinib.
  • Non-limiting examples of ErbB2 receptor inhibitors include: CP-724-714, canertinib, trastuzumab, lapatinib, petuzumab, TAK-165, ionafarnib, GW-282974, EKB-569, PI-166, dHER2 HER2. vaccine, APC-8024 HER-2 vaccine, anti-HER2/neu bispecific antibody, B7.her21gG3, AS HER2 trifunctional bispecific antibodies, mAB AR-209, and mAB 2B-1.
  • Non-limiting examples of histone deacetylase inhibitors include: depsipeptide, LAQ-824, MS-275, trapoxin, suberoylanilide hydroxamic acid (SAHA), TSA, and valproic acid.
  • Non-limiting examples of HSP-90 inhibitors include: 17-AAG-nab, 17-AAG, CNE-101, CNF-1010, CNF-2024, 17-DMAG, geldanamycin, IPI-504, KOS-953, human recombinant antibody to HSP-90, NCS-683664, PU24FC1, PU-3, radicicol, SNX-2112, or STA-9090 VER49009.
  • Non-limiting examples of inhibitors of inhibitors of apoptosis proteins include: HGS1029, GDC-0145, GDC-0152, LCL-161, and LBW-242.
  • Non-limiting examples of antibody-drug conjugates include: anti-CD22-MC-MMAF, anti-CD22-MC-MMAE, anti-CD22-MCC-DM1, CR-0,1-veMMAE, PSMA-ADC, MEDI-547, SGN-19Am SGN-35, and SGN-75.
  • Non-limiting examples of activators of death receptor pathway include: TRAIL, antibodies or other agents that target TRAIL or death receptors (e.g., DR4 and DRS) such as apomab, conatumumab, ETR2-ST01, GDC0145, lexatumumab, HGS-1029, LBY-135, PRO-1762, and trastuzumab.
  • Non-limiting examples of kinesin inhibitors include: Eg5 inhibitors such as AZD4877, ARRY-520; and CENPE inhibitors such as GSK923295A.
  • Non-limiting examples of JAK-2 inhibitors include: lesaurtinib, XL019 or INCB018424.
  • Non-limiting examples of MEK inhibitors include: trametmib, ARRY-142886, ARRY-438162 PD-325901, C1-1040, and PD-98059.
  • Non-limiting examples of mTOR inhibitors include: AP-23573, CCI-779, everolimus, RAD-001, rapamycin, temsirolimus, ATP-competitive TORC1/TORC2 inhibitors, comprising PI-103, PP242, PP30, and Torin 1.
  • Non-limiting examples of non-steroidal anti-inflammatory drugs include: salsalate, diflunisal, ibuprofen, ketoprofen, nabumetone, piroxicam, ibuprofen cream, naproxen, diclofenac, indomethacin, sulindac, tolmetin, etodolac, ketorolac, and oxaprozin.
  • Non-limiting examples of PDGFR inhibitors include: C-451, CP-673, and CP-868596.
  • Non-limiting examples of platinum chemotherapeutics include: cisplatin, oxaliplatin, eptaplatin, lobaplatin, nedaplatin, carboplatin, satraplatin, and picoplatin.
  • Non-limiting examples of polo-like kinase inhibitors include: B1-2536.
  • Non-limiting examples of phosphoinositide-3 kinase (PI3K) inhibitors include: wortmannin, LY294002, XL-147, CAL-120, ONC-21, AEZS-127, ETP-45658, PX-866, GDC-0941, BGT226, BEZ235, and XL765.
  • Non-limiting examples of thrombospondin analogs include: ABT-510, ABT-567, ABT-898, and TSP-1.
  • Non-limiting examples of VEGFR inhibitors include: bevacizumab, ABT-869, AEE-788, ANGIOZYME™ (a ribozyme that inhibits angiogenesis, axitinib, AZD-2171, CP-547,632, IM-862, pegaptamib, sorafenib, pazopanib, vatalanib, sunitinib, VEGF trap, and vandetanib.
  • Non-limiting examples of antibiotics include: intercalating antibiotics aclarubicin, actinomycin D, amrubicin, annamycin, adriamycin, bleomycin, daunorubicin, liposomal doxorubicin, doxorubicin, elsamitrucin, epirbucin, glarbuicin, idarubicin, mitomycin C, nemorubicin, neocarzinostatin, peplomycin, pirarubicin, rebeccamycin, stimalamer, streptozocin, valrubicin, and zinostatin.
  • Non-limiting examples of topoisomerase inhibitors include: aclarubicin, 9-aminocamptothecin, amonafide, amsacrine, hecatecarin, belotecan, BN-80915, irinotecan, camptothecin, dexrazoxine, diflomotecan, edotecarin, epirubicin, etoposide, exatecan, 10-hydroxycamptothecin, gimatecan, lurtotecan, mitoxantrone, orathecin, pirarbucin, pixantrone, rubitecan, sobuzoxane, SN-38, tafluposide, and topotecan.
  • Non-limiting examples of antibodies include: bevacizumab, CD40 antibodies, chTNT-1/B, denosumab, cetuximab, zanolimumab, IGF1R antibodies, llintuzumab, edrecolomab, WX G250, rituximab, ticilimumab, trastuzumab, CD20 antibodies types I and II, pembrolizumab, ipilumimab, nivolumab, rituximab, and panituommab.
  • Non-limiting examples of hormonal therapies include: anastrozole, exemestane, arzoxifene, bicalutamide, cetrorelix, degarelix, deslorelin, trilostane, dexamethasone, flutamide, raloxifene, fadrozole, toremifene, fulvestrant, letrozole, formestane, glucocorticoids, doxercalciferol, sevelamer carbonate, lasofoxifene, leuprolide acetate, megesterol, mifepristone, nilutamide, tamoxifen citrate, aharelix, prednisone, finasteride, rilostane, buserelin, luteinizing hormone releasing hormone (LHRH), histrelin implant, trilostane, modrastane, fosrelin, and goserelin.
  • Non-limiting examples of deltoids and retinoids include: seocalcitol, lexacalcitrol, fenretinide, aliretinoin, liposomal tretinoin, bexarotene, and LGD-1550.
  • Non-limiting examples of PARP inhibitors include: ABT-888, olaparib, KU-59436, AZD-2281, AG-014699, BSI-201, BGP-15, INO-1001, and ONO-2231.
  • Non-limiting examples of plant alkaloids include: vincristine, vinblastine, vindesine, and vinorelbine.
  • Non-limiting examples of proteasome inhibitors include: bortezomib, carfilzomib, MG132, and NPI-0052.
  • Non-limiting examples of biological response modifiers include: krestin, lentinan, sizofuran, picibanil, PF-3512676, and ubenimex.
  • Non-limiting examples of pyrimidine analogs include: cytarabine, cytosine arabinoside, doxifluridine, fludarabine, 5-fluorouracil, floxuridine, gemcitabine, ratitrexed, and triacetyluridine troxacitabine.
  • Non-limiting examples of purine analogs include: thioguanine, and mercaptopurine.
  • Non-limiting examples of antimitotic agents include: batabulin, epothilone D, N-(2-((4-hydroxyphenyl)amino)pyridin-3-yl)-4-methoxybenzenesulfonamide, ixabepilone, paclitaxel, docetaxel, PNU100940, patupilone, XRP-9881 larotaxel, vinflunine, and epothilone.
  • Non-limiting examples of ubiquitin ligase inhibitors include paclitaxel and docetaxel.
  • Non-limiting examples of ubiquitin ligase inhibitors include: MDM2 inhibitors, such as nutlins, and NEDD8 inhibitors such as MLN4924.
  • Non-limiting examples of immunotherapies include: interferons or immune-enhancing agents. Interferons comprise interferon alpha, interferon alpha-2a, interferon alpha-2b, interferon beta, interferon gamma-1a, interferon gamma-1b, interferon gamma-n1. Other immune-enhancing agents comprise oxidized glutathione, tasonermin, tositurnornab, alemtuzumab, CTLA4, decarbazine, denileukin, epratuzumab, lenograstim, lentinan, leukocyte alpha interferon, imiquimod, ipilumimab, melanoma vaccine, niitumomab, molgramostim, nivolumab, pembrolizumab, gemtuzumab ozogamicin, filgrastim, OncoVAC-CL, oregovomab, pemtumomab, sipuleucel-T, sargaramostim, sizofilan, teceleukin, Bacillus Calmette-Guerin, ubenimex, virulizin, Z-100, Tetrachlorodecaoxide (TCDO), aldesleukin, thymalfasin, daclizumab, and 90Y-Ibritumomab tiuxetan.
  • While preferred embodiments of the present invention have been shown and described herein, it will be obvious to those skilled in the art that such embodiments are provided by way of example only. Numerous variations, changes, and substitutions will now occur to those skilled in the art without departing from the invention. It should be understood that various alternatives to the embodiments of the invention described herein may be employed in practicing the invention. It is intended that the following claims define the scope of the invention and that methods and structures within the scope of these claims and their equivalents be covered thereby.
    • EXAMPLES Example 1 Peptidomimetic Macrocycles of the Invention
  • Peptidomimetic macrocycles were synthesized, purified and analyzed as previously described and as described below (Schafmeister et al., J. Am. Chem. Soc. 122:5891-5892 (2000); Schafmeister & Verdin, J. Am. Chem. Soc. 122:5891 (2005); Walensky et al., Science 305:1466-1470 (2004); and U.S. Pat. No. 7,192,713). Peptidomimetic macrocycles were designed by replacing two or more naturally occurring amino acids with the corresponding synthetic amino acids. Substitutions were made at i and i+4, and i and i+7 positions. Peptide synthesis was performed either manually or on an automated peptide synthesizer (Applied Biosystems, model 433A), using solid phase conditions, rink amide AM resin (Novabiochem), and Fmoc main-chain protecting group chemistry. For the coupling of natural Fmoc-protected amino acids (Novabiochem), 10 equivalents of amino acid and a 1:1:2 molar ratio of coupling reagents HBTU/HOBt (Novabiochem)/DIEA were employed. Non-natural amino acids (4 equiv) were coupled with a 1:1:2 molar ratio of HATU (Applied Biosystems)/HOBt/DIEA. The N-termini of the synthetic peptides were acetylated, while the C-termini were amidated.
  • Purification of cross-linked compounds was achieved by high performance liquid chromatography (HPLC) (Varian ProStar) on a reverse phase C18 column (Varian) to yield the pure compounds. Chemical composition of the pure products was confirmed by LC/MS mass spectrometry (Micromass LCT interfaced with Agilent 1100 HPLC system) and amino acid analysis (Applied Biosystems, model 420A).
    • Example 2 Metabolism by Purified Protease
  • Linear peptides and cross-linked peptidomimetic macrocycles are tested for stability to proteolysis by Trypsin (MP Biomedicals, Solon Ohio) by solubilizing each peptide at 10 μM concentration in 200 μL 100 mM NH4OAc (pH 7.5). The reaction is initiated by adding 3.5 μl of Trypsin (12.5 μg protease per 500 μL reaction) and shaking continually in sealed vials while incubating in a Room Temperature (22±2° C.). The enzyme/substrate ratio is 1:102 (w/w). After incubation times of 0, 5, 30, 60 and 135 min the reaction is stopped by addition of equal volume of 0.2% trifluoroacetic acid. Then, the solution is immediately analyzed by LC-MS in positive detection mode. The reaction half-life for each peptide is calculated in GraphPad Prism by a non-linear fit of uncalibrated MS response versus enzyme incubation time.
  •
    SEQ
    ID
    NO: 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15
    1626 Ac— I W I A Q A L R $r8 I G D E F N
    1627 Ac— I W I A Q E L R $r8 I G D E F N
    1628 Ac— W I A Q A L R $r8 I G D A F N
    1629 Ac— I A Q A L R $r8 I G D A F A
    1630 Ac— I A Q A L R $r8 I G D A F N
    1631 Ac— I W I A Q A L R $r8 I G D A F N
    1632 Ac— W I A Q A L R $r8 I G D A F N
    1633 Ac— I A Q A L R $r8 I G D A F N
    1634 Ac— I A A A L R $r8 I G D A F N
    1635 Ac— I A Q A L A $r8 I G D A F N
    1636 Ac— I A Q A L R $r8 I A D A F N
    1637 Ac— I A Q A L R $r8 I G D A A N
    1638 Ac— I A Q A L R $r8 I G D A F N
    1639 Ac— I $ I A Q $ L R $r8 I G D E F N
    1640 Ac— I W I A Q A L R %r8 I G D A F N
    1641 Ac— I W I A Q A L R $r8 I G D E F A
    1642 Ac— I W I A Q A L R $r8 I G D Q A N
    1643 FITC- Ba I W I A Q A L R $r8 I G D A F N
    1644 5-FAM- Ba I W I A Q A L R $r8 I G D A F N
    1645 5-FAM- Ba I W I A Q A L R $r8 I G D E F N
    1646 Ac— I A I A Q A L R $r8 I G D A F N
    1647 Ac— I W I A Q A L R $r8 I G D E F N
    1648 Ac— I W I A Q A L R $r8 I G D Q F N
    1649 Ac— I W I A A A L R $r8 I G D E F N
    1650 Ac— I W I A A A L R $r8 I G D Q F N
    1651 Ac— I W I A A A L R $r8 I G D A F N
    1652 Ac— I W I A Q A L R $r8 I G D A F A
    1653 Ac— I W I A Q A L Cit $r8 I G D A F N
    1654 Ac— I W I A Q A L Cit $r8 I G D Q F N
    1655 Ac— I W I A Q A L H $r8 I G D A F N
    1656 Ac— I W I A Q A L H $r8 I G D Q F N
    1657 Ac— I W I A Q A L Q $r8 I G D A F N
    1658 Ac— I W I A Q A L Q $r8 I G D Q F N
    1659 Ac— I W I A Q A L R $r8 I G D A A N
    1660 Ac— I W I A Q A L R $r8 I G D A I N
    1661 Ac— I W I A Q A L R $r8 I G D Q I N
    1662 Ac— I W I A Q A A R $r8 I G D A A N
    1663 Ac— I W I A Q A L R $r8 I A D A F N
    1664 Ac— I W I A Q A L R $r8 I A D Q F N
    1665 Ac— I W I A Q A L R $r8 A G D A F N
    1666 Ac— I W I A Q A L R $r8 A G D Q F N
    1667 Ac— I W I A Q A L R $r8 F G D A F N
    1668 Ac— I W I A Q A L R $r8 F G D Q F N
    1669 Ac— I W F A Q A L R $r8 I G D A F N
    1670 Ac— I W F A Q A L R $r8 I G D Q F N
    1671 Ac— I W I A Q A L A $r8 I G D A F N
    1672 Ac— I W I A Q A L R $r8 I G N A F N
    1673 Ac— I W I A Q A A R $r8 I G D A F N
    1674 Ac— I W I A Q A L R $r8 I G D Q F A
    1675 Ac— I W Cha A Q A L R $r8 I G D A F N
    1676 Ac— I W hhL A Q A L R $r8 I G D A F N
    1677 Ac— I W Adm A Q A L R $r8 I G D A F N
    1678 Ac— I W hCha A Q A L R $r8 I G D A F N
    1679 Ac— I W hF A Q A L R $r8 I G D A F N
    1680 Ac— I W Igl A Q A L R $r8 I G D A F N
    1681 Ac— I W F4CF3 A Q A L R $r8 I G D A F N
    1682 Ac— I W F4tBu A Q A L R $r8 I G D A F N
    1683 Ac— I W 2Nal A Q A L R $r8 I G D A F N
    1684 Ac— I W Bip A Q A L R $r8 I G D A F N
    1685 Ac— I W I A Q A Cha R $r8 I G D A F N
    1686 Ac— I W I A Q A hhL R $r8 I G D A F N
    1687 Ac— I W I A Q A Adm R $r8 I G D A F N
    1688 Ac— I W I A Q A hCha R $r8 I G D A F N
    1689 Ac— I W I A Q A hAdm R $r8 I G D A F N
    1690 Ac— I W I A Q A hF R $r8 I G D A F N
    1691 Ac— I W I A Q A Igl R $r8 I G D A F N
    1692 Ac— I W I A Q A F4CF3 R $r8 I G D A F N
    1693 Ac— I W I A Q A F4tBu R $r8 I G D A F N
    1694 Ac— I W I A Q A 2Nal R $r8 I G D A F N
    1695 Ac— I W I A Q A Bip R $r8 I G D A F N
    1696 Ac— I W I A Q A L R $r8 Cba G D A F N
    1697 Ac— I W I A Q A L R $r8 hL G D A F N
    1698 Ac— I W I A Q A L R $r8 Cha G D A F N
    1699 Ac— I W I A Q A L R $r8 Tba G D A F N
    1700 Ac— I W I A Q A L R $r8 hhL G D A F N
    1701 Ac— I AmW I A Q A L R $r8 I G D A F N
    1702 Ac— I Aib I A Q A L R $r8 I G D A F N
    1703 Ac— AmL W I A Q A L R $r8 I G D A F N
    1704 Ac— I W AmL A Q A L R $r8 I G D A F N
    1705 Ac— I W I Aib Q A L R $r8 I G AmD A F N
    1706 Ac— I W I A Aib A L R $r8 I G D A F N
    1707 Ac— I W I A Q A L R $r8 I G AmD A F N
    1708 Ac— I W I A Q A L R $r8 I G D A F N
    1709 Ac— I W Tba A Q A L R $r8 I G D A F N
    1710 Ac— I W hL A Q A L R $r8 I G D A F N
    1711 Ac— I W Chg A Q A L R $r8 I G D A F N
    1712 Ac— I W Ac6c A Q A L R $r8 I G D A F N
    1713 Ac— I W Ac5c A Q A L R $r8 I G D A F N
    1714 Ac— E W I A A A L R $r8 I G D A F N
    1715 Ac— R W I A A A L R $r8 I G D A F N
    1716 Ac— K W I A A A L R $r8 I G D A F N
    1717 Ac— H W I A A A L R $r8 I G D A F N
    1718 Ac— S W I A A A L R $r8 I G D A F N
    1719 Ac— Q W I A A A L R $r8 I G D A F N
    1720 Ac— A W I A A A L R $r8 I G D A F N
    1721 Ac— Aib W I A A A L R $r8 I G D A F N
    1722 Ac— F W I A A A L R $r8 I G D A F N
    1723 Ac— I D I A A A L R $r8 I G D A F N
    1724 Ac— I R I A A A L R $r8 I G D A F N
    1725 Ac— I H I A A A L R $r8 I G D A F N
    1726 Ac— I S I A A A L R $r8 I G D A F N
    1727 Ac— I N I A A A L R $r8 I G D A F N
    1728 Ac— I L I A A A L R $r8 I G D A F N
    1729 Ac— I F I A A A L R $r8 I G D A F N
    1730 Ac— I 2Nal I A A A L R $r8 I G D A F N
    1731 Ac— I W I S A A L R $r8 I G D A F N
    1732 Ac— I W I L A A L R $r8 I G D A F N
    1733 Ac— I W I F A A L R $r8 I G D A F N
    1734 Ac— I W I A L A L R $r8 I G D A F N
    1735 Ac— I W I A A A L K $r8 I G D A F N
    1736 Ac— I W I A A A L R $r8 I Abu D A F N
    1737 Ac— I W I A A A L R $r8 I V D A F N
    1738 Ac— I W I A A A L R $r8 I G E A F N
    1739 Ac— I W I A A A L R $r8 I G D A G N
    1740 Ac— I W I A Q A L R $r8 I G D A W N
    1741 Ac— I W I A Q A L R $r8 I G D A hF N
    1742 Ac— I W I A Q A L R $r8 I G D A F4CF3 N
    1743 Ac— I W I A Q A L R $r8 I G D A F4tBu N
    1744 Ac— I W I A Q A L R $r8 I G D A 2Nal N
    1745 Ac— I W I A Q A L R $r8 I G D A Bip N
    1746 Ac— I W I A A A L R $r8 I G D A F D
    1747 Ac— I W I A A A L R $r8 I G D A F E
    1748 Ac— I W I A A A L R $r8 I G D A F Q
    1749 Ac— I W I A A A L R $r8 I G D A F S
    1750 Ac— I W I A A A L R $r8 I G D A F H
    1751 Ac— I W I A A A L R $r8 I G D A F N
    1752 Ac— I W I A Q A L R $r8 I G D A F N
    1753 Ac— I W I A Q A L R $r8 I G D A F N
    1754 Ac— I W I A Q A L R $r8 I G D A F N
    1755 Ac— I W I A Q A L R $r8 I G D A F N
    1756 Ac— I W I A Q A L R $r8 I G D A F N
    1757 Ac— I W I A Q A L R $r8 I G D A F N
    1758 Ac— I W I A A A L R $r8 I G D A F N
    1759 Ac— I W I A A A L R $r8 I G D A F N
    1760 Ac— I W I A A A L R $r8 I G D A F N
    1761 Ac— I W I A A A L R $r8 I G D A F N
    1762 Ac— I W I A A A L R $r8 I G D A F N
    1763 Ac— I W I A A A L R $r8 I G D A F N
    1764 Ac— I W I A A A L R $r8 I G D A F N
    1765 Ac— I W I A Q A AmL R $r8 I G D A F N
    1766 Ac— I W I A Q A L R $r8 I G AmD A F N
    1767 Ac— I W I A Q A L R $r8 I G D A F N
    1768 Ac— I W I A Q A L R $r8 I G D A F N
    1769 Ac— I W I A Q A A Cit $r8 I G D A F N
    1770 Ac— I W I A Q A L Cit $r8 I G N A F N
    1771 Ac— I W I A Q A L Cit $r8 I G D A A N
    1772 Ac— I W I A Q A L Cit $r8 I G D A V N
    1773 Ac— I W I A Q A L R $r8 I G D A F N
    1774 Ac— I W I A Q A L R $r8 hL G D A F N
    1775 Ac— I W I A Q A L R $r8 hL G D A F N
    1776 Ac— I W I A Q A L R $r8 hL G D A F N
    1777 Ac— A W I A A A L R $r8 hL G D A F N
    1778 Ac— A W I A A A L R $r8 hL G D A F N
    1779 Ac— I W I A Q A A R $r8 hL G D A F N
    1780 Ac— I $r8 I A Q A L R St I G D E F N
    1781 Ac— I W I A $ A L R St I G D E F N
    1782 Ac— I W I A Q A L R $r8 I G D E F N
    SEQ
    ID Calc. Found EC50 Ki Ki Ki
    NO: 16 17 18 19 20 21 (M + 2)/2 mass (μM)* MCL-1 BCL-XL BCL-2
    1626 $ Y Y A R R —NH2 1344.74 1345.7 10.6 3.9 12.9
    1627 $ Y Y A R R —NH2 1373.75 1373.56 9.2 23.5
    1628 $ Y Y A —NH2 1103.1 1103.12 212.6 423.8
    1629 $ Y Y A —NH2 988.55 988.45 373.6 877.5
    1630 $ Y A A —NH2 964.04 963.94 >1000 >1000
    1631 $ Y Y A —NH2 1159.64 1159.87 6.6 8.4 22.4 84.8
    1632 $ Y Y A —NH2 1103.1 1102.94 410.2
    1633 $ Y Y A —NH2 1010.06 1009.9 308.6 519.2
    1634 $ Y Y A —NH2 981.55 981.86 255.9 318.7
    1635 $ Y Y A —NH2 967.53 967.45 >1000 >1000
    1636 $ Y Y A —NH2 1017.07 1016.93 243.1 272.5
    1637 $ Y Y A —NH2 972.04 971.89 >1000 >1000
    1638 $ A Y A —NH2 964.04 963.94 471.5 803.9
    1639 $ Y Y A —NH2 1185.17 1185.61 >40 19.5 11.6 8.7
    1640 % Y Y A —NH2 1160.14 1161.28
    1641 $ Y Y A —NH2 1167.14 1168.2 7.0 15.4 21.9
    1642 $ Y Y A —NH2 1150.13 1151.09
    1643 $ Y Y A —NH2 1368.67 1369.79 ND ND ND
    1644 $ Y Y A —NH2 1353.18 1354.13 ND ND ND
    1645 $ Y Y A —NH2 1382.18 1382.99 ND ND ND
    1646 $ Y Y A —NH2 1102.12 1103.17 19.7 22.3 37.7
    1647 $ Y Y A —NH2 1188.64 1189.57 >40 1.8 1.4 3.2
    1648 $ Y Y A —NH2 1188.15 1189.1 5.2 12.0 67.0
    1649 $ Y Y A —NH2 1160.13 1161.17 1.0 1.0 6.0
    1650 $ Y Y A —NH2 1159.64 1160.34 6.0 4.0 22.0
    1651 $ Y Y A —NH2 1131.13 1132.12 6.7 25.6 65.4
    1652 $ Y Y A —NH2 1138.14 1139.15 7.4 55.7 114.6
    1653 $ Y Y A —NH2 1160.13 1160.98 9.1 7.5 109.0 211.6
    1654 $ Y Y A —NH2 1188.64 1189.66 1.7 28.8 88.2
    1655 $ Y Y A —NH2 1150.12 1151.09 >1000 >1000 >1000
    1656 $ Y Y A —NH2 1178.63 1179.67 >1000 >1000 >1000
    1657 $ Y Y A —NH2 1145.62 1146.55 76.2 325.4 364.7
    1658 $ Y Y A —NH2 1174.13 1175.14 14.8 6.3 27.5
    1659 $ Y Y A —NH2 1121.62 1122.5 7.5 401.7 139.7
    1660 $ Y Y A —NH2 1142.65 1143.59 3.4 14.1 113.0
    1661 $ Y Y A —NH2 1171.16 1171.9
    1662 $ Y Y A —NH2 1100.6 1101.5 177.0 154.0 502.0
    1663 $ Y Y A —NH2 1166.65 1167.83 96.3 7.7 84.0
    1664 $ Y Y A —NH2 1195.16 1196.23 116.2 7.7 25.6
    1665 $ Y Y A —NH2 1138.62 1139.61 182.7 18.1 59.6
    1666 $ Y Y A —NH2 1167.13 1168.11 122.1 1.9 4.8
    1667 $ Y Y A —NH2 1176.63 1177.63 27.8 15.8 68.5
    1668 $ Y Y A —NH2 1205.14 1205.94 74.1 25.6 66.1
    1669 $ Y Y A —NH2 1176.63 1177.63 22.0 28.0 179.4
    1670 $ Y Y A —NH2 1205.14 1206.13 29.3 25.9 204.6
    1671 $ Y Y A —NH2 1117.11 1118.15 73.8 386.4 >1000
    1672 $ Y Y A —NH2 1159.15 1159.63 194.7 416.0 404.9
    1673 $ Y Y A —NH2 1138.62 1139.2 >1000 >1000 >1000
    1674 $ Y Y A —NH2 1166.65 1167.3 22.8 53.5 84.9
    1675 $ Y Y A —NH2 1179.65 1180.15 3.9 43.8 14.4 104.9
    1676 $ Y Y A —NH2 1173.65 1174.39 5.7 21.2 11.9 160.7
    1677 $ Y Y A —NH2 1198.66 1199.28 21.6 7.3 59.0
    1678 $ Y Y A —NH2 1186.66 1186.98 22.2 13.1 182.3
    1679 $ Y Y A —NH2 1183.64 1184.48 7.2 53.1 69.7 221.2
    1680 $ Y Y A —NH2 1190.65 1190.41 5.9 12.8 145.5 246.4
    1681 $ Y Y A —NH2 1210.62 1211.31 76.7 9.1 237.0
    1682 $ Y Y A —NH2 1204.66 1205.39 150.8 16.9 >1000
    1683 $ Y Y A —NH2 1201.64 1202.2 4.8 163.2 151.1 264.6
    1684 $ Y Y A —NH2 1214.65 1215.43 6.4 11.0 3.0 >1000
    1685 $ Y Y A —NH2 1179.65 1180.22 4.2 81.1 >1000
    1686 $ Y Y A —NH2 1173.65 1174.4 3.1 135.9 231.4
    1687 $ Y Y A —NH2 1198.66 1199.05 0.5 40.2 109.5 >1000
    1688 $ Y Y A —NH2 1186.66 1187.25 3.8 >1000 >1000
    1689 $ Y Y A —NH2 1205.67 1206.4 16.6 >1000 240.3
    1690 $ Y Y A —NH2 1183.64 1184.29 7.5 >1000 >1000
    1691 $ Y Y A —NH2 1190.65 1190.4 47.7 146.7 >1000
    1692 $ Y Y A —NH2 1210.62 1210.94 188.1 10.8 >1000
    1693 $ Y Y A —NH2 1204.66 1205.29 169.0 12.7 288.0
    1694 $ Y Y A —NH2 1201.64 1202.15 119.7 17.3 234.4
    1695 $ Y Y A —NH2 1214.65 1214.91 83.7 8.0 280.1
    1696 $ Y Y A —NH2 1165.64 1166.07 26.6 27.5 89.0
    1697 $ Y Y A —NH2 1166.65 1167.37 13.0 6.0 12.7
    1698 $ Y Y A —NH2 1179.65 1180.22 15.9 7.1 109.1
    1699 $ Y Y A —NH2 1166.65 1167.18 13.7 35.4 227.1
    1700 $ Y Y A —NH2 1173.65 1173.93 34.6 4.0 23.1
    1701 $ Y Y A —NH2 1166.65 1167.18 9.9 17.4 70.6
    1702 $ Y Y A —NH2 1109.13 1109.46 42.5 83.5 97.9
    1703 $ Y Y A —NH2 1166.65 1167.27 5.2 8.4 48.3
    1704 $ Y Y A —NH2 1166.65 1137.37 19.8 7.2 24.8
    1705 $ Y Y A —NH2 1173.65 1173.93 >1000 >1000 >1000
    1706 $ Y Y A —NH2 1138.14 1138.32 5.5 59.0 120.1
    1707 $ Y Y A —NH2 1166.65 1167.37 >40 >1000 15.5 >1000
    1708 $ Y F4F A —NH2 1160.64 1161.45 2.1 4.8 9.5 91.8
    1709 $ Y Y A —NH2 1166.65 1167.37 10.9 17.2 36.6
    1710 $ Y Y A —NH2 1166.65 1167.37 3.7 17.0 36.5
    1711 $ Y Y A —NH2 1172.65 1173.47 4.6 20.9 38.9
    1712 $ Y Y A —NH2 1165.64 1166.44 10.4 7.7 25.7
    1713 $ Y Y A —NH2 1158.63 1159.32 8.9 8.4 68.2
    1714 $ Y Y A —NH2 1139.11 1139.52 2.2 72.0 117.8
    1715 $ Y Y A —NH2 1152.64 1153.49 4.5 32.8 47.8
    1716 $ Y Y A —NH2 1138.63 1138.97 3.9 27.2 49.7
    1717 $ Y Y A —NH2 1143.12 1143.87 3.6 25.2 52.0
    1718 $ Y Y A —NH2 1118.1 1118.8 3.9 33.4 53.2
    1719 $ Y Y A —NH2 1138.62 1139.24 4.8 35.9 64.9
    1720 $ Y Y A —NH2 1110.1 1110.75 3.8 32.6 63.9
    1721 $ Y Y A —NH2 1117.11 1117.78 4.0 20.3 56.0
    1722 $ Y Y A —NH2 1148.12 1148.96 6.2 33.9 76.7
    1723 $ Y Y A —NH2 1095.6 1096.32 3.0 36.3 41.1
    1724 $ Y Y A —NH2 1116.14 1116.95 9.8 20.5 39.1
    1725 $ Y Y A —NH2 1106.62 1107.24 6.6 19.5 43.0
    1726 $ Y Y A —NH2 1081.6 1181.98 15.3 56.2 89.5
    1727 $ Y Y A —NH2 1095.11 1095.58 11.2 37.3 62.5
    1728 $ Y Y A —NH2 1094.63 1095.3 10.2 71.8 125.6
    1729 $ Y Y A —NH2 1111.62 1112.33 10.2 45.3 95.9
    1730 $ Y Y A —NH2 1136.63 1137.3 13.7 55.3 144.3
    1731 $ Y Y A —NH2 1139.13 1139.89 3.6 67.8 117.2
    1732 $ Y Y A —NH2 1152.15 1152.94 19.7 96.2 170.5
    1733 $ Y Y A —NH2 1169.14 1169.86 17.2 109.9 125.0
    1734 $ Y Y A —NH2 1152.15 1152.84 11.6 37.9 75.8
    1735 $ Y Y A —NH2 1117.13 1117.97 23.2 11.7 25.6
    1736 $ Y Y A —NH2 1145.14 1145.9 106.2 112.2 130.6
    1737 $ Y Y A —NH2 1152.15 1152.94 104.3 139.5 119.8
    1738 $ Y Y A —NH2 1138.14 1138.87 63.6 135.4 141.9
    1739 $ Y Y A —NH2 1086.1 1086.89 29.7 171.4 145.1
    1740 $ Y Y A —NH2 1179.14 1180.04 2.3 14.5 17.7
    1741 $ Y Y A —NH2 1166.65 1167.46 2.7 16.6 38.9
    1742 $ Y Y A —NH2 1193.63 1194.38 8.2 107.4 103.8
    1743 $ Y Y A —NH2 1187.67 1188.36 21.2 154.1 158.3
    1744 $ Y Y A —NH2 1184.65 1185.5 4.4 19.1 35.1
    1745 $ Y Y A —NH2 1197.65 1198.54 6.5 100.2 113.5
    1746 $ Y Y A —NH2 1131.62 1132.4 1.5 25.9 35.3
    1747 $ Y Y A —NH2 1138.63 1139.02 1.8 17.9 30.7
    1748 $ Y Y A —NH2 1138.14 1138.84 4.9 36.5 71.6
    1749 $ Y Y A —NH2 1117.62 1118.5 8.0 44.1 67.5
    1750 $ Y Y A —NH2 1142.64 1143.25 8.0 36.3 57.4
    1751 $ L Y A —NH2 1106.14 1107.05 17.6 69.9 124.9
    1752 $ Y A A —NH2 1113.63 1114.27 20.3 51.8 102.0
    1753 $ Y L A —NH2 1134.65 1135.33 23.4 9.0 18.9
    1754 $ Y Cha A —NH2 1154.66 1155.31 24.1 8.6 28.9
    1755 $ Y hF A —NH2 1158.65 1159.5 8.0 12.1 30.7
    1756 $ Y W A —NH2 1171.15 1171.78 3.9 15.4 23.5
    1757 $ Y 2Nal A —NH2 1176.65 1177 8.0 26.1 65.2
    1758 $ Y Y D —NH2 1153.12 1153.77 2.2 116.4 137.9
    1759 $ Y Y E —NH2 1160.13 1160.8 1.4 45.4 56.4
    1760 $ Y Y Q —NH2 1159.64 1160.26 4.6 41.1 64.7
    1761 $ Y Y S —NH2 1139.13 1139.47 4.7 36.0 62.4
    1762 $ Y Y H —NH2 1164.14 1165.05 10.6 73.8 98.8
    1763 $ Y Y R —NH2 1173.66 1174.4 18.5 185.9 141.8
    1764 $ Y Y K —NH2 1159.66 1160.26 6.6 66.3 43.4
    1765 $ Y Y A —NH2 1166.65 1167.18 0.98 86.6 >1000 >1000
    1766 $ Y Y A —NH2 1166.65 1167.46 15.2 >1000 205.5 >1000
    1767 $ F4F Y A —NH2 1160.64 1161.26 1.4 14.9 26.0 199.8
    1768 $ Y Y Aib —NH2 1166.65 1167.46 4.6 29.0 >1000 218.1
    1769 $ Y Y A —NH2 1139.11 1139.71 15.3 >1000 85.0 >1000
    1770 $ Y Y A —NH2 1159.64 1160.4 5.0 >1000 >1000 >1000
    1771 $ Y Y A —NH2 1122.12 1122.87 19.3 39.5 >1000 >1000
    1772 $ Y Y A —NH2 1136.13 1136.47 5.8 0.8 >1000 >1000
    1773 $ A Y A —NH2 1113.63 1113.9 4.0 5.3 12.6 111.6
    1774 $ F4F Y A —NH2 1167.64 1168.57 1.0 58.0 43.0
    1775 $ Y F4F A —NH2 1167.64 1168.2 0.7 27.0 13.0
    1776 $ F4F F4F A —NH2 1168.64 1169.59 0.7 127.0 121.0
    1777 $ Y F4F A —NH2 1118.11 1118.89 0.6 52.0 37.0
    1778 $ A F4F A —NH2 1072.1 1072.92 0.9 23.0 9.0
    1779 $ F4F F4F A —NH2 1147.62 1148.59 0.5 >1000 >1000
    1780 $s8 Y Y A —NH2 1199.18 1199.74 >40 1.1 1.1 22.0
    1781 $s8 Y Y A —NH2 1207.17 1207.7 >40 1.6 1.6 19.2
    1782 St Y Y A $r5 A —NH2 1306.72 1307.42 >40 11.6 24.2 57.7
    *Raji Cell Viability, 48 h, 5% serum
    • Example 3 Dose-Dependent Cell Killing By Peptidomimetic Macrocycles
  • BIM peptidomimetic macrocycles were tested for cell killing at various concentrations. Human Raji cells were treated with increasing doses of peptidomimetic macrocycles corresponding to SEQ ID NO. 763 (FIGS. 1 and 2), 1143 (FIGS. 1-3), and 1621 (FIGS. 3 and 4). An % Viable cells was calculated for each dose of the peptidomimetic macrocycle from a non-linear fit of response vs dose (GraphPad Prism). The effect of the peptidomimetic macrocycles corresponding to SEQ ID NO. 763 are presented in FIGS. 1 and 2. The effect of the peptidomimetic macrocycles corresponding to SEQ ID NO. 1143 are presented in FIGS. 1-3. The effect of the peptidomimetic macrocycles corresponding to SEQ ID NO. 1621 are presented in FIGS. 3 and 4.
    • Example 4 MCL-1 Displacement Study
  • BIM peptidomimetic macrocycles were tested for displacement of MCL-1 from a BAK fluorescence resonance energy transfer (FRET) peptide. Human Raji cells were treated with DMSO, ABT-263, and peptidomimetic macrocycles corresponding to SEQ ID NO. 763 and 1143. FIG. 5 shows the effect of the compounds on normalized BAK peptide FRET signal.
    • Example 5 Pharmacokinetic (PK) and Biodistribution Study in Mice
  • A peptidomimetic macrocycle corresponding to SEQ ID NO. 763 was administered to mice at a 5 mg/kg dose. Mice were sacrificed at specific timepoints both before and after dosing, up to 24 hours post-administration. Blood, liver, and spleen were collected from the mice at the specific time points. Plasma was prepared from the blood using K2EDTA tubes by centrifuging for 20 minutes at 4° C. at 2000G maximum 30 minutes after collection. From each plasma sample, an aliquot was transferred to a fresh tube for PK studies. From each liver and spleen sample, tissue was homogenized and extracts were prepared for biodistribution studies. FIG. 6 shows the PK and biodistribution results for this study by concentration in nanograms of peptidomimetic macrocycle per gram mouse body weight (ng/g) over time.
    • Example 6 Human Plasma Stability Study
  • Peptidomimetic macrocycles corresponding to SEQ ID NO. 763 or 1143 were administered to humans. Blood was collected at specific timepoints both before and after dosing, up to 24 hours post-administration. Plasma was prepared from the blood using K2EDTA tubes by centrifuging for 20 minutes at 4° C. at 2000G maximum 30 minutes after collection. From each plasma sample, an aliquot was transferred to a fresh tube for plasma stability studies. FIG. 7 shows the plasma stability results for this study as a percentage of peptidomimetic macrocycle remaining in plasma over time, with the dashed line corresponding to the initial amount of peptidomimetic macrocycle dosed.

Claims (20)

1-162. (canceled)
163. A peptidomimetic macrocycle of Formula (I):
Figure US20180340009A1-20181129-C00137
or a pharmaceutically acceptable salt thereof,
wherein
each A, B, C, D, and E is independently an amino acid and the terminal D and E independently optionally include a capping group;
L is a macrocycle-forming linker;
L′ is alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, arylene, or heteroarylene, optionally substituted with R5, or a bond; R1 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, cycloalkylalkyl, heteroalkyl, or heterocycloalkyl, each being optionally substituted with halo-; or R1 and L′ together with the atom to which both R1 and L′ are bound form a ring;
L″ is alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, arylene, or heteroarylene, optionally substituted with R5, or a bond; R2 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, cycloalkylalkyl, heteroalkyl, or heterocycloalkyl, each being optionally substituted with halo-; or R2 and L″ together with the atom to which both R2 and L″ are bound form a ring;
each R5 is independently halogen, alkyl, —OR6, —N(R6)2, —SR6, —SOR6, —SO2R6, —CO2R6, a fluorescent moiety, a radioisotope, or a therapeutic agent;
each R6 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkylalkyl, heterocycloalkyl, a fluorescent moiety, a radioisotope, or a therapeutic agent;
each R7 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, aryl, or heteroaryl, each being optionally substituted with R5, or part of a cyclic structure with a D residue;
each R8 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, aryl, or heteroaryl, each being optionally substituted with R5, or part of a cyclic structure with an E residue;
v is 1-10;
w is an integer from 1-1000;
u is 1; and
each x, y, and z is an integer such that x+y+z is 3;
wherein [A]x-[B]y-[C]z comprises an isoleucine (Ile) and an aspartic acid (Asp) and [E]w comprises an arginine (Arg) and a histidine (His).
164. The peptidomimetic macrocycle of claim 163, wherein R1 and L′ together with the atom to which both R1 and L′ are bound form a ring.
165. The peptidomimetic macrocycle of claim 163, wherein R2 and L″ together with the atom to which both R2 and L″ are bound form a ring.
166. The peptidomimetic macrocycle of claim 163, wherein the peptidomimetic macrocycle comprises an α-helix.
167. The peptidomimetic macrocycle of claim 163, wherein -[A]x-[B]y-[C]z- is -Ile-[B]1-Asp-.
168. The peptidomimetic macrocycle of claim 163, wherein B is a hydrophobic amino acid.
169. The peptidomimetic macrocycle of claim 163, wherein [E]w comprises two arginines.
170. The peptidomimetic macrocycle of claim 163, wherein R2 is methyl.
171. The peptidomimetic macrocycle of claim 163, wherein both R7 and R8 are hydrogen.
172. The peptidomimetic macrocycle of claim 163, wherein w is an integer from 1-15.
173. The peptidomimetic macrocycle of claim 163, wherein L′ and L″ is each independently alkylene, alkenylene, or alkynylene.
174. A pharmaceutical composition comprising
(i) a peptidomimetic macrocycle of Formula (I):
Figure US20180340009A1-20181129-C00138
or a pharmaceutically acceptable salt thereof,
wherein
each A, B, C, D, and E is independently an amino acid and the terminal D and E independently optionally include a capping group;
L is a macrocycle-forming linker;
L′ is alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, arylene, or heteroarylene, optionally substituted with R5, or a bond; R1 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, cycloalkylalkyl, heteroalkyl, or heterocycloalkyl, each being optionally substituted with halo-; or R1 and L′ together with the atom to which both R1 and L′ are bound form a ring;
L″ is alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, arylene, or heteroarylene, optionally substituted with R5, or a bond; R2 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, cycloalkylalkyl, heteroalkyl, or heterocycloalkyl, each being optionally substituted with halo-; or R2 and L″ together with the atom to which both R2 and L″ are bound form a ring;
each R5 is independently halogen, alkyl, —OR6, —N(R6)2, —SR6, —SOR6, —SO2R6, —CO2R6, a fluorescent moiety, a radioisotope, or a therapeutic agent;
each R6 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkylalkyl, heterocycloalkyl, a fluorescent moiety, a radioisotope, or a therapeutic agent;
each R7 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, aryl, or heteroaryl, each being optionally substituted with R5, or part of a cyclic structure with a D residue;
each R8 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, aryl, or heteroaryl, each being optionally substituted with R5, or part of a cyclic structure with an E residue;
v is 1-10;
w is an integer from 1-1000;
u is 1; and
each x, y, and z is an integer such that x+y+z is 3;
wherein [A]x-[B]y-[C]z comprises an isoleucine (Ile) and an aspartic acid (Asp) and [E]w comprises an arginine (Arg) and a histidine (His); and
(ii) a pharmaceutically-acceptable carrier.
175. A method of treating a cancer in a subject, the method comprising administering to the subject suffering from the cancer a therapeutically-effective amount of a peptidomimetic macrocycle of Formula (I):
Figure US20180340009A1-20181129-C00139
or a pharmaceutically acceptable salt thereof,
wherein
each A, B, C, D, and E is independently an amino acid and the terminal D and E independently optionally include a capping group;
L is a macrocycle-forming linker;
L′ is alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, arylene, or heteroarylene, optionally substituted with R5, or a bond; R1 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, cycloalkylalkyl, heteroalkyl, or heterocycloalkyl, each being optionally substituted with halo-; or R1 and L′ together with the atom to which both R1 and L′ are bound form a ring;
L″ is alkylene, alkenylene, alkynylene, heteroalkylene, cycloalkylene, heterocycloalkylene, arylene, or heteroarylene, optionally substituted with R5, or a bond; R2 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, cycloalkylalkyl, heteroalkyl, or heterocycloalkyl, each being optionally substituted with halo-; or R2 and L″ together with the atom to which both R2 and L″ are bound form a ring;
each R5 is independently halogen, alkyl, —OR6, —N(R6)2, —SR6, —SOR6, —SO2R6, —CO2R6, a fluorescent moiety, a radioisotope, or a therapeutic agent;
each R6 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkylalkyl, heterocycloalkyl, a fluorescent moiety, a radioisotope, or a therapeutic agent;
each R7 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, aryl, or heteroaryl, each being optionally substituted with R5, or part of a cyclic structure with a D residue;
each R8 is independently —H, alkyl, alkenyl, alkynyl, arylalkyl, cycloalkyl, heteroalkyl, cycloalkylalkyl, heterocycloalkyl, aryl, or heteroaryl, each being optionally substituted with R5, or part of a cyclic structure with an E residue;
v is 1-10;
w is an integer from 1-1000;
u is 1; and
each x, y, and z is an integer such that x+y+z is 3;
wherein [A]x-[B]y-[C]z comprises an isoleucine (Ile) and an aspartic acid (Asp) and [E]w comprises at an arginine (Arg) and a histidine (His).
176. The method of claim 176, wherein R1 and L′ together with the atom to which both R1 and L′ are bound form a ring.
177. The method of claim 176, wherein R2 and L″ together with the atom to which both R2 and L″ are bound form a ring.
178. The method of claim 176, wherein the peptidomimetic macrocycle comprises an a-helix.
179. The method of claim 176, wherein -[A]x-[B]y-[C]z- is -Ile-[B]1-Asp-.
180. The method of claim 176, wherein the cancer is colorectal cancer, liver cancer, breast cancer, prostate cancer, uterine cancer, or lung cancer.
181. The method of claim 176, further comprising administering to the subject an additional therapy to treat the cancer.
US15/982,700 2015-09-10 2018-05-17 Peptidomimetic macrocycles as modulators of mcl-1 Abandoned US20180340009A1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US15/982,700 US20180340009A1 (en) 2015-09-10 2018-05-17 Peptidomimetic macrocycles as modulators of mcl-1

Applications Claiming Priority (3)

Application Number Priority Date Filing Date Title
US201562216683P 2015-09-10 2015-09-10
US15/259,947 US10023613B2 (en) 2015-09-10 2016-09-08 Peptidomimetic macrocycles as modulators of MCL-1
US15/982,700 US20180340009A1 (en) 2015-09-10 2018-05-17 Peptidomimetic macrocycles as modulators of mcl-1

Related Parent Applications (1)

Application Number Title Priority Date Filing Date
US15/259,947 Continuation US10023613B2 (en) 2015-09-10 2016-09-08 Peptidomimetic macrocycles as modulators of MCL-1

Publications (1)

Publication Number Publication Date
US20180340009A1 true US20180340009A1 (en) 2018-11-29

Family

ID=58240031

Family Applications (2)

Application Number Title Priority Date Filing Date
US15/259,947 Expired - Fee Related US10023613B2 (en) 2015-09-10 2016-09-08 Peptidomimetic macrocycles as modulators of MCL-1
US15/982,700 Abandoned US20180340009A1 (en) 2015-09-10 2018-05-17 Peptidomimetic macrocycles as modulators of mcl-1

Family Applications Before (1)

Application Number Title Priority Date Filing Date
US15/259,947 Expired - Fee Related US10023613B2 (en) 2015-09-10 2016-09-08 Peptidomimetic macrocycles as modulators of MCL-1

Country Status (5)

Country Link
US (2) US10023613B2 (en)
EP (1) EP3347372A4 (en)
JP (1) JP2018528217A (en)
CN (1) CN108368161A (en)
WO (1) WO2017044633A1 (en)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2020190827A1 (en) * 2019-03-21 2020-09-24 Merck Sharp & Dohme Corp. Inhibitors of histone deacetylase useful for the treatment or prevention of hiv infection

Families Citing this family (24)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN101636407B (en) 2006-12-14 2015-08-26 爱勒让治疗公司 Bis-sulfhydryl macrocyclization systems
JP5649825B2 (en) 2007-01-31 2015-01-07 デイナ ファーバー キャンサー インスティチュート，インコーポレイテッド Stabilized p53 peptides and methods of use thereof
ES2649941T3 (en) 2007-02-23 2018-01-16 Aileron Therapeutics, Inc. Substituted amino acids to prepare triazole-linked macrocyclic peptides
ES2430067T3 (en) 2007-03-28 2013-11-18 President And Fellows Of Harvard College Sewn polypeptides
JP2012515172A (en) 2009-01-14 2012-07-05 エルロン・セラピューティクス・インコーポレイテッド Peptidomimetic macrocycle
JP2013505300A (en) 2009-09-22 2013-02-14 エルロン・セラピューティクス・インコーポレイテッド Peptidomimetic macrocycle
KR20170058446A (en) 2010-08-13 2017-05-26 에일러론 테라퓨틱스 인코포레이티드 Peptidomimetic macrocycles
RU2639523C2 (en) 2011-10-18 2017-12-21 Эйлерон Терапьютикс, Инк. Peptidomimetic macrocycles and their application
CA2862038C (en) 2012-02-15 2021-05-25 Aileron Therapeutics, Inc. Peptidomimetic macrocycles
CA2864120A1 (en) 2012-02-15 2013-08-22 Aileron Therapeutics, Inc. Triazole-crosslinked and thioether-crosslinked peptidomimetic macrocycles
JP6526563B2 (en) 2012-11-01 2019-06-05 エイルロン セラピューティクス，インコーポレイテッド Disubstituted amino acids and methods for their preparation and use
WO2014138429A2 (en) 2013-03-06 2014-09-12 Aileron Therapeutics, Inc. Peptidomimetic macrocycles and use thereof in regulating hif1alpha
MX2017003797A (en) 2014-09-24 2017-06-15 Aileron Therapeutics Inc Peptidomimetic macrocycles and uses thereof.
CA2961029A1 (en) 2014-09-24 2016-03-31 Aileron Therapeutics, Inc. Peptidomimetic macrocycles and formulations thereof
CN107614003A (en) 2015-03-20 2018-01-19 艾瑞朗医疗公司 Peptidomimetic macrocyclic compound and application thereof
WO2017004548A1 (en) 2015-07-01 2017-01-05 Aileron Therapeutics, Inc. Peptidomimetic macrocycles
US11078246B2 (en) * 2015-08-28 2021-08-03 Dana-Farber Cancer Institute, Inc. Peptides binding to Bfl-1
US10023613B2 (en) 2015-09-10 2018-07-17 Aileron Therapeutics, Inc. Peptidomimetic macrocycles as modulators of MCL-1
FR3072679B1 (en) * 2017-10-25 2020-10-30 Servier Lab NEW MACROCYCLIC DERIVATIVES, THEIR PREPARATION PROCESS AND THE PHARMACEUTICAL COMPOSITIONS CONTAINING THEM
CA3079758A1 (en) 2017-12-15 2019-06-20 Dana-Farber Cancer Institute, Inc. Selective targeting of apoptosis proteins by structurally-stabilized and/or cysteine-reactive noxa peptides
WO2020023502A1 (en) 2018-07-23 2020-01-30 Aileron Therapeutics, Inc. Peptidomimetic macrocycles and uses thereof
CN109731104A (en) * 2018-12-29 2019-05-10 苏州明基医院有限公司 A kind of polypeptide-rare earth material delivery system and preparation method and application
EP3981784A1 (en) * 2020-10-07 2022-04-13 Technische Universität Dresden Regulators of cell division
KR102530956B1 (en) * 2022-09-08 2023-05-11 주식회사 알츠코리아 Alzheimer's disease vaccine composition comprising epitope derived from amyloid beta as effective component and thereof

Family Cites Families (328)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4000259A (en) 1975-06-16 1976-12-28 American Home Products Corporation Cyclic dodecapeptide analogs of somatostatin and intermediates
US4438270A (en) 1977-07-11 1984-03-20 Merrell Toraude Et Compagnie α-Halomethyl derivatives of α-amino acids
US4191754A (en) 1979-02-28 1980-03-04 Merck & Co., Inc. Bicyclic somatostatin analogs
US4270537A (en) 1979-11-19 1981-06-02 Romaine Richard A Automatic hypodermic syringe
AU550730B2 (en) 1982-03-09 1986-04-10 Commonwealth Of Australia, The Automated metal detection
US4596556A (en) 1985-03-25 1986-06-24 Bioject, Inc. Hypodermic injection apparatus
US4730006A (en) 1986-01-27 1988-03-08 Merrell Dow Pharmaceuticals Inc. Derivatives of 2,6-diamino-3-haloheptanedioic acid
CA1283827C (en) 1986-12-18 1991-05-07 Giorgio Cirelli Appliance for injection of liquid formulations
GB8704027D0 (en) 1987-02-20 1987-03-25 Owen Mumford Ltd Syringe needle combination
US4940460A (en) 1987-06-19 1990-07-10 Bioject, Inc. Patient-fillable and non-invasive hypodermic injection device assembly
US4941880A (en) 1987-06-19 1990-07-17 Bioject, Inc. Pre-filled ampule and non-invasive hypodermic injection device assembly
US4790824A (en) 1987-06-19 1988-12-13 Bioject, Inc. Non-invasive hypodermic injection device
US5339163A (en) 1988-03-16 1994-08-16 Canon Kabushiki Kaisha Automatic exposure control device using plural image plane detection areas
WO1989009233A1 (en) 1988-03-24 1989-10-05 Terrapin Technologies, Inc. Molecular sticks for controlling protein conformation
US5094951A (en) 1988-06-21 1992-03-10 Chiron Corporation Production of glucose oxidase in recombinant systems
FR2638359A1 (en) 1988-11-03 1990-05-04 Tino Dalto SYRINGE GUIDE WITH ADJUSTMENT OF DEPTH DEPTH OF NEEDLE IN SKIN
US5384309A (en) 1989-07-17 1995-01-24 Genentech, Inc. Cyclized peptides and their use as platelet aggregation inhibitors
US5120859A (en) 1989-09-22 1992-06-09 Genentech, Inc. Chimeric amino acid analogues
US5650133A (en) 1990-01-19 1997-07-22 Nycomed Salutar Macrocyclic polyaza dichelates linked through ring nitrogens via an amide or ester functionality
US5712418A (en) 1989-10-23 1998-01-27 Research Corporation Technologies, Inc. Synthesis and use of amino acid fluorides as peptide coupling reagents
US5312335A (en) 1989-11-09 1994-05-17 Bioject Inc. Needleless hypodermic injection device
US5064413A (en) 1989-11-09 1991-11-12 Bioject, Inc. Needleless hypodermic injection device
US5245009A (en) 1990-03-23 1993-09-14 The Salk Institute For Biological Studies CRF antagonists
CA2047042A1 (en) 1990-07-19 1992-01-20 John Hannah Cyclic hiv principal neutralizing determinant peptides
US5190521A (en) 1990-08-22 1993-03-02 Tecnol Medical Products, Inc. Apparatus and method for raising a skin wheal and anesthetizing skin
HUT63859A (en) 1990-10-11 1993-10-28 Boehringer Ingelheim Kg Process for producing cyclopeptides and pharmaceutical compositions comprising same
DE69118826T2 (en) 1990-11-27 1996-11-14 Fuji Photo Film Co Ltd Propenamide derivatives, their polymers, copolymers and their use
US5124454A (en) 1990-11-30 1992-06-23 Minnesota Mining And Manufacturing Company Polycyclic diamines and method of preparation
US5527288A (en) 1990-12-13 1996-06-18 Elan Medical Technologies Limited Intradermal drug delivery device and method for intradermal delivery of drugs
EP0573608A1 (en) 1991-02-07 1993-12-15 Molecumetics, Ltd. Conformationally restricted mimetics of beta turns and beta bulges and peptides containing the same
US5747469A (en) 1991-03-06 1998-05-05 Board Of Regents, The University Of Texas System Methods and compositions comprising DNA damaging agents and p53
US5364851A (en) 1991-06-14 1994-11-15 International Synthecon, Llc Conformationally restricted biologically active peptides, methods for their production and uses thereof
CA2072249C (en) 1991-06-28 2003-06-17 Saiko Hosokawa Human monoclonal antibody specifically binding to surface antigen of cancer cell membrane
GB9114949D0 (en) 1991-07-11 1991-08-28 Smithkline Beecham Plc Novel compounds
ATE155486T1 (en) 1991-08-13 1997-08-15 Takeda Chemical Industries Ltd CYCLIC PEPTIDES AND THEIR USE
GB9118204D0 (en) 1991-08-23 1991-10-09 Weston Terence E Needle-less injector
US7517644B1 (en) 1991-08-23 2009-04-14 Larry J. Smith Method and compositions for cellular reprogramming
SE9102652D0 (en) 1991-09-13 1991-09-13 Kabi Pharmacia Ab INJECTION NEEDLE ARRANGEMENT
IL103252A (en) 1991-09-30 1997-03-18 Du Pont Merck Pharma CYCLIC COMPOUNDS USEFUL AS INHIBITORS OF PLATELET GLYCOPROTEIN IIb/IIIa AND PHARMACEUTICAL COMPOSITIONS CONTAINING THEM
ES2133295T3 (en) 1991-11-19 1999-09-16 Takeda Chemical Industries Ltd CYCLIC PEPTIDES AND THEIR USE.
US5328483A (en) 1992-02-27 1994-07-12 Jacoby Richard M Intradermal injection device with medication and needle guard
EP1253156A3 (en) 1992-04-03 2004-01-07 California Institute Of Technology High activity ruthenium or osmium metal carbene complexes for olefin metathesis reactions and synthesis and application thereof
US5411860A (en) 1992-04-07 1995-05-02 The Johns Hopkins University Amplification of human MDM2 gene in human tumors
DE69326064T2 (en) 1992-05-26 2000-05-25 Rijksuniversiteit Te Leiden Le Human protein P53 peptides for use in human cytotoxic T cell response inducing compositions and human P53 protein specific T lymphocytes
US5383851A (en) 1992-07-24 1995-01-24 Bioject Inc. Needleless hypodermic injection device
US5569189A (en) 1992-09-28 1996-10-29 Equidyne Systems, Inc. hypodermic jet injector
US5334144A (en) 1992-10-30 1994-08-02 Becton, Dickinson And Company Single use disposable needleless injector
EP0691987A1 (en) 1993-03-29 1996-01-17 The Du Pont Merck Pharmaceutical Company CYCLIC COMPOUNDS USEFUL AS INHIBITORS OF PLATELET GLYCOPROTEIN IIb/IIIa
AU6770794A (en) 1993-04-23 1994-11-21 Herbert J. Evans Polypeptides that include conformation-constraining groups which flank a protein-protein interaction site
US5446128A (en) 1993-06-18 1995-08-29 The Board Of Trustees Of The University Of Illinois Alpha-helix mimetics and methods relating thereto
US5622852A (en) 1994-10-31 1997-04-22 Washington University Bcl-x/Bcl-2 associated cell death regulator
US5536814A (en) 1993-09-27 1996-07-16 La Jolla Cancer Research Foundation Integrin-binding peptides
AU1211895A (en) 1993-11-22 1995-06-13 Onyx Pharmaceuticals P53-binding polypeptides and polynucleotides encoding same
US6287787B1 (en) 1993-11-24 2001-09-11 Torrey Pines Institute For Molecular Studies Dimeric oligopeptide mixture sets
EP0746557A4 (en) 1994-02-18 1997-05-02 Cell Therapeutics Inc Intracellular signalling mediators
WO1995024176A1 (en) 1994-03-07 1995-09-14 Bioject, Inc. Ampule filling device
US5466220A (en) 1994-03-08 1995-11-14 Bioject, Inc. Drug vial mixing and transfer device
US5824483A (en) 1994-05-18 1998-10-20 Pence Inc. Conformationally-restricted combinatiorial library composition and method
IL109943A (en) 1994-06-08 2006-08-01 Develogen Israel Ltd Conformationally constrained backbone cyclized peptide analogs
US6407059B1 (en) 1994-06-08 2002-06-18 Peptor Limited Conformationally constrained backbone cyclized peptide analogs
US7553929B2 (en) 1994-06-13 2009-06-30 Vanderbilt University Cell permeable peptides for inhibition of inflammatory reactions and methods of use
US5807746A (en) 1994-06-13 1998-09-15 Vanderbilt University Method for importing biologically active molecules into cells
US5770377A (en) 1994-07-20 1998-06-23 University Of Dundee Interruption of binding of MDM2 and P53 protein and therapeutic application thereof
US5702908A (en) 1994-07-20 1997-12-30 University Of Dundee Interruption of binding of MDM2 and p53 protein and therapeutic application thereof
CN1132012C (en) 1994-09-19 2003-12-24 里卡尔多·J·莫罗 Detection and treatment of cancer
JP3817739B2 (en) 1994-12-29 2006-09-06 マサチューセッツ・インスティテュート・オブ・テクノロジー Chimeric DNA binding protein
US5599302A (en) 1995-01-09 1997-02-04 Medi-Ject Corporation Medical injection system and method, gas spring thereof and launching device using gas spring
US6169073B1 (en) 1995-02-16 2001-01-02 Bayer Corporation Peptides and peptidomimetics with structural similarity to human p53 that activate p53 function
EP0729972A1 (en) 1995-02-28 1996-09-04 F. Hoffmann-La Roche Ag Peptide derivatives of tetrahydronaphthalene
US5675001A (en) 1995-03-14 1997-10-07 Hoffman/Barrett, L.L.C. Heteroatom-functionalized porphyrazines and multimetallic complexes and polymers derived therefrom
US6514942B1 (en) 1995-03-14 2003-02-04 The Board Of Regents, The University Of Texas System Methods and compositions for stimulating T-lymphocytes
US5731408A (en) 1995-04-10 1998-03-24 Arizona Board Of Regents On Behalf Of The University Of Arizona Peptides having potent antagonist and agonist bioactivities at melanocortin receptors
US6054556A (en) 1995-04-10 2000-04-25 The Arizona Board Of Regents On Behalf Of The University Of Arizona Melanocortin receptor antagonists and agonists
US5672584A (en) 1995-04-25 1997-09-30 The University Of Kansas Cyclic prodrugs of peptides and peptide nucleic acids having improved metabolic stability and cell membrane permeability
US6184344B1 (en) 1995-05-04 2001-02-06 The Scripps Research Institute Synthesis of proteins by native chemical ligation
CA2218620C (en) 1995-05-04 2007-02-27 Stephen B. H. Kent Synthesis of proteins by native chemical ligation
US5730723A (en) 1995-10-10 1998-03-24 Visionary Medical Products Corporation, Inc. Gas pressured needle-less injection device and method
US5817789A (en) 1995-06-06 1998-10-06 Transkaryotic Therapies, Inc. Chimeric proteins for use in transport of a selected substance into cells
US6051554A (en) 1995-06-07 2000-04-18 Peptor Limited Conformationally constrained backbone cyclized somatostatin analogs
US5811515A (en) 1995-06-12 1998-09-22 California Institute Of Technology Synthesis of conformationally restricted amino acids, peptides, and peptidomimetics by catalytic ring closing metathesis
FR2738151B1 (en) 1995-09-04 1997-09-26 Rhone Poulenc Rorer Sa ANTAGONISTS OF THE ONCOGENIC ACTIVITY OF THE MDM2 PROTEIN, AND THEIR USE IN THE TREATMENT OF CANCERS
GB9521544D0 (en) 1995-10-20 1995-12-20 Univ Dundee Activation of P53 protein and therapeutic applications thereof
US5840833A (en) 1995-10-27 1998-11-24 Molecumetics, Ltd Alpha-helix mimetics and methods relating thereto
US5893397A (en) 1996-01-12 1999-04-13 Bioject Inc. Medication vial/syringe liquid-transfer apparatus
AU4385696A (en) 1996-01-18 1997-08-11 Christian Gronhoj Larsen Synthetic il-10 analogues
US5849954A (en) 1996-01-18 1998-12-15 Research Corporation Technologies, Inc. Method of peptide synthesis
US5849691A (en) 1996-02-20 1998-12-15 The United States Of America As Represented By The Department Of Health And Human Services Peptidomimetic inhibitors of cathepsin D and plasmepsins I and II
GB9607549D0 (en) 1996-04-11 1996-06-12 Weston Medical Ltd Spring-powered dispensing device
US5817752A (en) 1996-06-06 1998-10-06 La Jolla Pharmaceutical Company Cyclic polypeptides comprising a thioether linkage and methods for their preparation
US5663316A (en) 1996-06-18 1997-09-02 Clontech Laboratories, Inc. BBC6 gene for regulation of cell death
US7083983B2 (en) 1996-07-05 2006-08-01 Cancer Research Campaign Technology Limited Inhibitors of the interaction between P53 and MDM2
ATE397621T1 (en) 1996-07-05 2008-06-15 Cancer Rec Tech Ltd INHIBITORS OF INTERACTION BETWEEN P53 AND MDM2
US5955593A (en) 1996-09-09 1999-09-21 Washington University BH3 interacting domain death agonist
US20020064546A1 (en) 1996-09-13 2002-05-30 J. Milton Harris Degradable poly(ethylene glycol) hydrogels with controlled half-life and precursors therefor
US5965703A (en) 1996-09-20 1999-10-12 Idun Pharmaceuticals Human bad polypeptides, encoding nucleic acids and methods of use
US5856445A (en) 1996-10-18 1999-01-05 Washington University Serine substituted mutants of BCL-XL /BCL-2 associated cell death regulator
JP4024309B2 (en) 1996-10-22 2007-12-19 第一三共株式会社 New treatment for infectious diseases
US6271198B1 (en) 1996-11-06 2001-08-07 Genentech, Inc. Constrained helical peptides and methods of making same
WO1998022122A1 (en) 1996-11-21 1998-05-28 Promega Corporation Alkyl peptide amides and applications
CA2281204A1 (en) 1997-02-20 1998-08-27 Yeda Research And Development Co., Ltd. Antipathogenic synthetic peptides and compositions comprising them
US6849428B1 (en) 1997-03-05 2005-02-01 New England Biolabs, Inc. Intein-mediated protein ligation of expressed proteins
JP2002506423A (en) 1997-04-11 2002-02-26 イーライ・リリー・アンド・カンパニー Combinatorial library of peptidomimetic macrocycles and methods therefor
GB9708092D0 (en) 1997-04-22 1997-06-11 Univ Dundee Materials and methods relating to inhibiting the interaction of p53 and mdm2
US5993412A (en) 1997-05-19 1999-11-30 Bioject, Inc. Injection apparatus
EP1015578A4 (en) 1997-09-17 2004-12-01 Walker And Eliza Hall Inst Of Therapeutic molecules
AU9565598A (en) 1997-09-26 1999-04-23 Board Of Trustees Of The University Of Illinois, The Use of the tumour suppressor gene p33ing1 for modulation of p53 activity and in tumour diagnosis
US6165732A (en) 1997-10-14 2000-12-26 Washington University Method for identifying apoptosis modulating compounds
US6875594B2 (en) 1997-11-13 2005-04-05 The Rockefeller University Methods of ligating expressed proteins
WO1999029343A1 (en) 1997-12-09 1999-06-17 Thomas Jefferson University Method of treating bladder cancer with wild type vaccinia virus
US6362276B1 (en) 1998-01-07 2002-03-26 Debio Recherche Pharmaceutique S.A. Degradable heterobifunctional poly(ethylene glycol) acrylates and gels and conjugates derived therefrom
IT1298087B1 (en) 1998-01-08 1999-12-20 Fiderm S R L DEVICE FOR CHECKING THE PENETRATION DEPTH OF A NEEDLE, IN PARTICULAR APPLICABLE TO A SYRINGE FOR INJECTIONS
US6030997A (en) 1998-01-21 2000-02-29 Eilat; Eran Acid labile prodrugs
AU767185B2 (en) 1998-03-23 2003-11-06 President And Fellows Of Harvard College Synthesis of compounds and libraries of compounds
HUP0101629A2 (en) 1998-04-15 2003-03-28 Aventis Pharma Inc Process for the preparation of resin-bound cyclic peptides
AU4543899A (en) 1998-06-08 1999-12-30 Advanced Medicine, Inc. Multibinding inhibitors of microsomal triglyceride transferase protein
US6326354B1 (en) 1998-08-19 2001-12-04 Washington University Modulation of apoptosis with bid
US7173005B2 (en) 1998-09-02 2007-02-06 Antyra Inc. Insulin and IGF-1 receptor agonists and antagonists
US6572856B1 (en) 1998-09-10 2003-06-03 The University Of Virginia Patent Foundation Methods for the prevention and treatment of cancer using anti-C3b(i) antibodies
CA2360671A1 (en) 1999-01-29 2000-08-03 The Board Of Trustees Of The University Of Illinois P53 inhibitors and therapeutic use of the same
US6372490B1 (en) 1999-02-23 2002-04-16 Curagen Corporation Nucleic acid encoding the MDM interacting protein
WO2000052210A2 (en) 1999-03-01 2000-09-08 Variagenics, Inc. Methods for targeting rna molecules
KR100558131B1 (en) 1999-03-29 2006-03-10 더 프록터 앤드 갬블 캄파니 A pharmaceutical composition comprising melanocortin receptor ligands and a manufacture of a medicament comprising melanocornin receptor ligands
US6444425B1 (en) 1999-04-02 2002-09-03 Corixa Corporation Compounds for therapy and diagnosis of lung cancer and methods for their use
US6713280B1 (en) 1999-04-07 2004-03-30 Thomas Jefferson University Enhancement of peptide cellular uptake
US7192713B1 (en) 1999-05-18 2007-03-20 President And Fellows Of Harvard College Stabilized compounds having secondary structure motifs
EP1180016B1 (en) 1999-05-24 2006-09-27 Introgen Therapeutics, Inc. Methods and compositions for non-viral gene therapy for treatment of hyperproliferative diseases
US6831155B2 (en) 1999-12-08 2004-12-14 President And Fellows Of Harvard College Inhibition of p53 degradation
US6348558B1 (en) 1999-12-10 2002-02-19 Shearwater Corporation Hydrolytically degradable polymers and hydrogels made therefrom
DE60026576T2 (en) 1999-12-16 2007-01-18 Chugai Seiyaku K.K. METHOD FOR FINDING A CANCER CLEANING MEDIUM WITH THE HELP OF INTERACTIVE DOMAINS OF p53 AND MORTALINE
DE10009341A1 (en) 2000-02-22 2001-09-06 Florian Kern Method for antigen-specific stimulation of T lymphocytes
US6495674B1 (en) 2000-02-25 2002-12-17 The Salk Institute For Biological Studies Evectins and their use
US7166712B2 (en) 2000-07-12 2007-01-23 Philadelphia, Health And Education Corporation Mammalian MDM2 binding proteins and uses thereof
US7049290B2 (en) 2000-07-28 2006-05-23 Universität Zürich Essential downstream component of the wingless signaling pathway and therapeutic and diagnostic applications based thereon
US20040228866A1 (en) 2000-08-04 2004-11-18 Ludwig Institute For Cancer Research Suppressor genes
US6703382B2 (en) 2000-08-16 2004-03-09 Georgetown University Medical Center Small molecule inhibitors targeted at Bcl-2
HUP0303854A2 (en) 2000-09-08 2004-03-01 Gryhon Therapeutics, Inc. Synthetic erythropoiesis stimulating proteins
WO2002064790A2 (en) 2000-12-19 2002-08-22 The Johns Hopkins University Jfy1 protein induces rapid apoptosis
US7253146B2 (en) 2001-02-23 2007-08-07 Polyphor Ltd Template-fixed peptidomimetics with antimicrobial activity
GB0104588D0 (en) 2001-02-24 2001-04-11 Univ Dundee Novel p-53 inducible protein
DE10109813A1 (en) 2001-03-01 2002-09-12 Thomas Stanislawski Tumor peptide antigen from human mdm2 proto-oncogene
US20050054770A1 (en) 2001-03-09 2005-03-10 Spatola Arno F. Helicomimetics and stabilized lxxll peptidomimetics
US20040106548A1 (en) 2001-09-07 2004-06-03 Schmidt Michelle A Conformationally constrained labeled peptides for imaging and therapy
US20020045192A1 (en) 2001-09-19 2002-04-18 St. Jude Children's Research Hospital Arf and HDM2 interaction domains and methods of use thereof
CN101157924A (en) 2001-12-11 2008-04-09 人体基因组科学有限公司 Neutrophil leukocyte gene alpha
EP1321474A1 (en) 2001-12-18 2003-06-25 Universite De Geneve A method for inducing apoptosis
US7247700B2 (en) 2001-12-31 2007-07-24 Dana Farber Cancer Institute, Inc. BID polypeptides and methods of inducing apoptosis
EP1468013A4 (en) 2002-01-03 2005-03-16 Yissum Res Dev Co Conformationally constrained c-backbone cyclic peptides
AU2003211093A1 (en) 2002-02-15 2003-09-09 The Regents Of The University Of Michigan Inhibitors of rgs proteins
US20030166138A1 (en) 2002-02-21 2003-09-04 Todd Kinsella Cyclic peptides and analogs useful to treat allergies
US7498134B2 (en) 2002-03-30 2009-03-03 The Trustees Of Columbia University In The City Of New York HAUSP-Mdm2 interaction and uses thereof
US7524630B2 (en) 2002-04-22 2009-04-28 University Of Florida Research Foundation, Inc. Functionalized nanoparticles and methods of use
WO2003095625A2 (en) 2002-05-13 2003-11-20 3-Dimensional Pharmaceuticals, Inc. Method for cytoprotection through mdm2 and hdm2 inhibition
EP2226316B1 (en) 2002-05-30 2016-01-13 The Scripps Research Institute Copper-catalysed ligation of azides and acetylenes
WO2003102538A2 (en) 2002-05-30 2003-12-11 European Molecular Biology Laboratory Combinatorial chemical library ii
US7208154B2 (en) 2002-06-03 2007-04-24 Regents Of The University Of Michigan Methods and compositions for the treatment of MHC-associated conditions
SE0201863D0 (en) 2002-06-18 2002-06-18 Cepep Ab Cell penetrating peptides
US20060051846A1 (en) 2002-09-06 2006-03-09 Kaneka Corporation Process for producing l-alpha-methylcysteine derivative
US20040171809A1 (en) 2002-09-09 2004-09-02 Korsmeyer Stanley J. BH3 peptides and method of use thereof
AU2003277891A1 (en) 2002-09-23 2004-04-08 Medivir Ab Hcv ns-3 serine protease inhibitors
AU2003299132A1 (en) 2002-10-07 2004-04-23 Genome Research Limited P53 binding polypeptide
CA2505368C (en) 2002-11-07 2011-09-20 Kosan Biosciences Incorporated Trans-9,10-dehydroepothilone c and d, analogs thereof and methods of making the same
BR0316091A (en) 2002-11-08 2005-09-27 Hoffmann La Roche Compounds, process for manufacturing them, pharmaceutical compositions, method for treating and / or preventing diseases that are modulated by ppar (a) and / or ppar (y) agonists and / or use thereof
US20050227932A1 (en) 2002-11-13 2005-10-13 Tianbao Lu Combinational therapy involving a small molecule inhibitor of the MDM2: p53 interaction
US7166575B2 (en) 2002-12-17 2007-01-23 Nastech Pharmaceutical Company Inc. Compositions and methods for enhanced mucosal delivery of peptide YY and methods for treating and preventing obesity
US20070032417A1 (en) 2002-12-24 2007-02-08 Walter And Eliza Hall Institute Of Medical Research Peptides and therapeutic uses thereof
CA2512693A1 (en) 2003-01-08 2004-07-29 Xencor, Inc. Novel proteins with altered immunogenicity
CA2517285A1 (en) 2003-02-26 2004-09-10 Japan Science And Technology Agency Transcriptional factor inducing apoptosis in cancer cell
EP1452868A2 (en) 2003-02-27 2004-09-01 Pepscan Systems B.V. Method for selecting a candidate drug compound
US7632920B2 (en) 2003-04-10 2009-12-15 Schering Corporation Soluble, stable form of HDM2, crystalline forms thereof and methods of use thereof
BRPI0409911A (en) 2003-05-01 2006-04-25 Cornell Res Foundation Inc method to release a molecule into a cell, and carrier complex
AU2003902743A0 (en) 2003-06-02 2003-06-19 Promics Pty Limited Process for the preparation of cyclic peptides
WO2005000876A2 (en) 2003-06-27 2005-01-06 Proteologics, Inc. Ring finger family proteins and uses related thereto
WO2005007675A2 (en) 2003-07-09 2005-01-27 The Scripps Research Institute TRIAZOLE &epsiv;-AMINO ACIDS
GB0317815D0 (en) 2003-07-30 2003-09-03 Amersham Health As Imaging agents
CN1871341A (en) 2003-08-20 2006-11-29 悉尼北方和中部海岸区医疗服务系统 Methods for enhancing embryo viability
WO2005032471A2 (en) 2003-10-03 2005-04-14 Merck & Co., Inc. Benzylether and benzylamino beta-secretase inhibitors for the treatment of alzheimer's disease
JP2007537989A (en) 2003-10-16 2007-12-27 アプラーゲン ゲゼルシャフト ミット ベシュレンクテル ハフツング Stabilizing peptide
US20070274915A1 (en) 2003-10-17 2007-11-29 Anjana Rao Modulation Of Anergy And Methods For isolating Anergy-Modulating Compounds
US7273927B2 (en) 2003-11-03 2007-09-25 University Of Massachusetts Mdm2 splice variants
EP1680443B9 (en) 2003-11-05 2014-09-03 Dana-Farber Cancer Institute, Inc. Stabilized alpha helical peptides and uses thereof
WO2005074521A2 (en) 2004-01-30 2005-08-18 The Trustees Of Columbia University In The City Of New York C-TERMINAL p53 PALINDROMIC PEPTIDE THAT INDUCES APOPTOSIS OF CELLS WITH ABERRANT p53 AND USES THEREOF
GB0404731D0 (en) 2004-03-03 2004-04-07 Indp Administrative Inst Nims Method and products for the selective degradation of proteins
WO2005090388A1 (en) 2004-03-19 2005-09-29 The University Of Queensland Alpha helical mimics, their uses and methods for their production
AU2005243465B2 (en) 2004-05-18 2011-08-25 F. Hoffmann-La Roche Ag Novel CIS-imidazolines
US7202332B2 (en) 2004-05-27 2007-04-10 New York University Methods for preparing internally constrained peptides and peptidomimetics
US7501397B2 (en) 2004-06-04 2009-03-10 The Brigham And Women's Hospital, Inc. Helical peptidomimetics with enhanced activity
CN100335467C (en) 2004-06-04 2007-09-05 中国科学院上海有机化学研究所 Synthesis of 5-iodo-1,4-twice substituted-1,2,3-trioxazole compound
EP1602663A1 (en) 2004-06-04 2005-12-07 Chiralix B.V. Triazole-linked glycoamino acids and glycopeptides
US7893278B2 (en) 2004-06-17 2011-02-22 Hoffman-La Roche Inc. CIS-imidazolines
US7842815B2 (en) 2004-06-17 2010-11-30 Infinity Pharmaceuticals, Inc. Compounds and methods for inhibiting the interaction of BCL proteins with binding partners
MXPA06014684A (en) 2004-06-18 2007-02-12 Ambrx Inc Novel antigen-binding polypeptides and their uses.
US7674787B2 (en) 2004-07-09 2010-03-09 The Regents Of The University Of Michigan Conformationally constrained Smac mimetics and the uses thereof
US9598470B2 (en) 2004-10-07 2017-03-21 Craig W. Beattie Compositions and methods to prevent cancer by stabilizing P53 through non MDM2-mediated pathways
CN101087762A (en) 2004-10-29 2007-12-12 先灵公司 Substituted 5-carboxyamide pyrazoles and [1,2,4]triazoles as antiviral agents
US20060148715A1 (en) 2004-12-20 2006-07-06 Baylor College Of Medicine Structural requirements for STAT3 binding and recruitment to phosphotyrosine ligands
GB0428187D0 (en) 2004-12-23 2005-01-26 Univ Liverpool Cancer treatment
PT1844337E (en) 2005-01-24 2014-04-03 Pepscan Systems Bv Binding compounds, immunogenic compounds and peptidomimetics
FR2881430B1 (en) 2005-02-01 2010-10-22 Servier Lab NOVEL PEPTIDES INTERACTING WITH ANTI-APOPTOTIC MEMBERS OF THE BCL-2 PROTEIN FAMILY AND USES THEREOF
NZ561215A (en) 2005-02-22 2010-12-24 Univ Michigan Small molecule inhibitors of MDM2 and uses thereof
WO2006103666A2 (en) 2005-03-28 2006-10-05 Yeda Research And Development Co. Ltd. Isolated bid polypeptides, polynucleotides encoding same and antibodies directed thereagainst and methods of using same for inducing cell cycle arrest or apoptosis
WO2006137974A2 (en) 2005-06-13 2006-12-28 Tranzyme Pharma, Inc. Macrocyclic ghrelin receptor antagonists and inverse agonists and methods of using the same
US20070020620A1 (en) 2005-07-14 2007-01-25 Finn M G Compositions and methods for coupling a plurality of compounds to a scaffold
KR20080097382A (en) 2005-07-21 2008-11-05 뉴사우스 이노베이션즈 피티와이 리미티드 Method for treating cancer
US20070161544A1 (en) 2006-01-06 2007-07-12 Peter Wipf Selective targeting agents for mitcochondria
US7538190B2 (en) 2006-02-17 2009-05-26 Polychip Pharmaceuticals Pty Ltd Methods for the synthesis of two or more dicarba bridges in organic compounds
US7745573B2 (en) 2006-02-17 2010-06-29 Polychip Pharmaceuticals Pty Ltd. Conotoxin analogues and methods for synthesis of intramolecular dicarba bridge-containing peptides
GB0611405D0 (en) 2006-06-09 2006-07-19 Univ Belfast FKBP-L: A novel inhibitor of angiogenesis
CA2656398A1 (en) 2006-06-30 2008-01-10 Schering Corporation Substituted piperidines that increase p53 activity and the uses thereof
JP2009544697A (en) 2006-07-26 2009-12-17 ペプスキャン システムズ ベー．フェー． Immunogenic compounds and protein mimetics
WO2008014216A1 (en) 2006-07-28 2008-01-31 St. Jude Children's Research Hospital Method for treating ocular cancer
US7737174B2 (en) 2006-08-30 2010-06-15 The Regents Of The University Of Michigan Indole inhibitors of MDM2 and the uses thereof
JP5506386B2 (en) 2006-09-04 2014-05-28 ユニバーシティー・コート・オブ・ザ・ユニバーシティー・オブ・ダンディー P53 activating compound
WO2008033557A2 (en) 2006-09-15 2008-03-20 Siemens Medical Solutions Usa, Inc. Click chemistry-derived cyclic peptidomimetics as integrin markers
US7897394B2 (en) 2006-09-21 2011-03-01 Intrexon Corporation Endoplasmic reticulum localization signals
CA2662838A1 (en) 2006-09-21 2008-03-27 F. Hoffmann-La Roche Ag Oxindole derivatives
EP2068857A2 (en) 2006-09-28 2009-06-17 Arete Therapeutics, INC. Soluble epoxide hydrolase inhibitors
EP2517720A1 (en) 2006-10-05 2012-10-31 New York Blood Center, Inc. Stabilized therapeutic small helical antiviral peptides
EP2091552A4 (en) 2006-11-15 2010-01-06 Dana Farber Cancer Inst Inc Stabilized maml peptides and uses thereof
US7932397B2 (en) 2006-11-22 2011-04-26 Massachusetts Institute Of Technology Olefin metathesis catalysts and related methods
US7981998B2 (en) 2006-12-14 2011-07-19 Aileron Therapeutics, Inc. Bis-sulfhydryl macrocyclization systems
CN101636407B (en) 2006-12-14 2015-08-26 爱勒让治疗公司 Bis-sulfhydryl macrocyclization systems
AU2007336132A1 (en) 2006-12-21 2008-06-26 Cytos Biotechnology Ag Circular CCR5 peptide conjugates and uses thereof
EP2114986B1 (en) 2007-01-29 2013-05-22 Polyphor Ltd. Template-fixed peptidomimetics
JP5649825B2 (en) 2007-01-31 2015-01-07 デイナ ファーバー キャンサー インスティチュート，インコーポレイテッド Stabilized p53 peptides and methods of use thereof
ES2649941T3 (en) 2007-02-23 2018-01-16 Aileron Therapeutics, Inc. Substituted amino acids to prepare triazole-linked macrocyclic peptides
WO2008106507A2 (en) 2007-02-27 2008-09-04 University Of South Florida Mdm2/mdmx inhibitor peptide
ES2430067T3 (en) 2007-03-28 2013-11-18 President And Fellows Of Harvard College Sewn polypeptides
EP2152294B1 (en) 2007-05-02 2017-07-26 Dana-Farber Cancer Institute, Inc. A bad bh3 domain peptide for use in treating or delaying the onset of diabetes.
JP2010530846A (en) 2007-06-01 2010-09-16 アコロジックス インコーポレイティッド Peptide preparation stable at high temperature
CA2700925C (en) 2007-09-26 2016-08-23 Dana Farber Cancer Institute Methods and compositions for modulating bcl-2 family polypeptides
WO2009110952A2 (en) 2007-12-31 2009-09-11 New York University Control of viral-host membrane fusion with hydrogen bond surrogate-based artificial helices
DK2235064T3 (en) 2008-01-07 2016-01-11 Amgen Inc A process for the preparation of heterodimeric Fc molecules using electrostatic control effects
CN103951541A (en) 2008-01-25 2014-07-30 波士顿学院董事会 Method for catalyzing metathesis reactons including enantioselective olefin metathesis
US20090275519A1 (en) * 2008-02-08 2009-11-05 Aileron Therapeutics, Inc. Therapeutic peptidomimetic macrocycles
EP2310407A4 (en) 2008-04-08 2011-09-14 Aileron Therapeutics Inc Biologically active peptidomimetic macrocycles
US20110144303A1 (en) * 2008-04-08 2011-06-16 Aileron Therapeutics, Inc. Biologically Active Peptidomimetic Macrocycles
JP2011522796A (en) 2008-05-06 2011-08-04 ニューヨーク ブラッド センター， インコーポレイテッド Antiviral cell penetrating peptide
EP2285970A4 (en) 2008-06-03 2011-10-12 Aileron Therapeutics Inc Compositions and methods for enhancing cellular transport of biomolecules
US8343760B2 (en) 2008-06-05 2013-01-01 University Of Maryland, Baltimore p53 activator peptides
WO2010011313A2 (en) 2008-07-23 2010-01-28 President And Fellows Of Harvard College Ligation of stapled polypeptides
GB0813873D0 (en) 2008-07-30 2008-09-03 Univ Dundee Compounds
WO2010033617A2 (en) 2008-09-16 2010-03-25 The Research Foundation Of State University Of New York Stapled peptides and method of synthesis
US9399666B2 (en) 2008-09-18 2016-07-26 New York University Inhibiting interaction between the HIF-1ALPHA and p300/CBP with hydrogen bond surrogate-based helices
WO2010034026A1 (en) 2008-09-22 2010-03-25 Aileron Therapeutics, Inc. Peptidomimetic macrocycles
CN104961795A (en) 2008-09-22 2015-10-07 爱勒让治疗公司 Methods for preparing purified polypeptide compositions
CA2737916A1 (en) 2008-09-22 2010-03-25 Aileron Therapeutics, Inc. Peptidomimetic macrocycles
WO2010034029A1 (en) 2008-09-22 2010-03-25 Aileron Therapeutics, Inc. Peptidomimetic macrocycles
CN102482336B (en) 2008-09-22 2015-05-06 爱勒让治疗公司 Peptidomimetic macrocycles
US20120178700A1 (en) 2008-09-22 2012-07-12 Aileron Therapeutics, Inc. Peptidomimetic macrocycles
WO2010042225A2 (en) 2008-10-10 2010-04-15 Dana Farber Cancer Institute Chemical modulators of pro-apoptotic bax and bcl-2 polypeptides
JP2010120881A (en) 2008-11-19 2010-06-03 Keio Gijuku PEPTIDE FOR INHIBITING INTERACTION BETWEEN HUMAN CANCER PROTEIN MDM2 AND HUMAN CANCER-INHIBITING PROTEIN p53, AND USE THEREOF
KR101298168B1 (en) 2008-11-21 2013-08-20 충남대학교산학협력단 Chemical inhibitor of snail―ｐ５３ binding and pharmaceutical composition for treating cancer disease comprising the same
CA2743177A1 (en) 2008-11-24 2010-05-27 Aileron Therapeutics, Inc. Peptidomimetic macrocycles with improved properties
EP3549951A3 (en) * 2008-12-09 2019-11-20 Dana Farber Cancer Institute, Inc. Methods and compositions for specific modulation of mcl-1
JP2012515172A (en) 2009-01-14 2012-07-05 エルロン・セラピューティクス・インコーポレイテッド Peptidomimetic macrocycle
WO2010083501A2 (en) 2009-01-16 2010-07-22 University Of South Florida Alpha-helix mimetic using a 2,5-oligopyrimidine scaffold
US8217051B2 (en) 2009-02-17 2012-07-10 Hoffmann-La Roche Inc. Spiroindolinone derivatives
FR2942798B1 (en) 2009-03-05 2011-04-08 Centre Nat Rech Scient PEPTIDES USEFUL FOR THE TREATMENT OF CHRONIC LYMPHOCYTIC LEUKEMIA
US20120135089A1 (en) 2009-03-17 2012-05-31 Stockwell Brent R E3 ligase inhibitors
US8076482B2 (en) 2009-04-23 2011-12-13 Hoffmann-La Roche Inc. 3,3′-spiroindolinone derivatives
WO2011005219A1 (en) 2009-07-07 2011-01-13 Agency For Science, Technology And Research Novel mdm2 binding peptides and uses thereof
WO2011008260A2 (en) 2009-07-13 2011-01-20 President And Fellows Of Harvard College Bifunctional stapled polypeptides and uses thereof
US20120149661A1 (en) 2009-08-26 2012-06-14 Novartis Ag Tetra-substituted heteroaryl compounds and their use as mdm2 and/or mdm4 modulators
JP2013505300A (en) 2009-09-22 2013-02-14 エルロン・セラピューティクス・インコーポレイテッド Peptidomimetic macrocycle
WO2011047215A1 (en) 2009-10-14 2011-04-21 Aileron Therapeutics, Inc. Improved peptidomimetic macrocycles
US8017607B2 (en) 2009-10-14 2011-09-13 Hoffmann-La Roche Inc. N-substituted-pyrrolidines as inhibitors of MDM2-P-53 interactions
WO2011056961A2 (en) 2009-11-04 2011-05-12 Health Research Inc. Method and compositions for suppression of aging
KR20120099462A (en) 2009-11-12 2012-09-10 더 리젠츠 오브 더 유니버시티 오브 미시건 Spiro-oxindole mdm2 antagonists
US20110118283A1 (en) 2009-11-17 2011-05-19 Qingjie Ding Substituted Pyrrolidine-2-Carboxamides
US8088815B2 (en) 2009-12-02 2012-01-03 Hoffman-La Roche Inc. Spiroindolinone pyrrolidines
CU24130B1 (en) 2009-12-22 2015-09-29 Novartis Ag ISOQUINOLINONES AND REPLACED QUINAZOLINONES
US8440693B2 (en) 2009-12-22 2013-05-14 Novartis Ag Substituted isoquinolinones and quinazolinones
US8658170B2 (en) 2010-01-06 2014-02-25 Joseph P. Errico Combination therapy with MDM2 and EFGR inhibitors
KR101220516B1 (en) 2010-01-21 2013-01-10 연세대학교 산학협력단 Human Adult Stem Cells Secreting Anti-MDM2 and Uses thereof
EP2534140B1 (en) 2010-02-08 2018-04-11 Trustees of Boston College Efficient methods for z- or cis-selective cross-metathesis
US8288431B2 (en) 2010-02-17 2012-10-16 Hoffmann-La Roche Inc. Substituted spiroindolinones
WO2011106650A2 (en) 2010-02-27 2011-09-01 University Of Pittsburgh - Of The Commonwealth System Of Higher Education Novel p53-mdm2/p53-mdm4 antagonists to treat proliferative disease
CA2800519A1 (en) 2010-04-09 2011-10-13 The Regents Of The University Of Michigan Biomarkers for mdm2 inhibitors for use in treating disease
CA2797033C (en) 2010-04-22 2021-10-19 Longevity Biotech, Inc. Highly active polypeptides and methods of making and using the same
US20110313167A1 (en) 2010-06-22 2011-12-22 University Of Pittsburgh - Of The Commonwealth System Of Higher Education Substituted Heterocycles as Therapeutic agents for treating cancer
US20130177979A1 (en) 2010-06-22 2013-07-11 University Of Central Florida Research Foundation, Inc. Methods and compositions for cell permeable stat3 inhibitor
US8907053B2 (en) 2010-06-25 2014-12-09 Aurigene Discovery Technologies Limited Immunosuppression modulating compounds
WO2012016186A1 (en) 2010-07-29 2012-02-02 President And Fellows Of Harvard College Macrocyclic kinase inhibitors and uses thereof
KR20170058446A (en) 2010-08-13 2017-05-26 에일러론 테라퓨틱스 인코포레이티드 Peptidomimetic macrocycles
JP2013537191A (en) 2010-09-08 2013-09-30 ユニバーシティー オブ ピッツバーグ − オブ ザ コモンウェルス システム オブ ハイヤー エデュケーション p53-Mdm2 antagonist
US20120065210A1 (en) 2010-09-15 2012-03-15 Xin-Jie Chu Substituted hexahydropyrrolo[1,2-c]imidazolones
US20120071499A1 (en) 2010-09-20 2012-03-22 Xin-Jie Chu Substituted Spiro[3H-Indole-3,6'(5'H)-[1H]Pyrrolo[1,2c]Imidazole-1',2(1H,2'H)-diones
WO2012040459A2 (en) 2010-09-22 2012-03-29 President And Fellows Of Harvard College Beta-catenin targeting peptides and uses thereof
US20130225603A1 (en) 2010-09-27 2013-08-29 Serrata Llc Mdm2 inhibitors for treatment of ocular conditions
WO2012045018A1 (en) 2010-09-30 2012-04-05 St. Jude Children's Research Hospital Aryl-substituted imidazoles
EP2627662B1 (en) 2010-10-13 2015-09-16 Bristol-Myers Squibb Company Methods for preparing macrocycles and macrocycle stabilized peptides
FR2967072B1 (en) 2010-11-05 2013-03-29 Univ Dundee PROCESS FOR IMPROVING INFLUENZA PRODUCTION OF VACCINE AND SEEDS
SG190230A1 (en) 2010-11-12 2013-06-28 Univ Michigan Spiro-oxindole mdm2 antagonists
JP2014502152A (en) 2010-11-12 2014-01-30 ダナ ファーバー キャンサー インスティテュート，インコーポレイテッド Cancer treatment and diagnosis
WO2012076513A1 (en) 2010-12-09 2012-06-14 F. Hoffmann-La Roche Ag 3-cyano-1-hydroxymethyl-2-phenylpyrrolidine derivatives as inhibitors of mdm2-p53 interactions useful for the treatment of cancer
WO2012083078A2 (en) 2010-12-15 2012-06-21 The Research Foundation Of State University Of New York Croos-linked peptides and proteins, methods of making same, and uses thereof
WO2012083181A1 (en) 2010-12-16 2012-06-21 Indiana University Research And Technology Corporation Alpha helix mimetics and methods for using
EP2651921A1 (en) 2010-12-17 2013-10-23 Syngenta Participations AG Insecticidal compounds
JP6239979B2 (en) 2011-03-04 2017-11-29 ニューヨーク・ユニバーシティ Hydrogen-bonded alternative macrocycles as regulators of RAS
JP6150726B2 (en) 2011-03-09 2017-06-21 Jitsubo株式会社 Cross-linked peptide containing a novel non-peptidic cross-linked structure, method for synthesizing the cross-linked peptide, and novel organic compound used in the method
US8629133B2 (en) 2011-03-10 2014-01-14 Daiichi Sankyo Company, Limited Dispiropyrrolidine derivatives
WO2012149563A1 (en) 2011-04-29 2012-11-01 Kinemed, Inc. Chemical modification of apolipoprotein mimetic peptides for the production of therapeutic agents
WO2012173846A2 (en) 2011-06-06 2012-12-20 Aileron Therapeutics, Inc. Peptidomimetic macrocycles
JP2014520120A (en) 2011-06-17 2014-08-21 プレジデント アンド フェローズ オブ ハーバード カレッジ Stabilized mutant MAML peptides and uses thereof
US9487562B2 (en) 2011-06-17 2016-11-08 President And Fellows Of Harvard College Stabilized polypeptides as regulators of RAB GTPase function
GB201110390D0 (en) 2011-06-20 2011-08-03 Medical Res Council Compounds for use in stabilising p53 mutants
US20120328692A1 (en) 2011-06-24 2012-12-27 University Of Maryland, Baltimore Potent d-peptide antagonists of mdm2 and mdmx for anticancer therapy
AU2012301605A1 (en) 2011-08-31 2014-04-17 New York University Thioether-,ether-, and alkylamine-linked hydrogen bond surrogate pertidomimentics
EP3444262A3 (en) 2011-09-09 2019-04-10 Agency For Science, Technology And Research P53 activating peptides
US9376425B2 (en) 2011-09-27 2016-06-28 Amgen, Inc. Heterocyclic compounds as MDM2 inhibitors for the treatment of cancer
WO2013059530A2 (en) 2011-10-18 2013-04-25 Aileron Therapeutics, Inc. Peptidomimetic macrocycles
RU2639523C2 (en) 2011-10-18 2017-12-21 Эйлерон Терапьютикс, Инк. Peptidomimetic macrocycles and their application
US9408885B2 (en) 2011-12-01 2016-08-09 Vib Vzw Combinations of therapeutic agents for treating melanoma
CA2761253A1 (en) 2011-12-07 2013-06-07 Vib Vzw Combinations of therapeutic agents for treating melanoma
WO2013116829A1 (en) * 2012-02-03 2013-08-08 The Trustees Of Princeton University Novel engineered potent cytotoxic stapled bh3 peptides
CA2864120A1 (en) 2012-02-15 2013-08-22 Aileron Therapeutics, Inc. Triazole-crosslinked and thioether-crosslinked peptidomimetic macrocycles
CA2862038C (en) 2012-02-15 2021-05-25 Aileron Therapeutics, Inc. Peptidomimetic macrocycles
US9216170B2 (en) 2012-03-19 2015-12-22 Hoffmann-La Roche Inc. Combination therapy for proliferative disorders
DK2920197T3 (en) 2012-09-26 2021-05-31 Harvard College PROLINE-LOCKED STOPPED PEPTIDES AND USES THEREOF
WO2014055564A1 (en) 2012-10-01 2014-04-10 President And Fellows Of Harvard College Stabilized polypeptide insulin receptor modulators
JP6526563B2 (en) 2012-11-01 2019-06-05 エイルロン セラピューティクス，インコーポレイテッド Disubstituted amino acids and methods for their preparation and use
US9493510B2 (en) * 2013-01-10 2016-11-15 Noliva Therapeutics Llc Peptidomimetic compounds
WO2014138429A2 (en) 2013-03-06 2014-09-12 Aileron Therapeutics, Inc. Peptidomimetic macrocycles and use thereof in regulating hif1alpha
PE20160591A1 (en) 2013-12-05 2016-06-11 Hoffmann La Roche NEW COMBINATION TREATMENT FOR ACUTE MYELOID LEUKEMIA (AML)
CN108348571B (en) 2015-09-03 2022-03-22 艾瑞朗医疗公司 Peptidomimetic macrocycles and uses thereof
US10023613B2 (en) 2015-09-10 2018-07-17 Aileron Therapeutics, Inc. Peptidomimetic macrocycles as modulators of MCL-1
WO2017205786A1 (en) 2016-05-27 2017-11-30 Aileron Therapeutics, Inc. Cell permeable peptidomimetic macrocycles
US20170360881A1 (en) 2016-06-17 2017-12-21 Aileron Therapeutics, Inc. Peptidomimetic macrocycles and uses thereof

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2020190827A1 (en) * 2019-03-21 2020-09-24 Merck Sharp & Dohme Corp. Inhibitors of histone deacetylase useful for the treatment or prevention of hiv infection
US11976069B2 (en) 2019-03-21 2024-05-07 Merck Sharp & Dohme Llc Inhibitors of histone deacetylase useful for the treatment or prevention of HIV infection

Also Published As

Publication number Publication date
US10023613B2 (en) 2018-07-17
EP3347372A1 (en) 2018-07-18
US20170107252A1 (en) 2017-04-20
JP2018528217A (en) 2018-09-27
EP3347372A4 (en) 2019-09-04
CN108368161A (en) 2018-08-03
WO2017044633A1 (en) 2017-03-16

Similar Documents

Publication Publication Date Title
US10023613B2 (en) Peptidomimetic macrocycles as modulators of MCL-1
US10308699B2 (en) Peptidomimetic macrocycles
US20180273587A1 (en) Warhead-containing peptidomimetic macrocycles as modulators of bfl-1
JP6259861B2 (en) Bis-sulfhydryl macrocyclic system
US10011639B2 (en) Peptidomimetic compounds
US7981998B2 (en) Bis-sulfhydryl macrocyclization systems
US20180371044A1 (en) Peptidomimetic macrocycles
CN111447941B (en) Polypeptide conjugates for intracellular delivery of binding peptides
TW202321275A (en) Bicyclic peptide inhibitors of interleukin-23 receptor
OA21041A (en) Peptide inhibitors of interleukin-23 receptor and their use to treat inflammatory diseases.
AU2014201956A1 (en) Bis-sulfhydryl macrocyclization systems

Legal Events

Date Code Title Description
AS Assignment

Owner name: AILERON THERAPEUTICS, INC., MASSACHUSETTS

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:GUERLAVAIS, VINCENT;FEYFANT, ERIC;SIGNING DATES FROM 20180615 TO 20180618;REEL/FRAME:046139/0791

STPP Information on status: patent application and granting procedure in general

Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION MAILED

STCB Information on status: application discontinuation

Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION