US20130217622A1 - Exendin-4 analogue pegylated with polyethylene glycol or derivative thereof, preparation method thereof, and pharmaceutical compostion for preventing or treating diabetes, containing same as active ingredient - Google Patents

Exendin-4 analogue pegylated with polyethylene glycol or derivative thereof, preparation method thereof, and pharmaceutical compostion for preventing or treating diabetes, containing same as active ingredient Download PDF

Info

Publication number
US20130217622A1
US20130217622A1 US13/882,361 US201213882361A US2013217622A1 US 20130217622 A1 US20130217622 A1 US 20130217622A1 US 201213882361 A US201213882361 A US 201213882361A US 2013217622 A1 US2013217622 A1 US 2013217622A1
Authority
US
United States
Prior art keywords
exendin
analogue
derivative
polyethylene glycol
peg
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Abandoned
Application number
US13/882,361
Other languages
English (en)
Inventor
Sung Kwon Lee
Won Bae Kim
Seulki Lee
Tae Hyung Kim
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Theraly Pharmaceuticals Inc
Original Assignee
B&L Delipharm Corp
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by B&L Delipharm Corp filed Critical B&L Delipharm Corp
Assigned to B&L DELIPHARM, CORP. reassignment B&L DELIPHARM, CORP. ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: KIM, TAE HYUNG, KIM, WON BAE, LEE, SEULKI, LEE, SUNG KWON
Publication of US20130217622A1 publication Critical patent/US20130217622A1/en
Assigned to THERALY PHARMACEUTICALS INC. reassignment THERALY PHARMACEUTICALS INC. ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: B&L DELIPHARM, CORP.
Abandoned legal-status Critical Current

Links

Images

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/02Inorganic compounds
    • A61K47/48215
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/22Hormones
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/22Hormones
    • A61K38/2278Vasoactive intestinal peptide [VIP]; Related peptides (e.g. Exendin)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/06Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
    • A61K47/26Carbohydrates, e.g. sugar alcohols, amino sugars, nucleic acids, mono-, di- or oligo-saccharides; Derivatives thereof, e.g. polysorbates, sorbitan fatty acid esters or glycyrrhizin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/30Macromolecular organic or inorganic compounds, e.g. inorganic polyphosphates
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/56Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule
    • A61K47/59Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes
    • A61K47/60Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes the organic macromolecular compound being a polyoxyalkylene oligomer, polymer or dendrimer, e.g. PEG, PPG, PEO or polyglycerol
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/0012Galenical forms characterised by the site of application
    • A61K9/0019Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/20Pills, tablets, discs, rods
    • A61K9/2004Excipients; Inactive ingredients
    • A61K9/2013Organic compounds, e.g. phospholipids, fats
    • A61K9/2018Sugars, or sugar alcohols, e.g. lactose, mannitol; Derivatives thereof, e.g. polysorbates
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/20Pills, tablets, discs, rods
    • A61K9/2004Excipients; Inactive ingredients
    • A61K9/2022Organic macromolecular compounds
    • A61K9/205Polysaccharides, e.g. alginate, gums; Cyclodextrin
    • A61K9/2059Starch, including chemically or physically modified derivatives; Amylose; Amylopectin; Dextrin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/48Preparations in capsules, e.g. of gelatin, of chocolate
    • A61K9/4841Filling excipients; Inactive ingredients
    • A61K9/4858Organic compounds
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/48Preparations in capsules, e.g. of gelatin, of chocolate
    • A61K9/4841Filling excipients; Inactive ingredients
    • A61K9/4866Organic macromolecular compounds
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/08Drugs for disorders of the metabolism for glucose homeostasis
    • A61P3/10Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/575Hormones
    • C07K14/57563Vasoactive intestinal peptide [VIP]; Related peptides

Definitions

  • the present disclosure relates to an exendin-4 analogue PEGylated with polyethylene glycol or a derivative thereof, a preparation method thereof, and a pharmaceutical composition for prevention or treatment of diabetes containing the same as an active ingredient.
  • PEGylation of peptides and proteins for the purpose of treatment is the most effective technology.
  • PEGylation of peptides and proteins increases molecular weight thereof, protein degradation site defense and immunogenicity site defense, which consequently increases half-life of in vivo medications and reduce immunogenicity of peptides and proteins. Therefore, PEGylation technology has an effect of increasing treatment effect by solving problems of original medications, and due to such strength, serves an important role in increasing effects of PEGylated peptide and protein medication delivery system.
  • peptides and proteins increase treatment effect by covalently bonding with polyethylene glycol (PEG).
  • PEG polyethylene glycol
  • Such technology increases molecular weight, defense of a metabolism site and inhibition of an immunogenicity site, increasing in vivo half-life and stability and reducing immunogenicity.
  • kidney excretion of peptides and proteins bound with PEG is reduced due to the increase of molecular weights of peptides and proteins by PEG, so that PEGylation has advantages of increasing effects in both pharmacokinetically and pharmacodynamically.
  • PEGylation reacting sites of peptides and proteins are randomly dispersed and are occasionally close to bioactive sites.
  • traditional PEGylation employs nonspecific PEGylation methods that do not consider PEG reacting site, number of PEG bonds and biological activity.
  • nonspecific PEGylation method reduces treatment effects by bringing insufficient conformation by producing various branched type PEG-bonded isomers that have different physiochemical, biological and pharmacokinetic characteristics.
  • Specific PEGylation methods have been studied to solve such problems, and recently the specific PEGylation methods are rapidly developing to become a method of maximizing medications' treatment effects as genetic engineering technology and selective functional group introducing technology are quickly developing.
  • G-CSF granulocyte stimulating factor
  • Exendin-4 is a polypeptide substance and is the first incretin analogue, a diabetes medication prepared by synthesizing exendin-4, a salivary substance of Gila monster. Exendin-4 is different from exendin-3 for only #2 and #3 sites, is known to have a longer half-life than glucagon like peptide-1 (GLP-1) which is a diabetes medication having a half-life shorter than two minutes for DPP-IV, an enzyme that is resistant for directly degrading incretin enzyme that is produced in mammals' stomachs after ingestion by DPP-IV (dipeptidyl peptidase-4) to serve beneficial roles of promoting insulin secretion and lowering blood sugar level, and also, it shows 2-4 hours of half-life in vivo experiment, and it has been confirmed that it can reach enough blood concentration with 2-3 times of intraperitoneal injection per day.
  • GLP-1 glucagon like peptide-1
  • exendin-4 is known to control gastrointestinal tracts' motility, reduces food intake and suppresses blood plasma glucagon, and recently PLGA microsphere type synthetic exendin-4 (product name: Byetta) has been authorized by US FDA and is about to be released.
  • This Byetta LAR product has complicated preparation process and is short in vivo half-life for exendin-4, which is about 4-6 hours, frequent administration of high dose exendin-4 is required, and the problem of medication release control based on quick excretion due to the low molecular weight of lower than 4200, and problems such as immunogenicity still exist.
  • One object of the present invention is to provide an exendin-4 analogue in which a cysteine (Cys) is introduced into #40 site of C-terminal and is PEGylated with polyethylene glycol (PEG) or derivatives thereof.
  • Cys cysteine
  • PEG polyethylene glycol
  • Another object of the present invention is to provide a method of preparing the exendin-4 analogue.
  • Still another object of the present invention is to provide a pharmaceutical composition for prevention or treatment of diseases caused by insulin hypersecretion, containing the exendin-4 analogue as an active ingredient.
  • the present invention provides an exendin-4 analogue that has a cysteine (Cys) introduced into #40 site of C-terminal, which is PEGylated with polyethylene glycol (PEG) or derivatives thereof.
  • Cys cysteine
  • PEG polyethylene glycol
  • the present invention also provides a method of preparing the exendin-4 analogue.
  • the present invention provides a pharmaceutical composition for prevention or treatment of diseases caused by insulin hypersecretion containing the exendin-4 analogue as an active ingredient.
  • the yield of an exendin-4 analogue in which a cysteine (Cys) is introduced into #40 site of the C-terminal and is PEGylated with polyethylene glycol (PEG) or derivatives thereof can be increased, and treatment effect of medications can be increased, and thus the exendin-4 analogue can be beneficially used as a composition for prevention or treatment of diseases caused by insulin hypersecretion.
  • Cys cysteine
  • PEG polyethylene glycol
  • FIG. 1 is a schematic view illustrating PEGylation of exendin-4 in which cysteine (Cys 40) is introduced into the C-terminal of example 1 of the present invention.
  • FIG. 2 is a schematic view illustrating PEGylation for lycine amine of exendin-4 of comparative example 1 of the present invention.
  • FIG. 3 is a schematic view illustrating PEGylation for N-terminal of exendin-4 of comparative example 2 of the present invention.
  • FIG. 4 is a view illustrating light absorbance of example 1 of the present invention.
  • FIG. 5 is a view illustrating light absorbance of comparative examples 1a to 1c of the present invention.
  • FIG. 6 is a view illustrating light absorbance of comparative example 2 of the present invention.
  • FIG. 7 is a view illustrating the production yield of example 1 of the present invention.
  • FIG. 8 is a drawing illustrating product yield of comparative examples 1a to 1c of the present invention.
  • FIG. 9 is a view illustrating the production yield of comparative example 2 of the present invention.
  • FIG. 10 is a view illustrating the affinity of a PEG bound exendin-4 analogue to a GLP-1 receptor according to an example of the present invention.
  • FIG. 11 is a schematic view illustrating PEG bound exendin-4 analogues of examples 4 and 5 of the present invention.
  • FIG. 12 is a view illustrating blood glucose level for diabetic mice administrated with a PEG bound exendin-4 analogue according to an example of the present invention.
  • the present invention provides an exendin-4 analogue in which a cysteine (Cys) is introduced into #40 site of the C-terminal and is PEGylated with polyethylene glycol (PEG) or a derivative thereof.
  • Cys cysteine
  • PEG polyethylene glycol
  • the molecular weight of polyethylene glycol or a derivative thereof according to the present invention is 5-60 kDa, and preferably 20-50 kDa, but is not limited thereto.
  • the polyethylene glycol or a derivative thereof according to the present invention is a linear type or a branched type, and for the branched type, preferably a dimeric type or a trimeric type may be used, and more preferably a trimeric type may be used.
  • the polyethylene glycol derivative is, for example, methoxypolyethylene glycol succinimidylpropionate, methoxypolyethylene glycol N-hydroxysuccinimide, methoxypolyethylene glycol propionaldehyde, methoxypolyethylene glycol maleimide, or multiple branched types of these derivatives.
  • the polyethylene glycol derivative is linear methoxypolyethylene glycol maleimide, branch type methoxypolyethylene glycol maleimide or trimeric methoxypolyethylene glycol maleimide, and more preferably is trimeric methoxypolyethylene glycol maleimide.
  • the present invention provides a method of preparing an exendin-4 analogue PEGylated with the polyethylene glycol or a derivative thereof, which includes a process of dissolving exendin-4 in which cysteine is introduced into #40 site of the C-terminal, and polyethylene glycol or a derivative thereof in phosphate buffer saline solution and reacting them at room temperature.
  • an exendin-4 analogue PEGylated with polyethylene glycol or a derivative thereof may be prepared by adding exendin-4 in which cysteine is introduced into #40 site of the C-terminal, and polyethylene glycol or a derivative thereof in a phosphate buffer saline solution in a mole ratio of 1:1-3 in a phosphate buffer saline having a pH range of 7.2-7.8, preferably pH 7.5, dissolving these ingredients, and perform a reaction for 1-3 hours at room temperature although the reaction temperature is not particularly limited, and performing a column chromatography after the reaction is completed.
  • the yield may decrease.
  • the molecular structure of the exendin-4 analogue may be confirmed by a mass spectroscope, a liquid chromatography, an X-ray diffraction analysis, a polarimetry, and comparison between calculated values and measured values of representative elements constituting the exendin-4 analogue.
  • the present invention provides a pharmaceutical composition for prevention or treatment of diseases caused by insulin hypersecretion, containing the exendin-4 analogue as an active ingredient.
  • the present invention provides a treatment method characterized with administration of the exendin-4 analogue PEGylated with polyethylene glycol or a derivative thereof to patients in need of treating the diseases caused by insulin hypersecretion.
  • the diseases caused by insulin hypersecretion may include Type 1 diabetes, Type 2 diabetes and diabetes complications.
  • FIG. 11 a schematic diagram of the present invention's exendin-4 bound with a trimeric PEG at C40 site is shown in FIG. 11 .
  • the C40 site specific PEG bound exendin-4 compound according to the present invention can solve the drawback of quick excretion of medications due to the low molecular weight of existing exendin-4, has excellent affinity to the GLP-1 receptor, and has strong low blood glucose maintaining ability capable of maintaining blood glucose level up to 3-4 days after having administrated the medications, so it can be used beneficially for preventing or treating insulin hypersecretion related Type 1 diabetes, Type 2 diabetes and diseases related with diabetes complications.
  • the pharmaceutical composition containing the exendin-4 analogue PEGylated with polyethylene glycol or a derivative thereof may be administrated after having formulated into various oral or non-oral administration forms as the following in case of clinical administration, but is not limited thereof.
  • formulations for example, there are tablets, pellets, hard/soft capsules, liquids, suspensions, emulsifiers, syrups, granules, elixirs, troches, etc., and these formulations include diluents (example: lactose, dextrose, sucrose, mannitol, sorbitol, cellulose and/or glycine), slip modifiers (example: silica, talc, stearate and its magnesium or calcium salt and/or polyethylene glycol) in addition to the active ingredient.
  • diluents example: lactose, dextrose, sucrose, mannitol, sorbitol, cellulose and/or glycine
  • slip modifiers example: silica, talc, stearate and its magnesium or calcium salt and/or polyethylene glycol
  • Tablets may also include binders such as magnesium aluminum silicate, starch paste, gelatin, methyl cellulose, sodium carboxymethyl cellulose and/or polyvinyl pyrrolidine, and may include disintegrating agents such as starch, agar, alginic acid or sodium salt thereof or boiling mixture and/or absorbents, coloring agents, flavoring agents and sweetening agents if needed.
  • binders such as magnesium aluminum silicate, starch paste, gelatin, methyl cellulose, sodium carboxymethyl cellulose and/or polyvinyl pyrrolidine
  • disintegrating agents such as starch, agar, alginic acid or sodium salt thereof or boiling mixture and/or absorbents, coloring agents, flavoring agents and sweetening agents if needed.
  • the pharmaceutical composition containing the exendin-4 analogue PEGylated with polyethylene glycol or a derivative thereof may be non-orally administrated, and the administration is done by subcutaneous injection, intravenous injection, intramuscular injection or intrathoracic injection.
  • the exendin-4 analogue PEGylated with polyethylene glycol or a derivative thereof may be may be prepared into liquid or suspension by having mixed it with stabilizer or buffer in water to formulize it into non-orally administration purposed formulation, and this may be prepared into ampoule or vial unit administration form.
  • the composition is sterilized and/or may include adjuvants such as antiseptics, stabilizers, hydrators or emulsify stimulators, osmotic pressure controlling purposed salts and/or buffers, and other substances beneficial for treatments, and may be formulated according to traditional methods of mixture, granulation or coating.
  • the human body dose of the pharmaceutical composition containing the exendin-4 analogue PEGylated with polyethylene glycol or a derivative thereof according to the present invention may vary depending on the age, body weight, gender, administration form, health status and level of disease of patients, and may be administrated via oral or non-oral route following decisions of doctors or pharmacists with preferably dose of 0.01 to 200 mg/kg/day.
  • exendin-4-Cys in which cysteine is introduced into the C-terminal site (#40 site) was used (exendin-Cys, molecular weight: 4290.7, sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSC), and maleimide activated monomethoxy PEG (mPEG-MAL, MW: 5, 20 kDa(Linear type), 20 kDa (Branch type), 23, 50 kDa (Trimer type)) was purchased from Nippon Oil and Fats, NOF, Tokyo, and used.
  • exendin-4-Cys and mPEG-MAL (MW: 5, 20 (linear type), 20 (branch type), 23, 50 kDa) were completely dissolved in a mole ratio of 1:2 in a 20 mM phosphate buffer saline (pH 7.5) and were reacted for two hours at room temperature (refer to FIG. 1 ).
  • the reacted solution was separated by a reversed phase chromatography with Capcell-pak RP-18 column (250 ⁇ 10 mm, 5 ⁇ m, Shiseido, Japan) at a flow speed of 5.0 ml/min. The separation was monitored at 215 nm wavelength ultraviolet ray.
  • the mobile phase was separated using a linear concentration gradient method (36-42% B over 30 min) for 0.1% TFA distilled water (mobile phase A) and 0.1% TFA acetonitrile (mobile phase B) (refer to FIG. 4 ).
  • the peaks separated by the method were collected separately, acetonitrile was removed using nitrogen gas, and the removed solution was concentrated using Centricon-10 (Mw cut off 3000, Millipore Corp., Billerica, Mass.).
  • the prepared substance was stored at 4° C. and prepared by mixing 1 ⁇ l sample-matrix sample solution and 2 ⁇ l matrix solution, and the matrix solution was prepared by dissolving ⁇ -cyanohydroxycinnamic acid ( ⁇ -CHCA) with water/CAN (50:50) solution containing 0.1% (v/v) TFA.
  • the prepared 1 ⁇ l sample-matrix solution was put on a sample plate, dried at vacuum status and analyzed with size exclusion chromatography (SEC) and MALDI-TOF mass spectrometer, and C40 site specific PEG bonding reaction (C40-PEG-Ex4) was analyzed at 0, 20, 40, 60 and 80 minutes and was shown with chromatogram area ratio in comparison with the initial status of exendin-4 and C40-PEG-Ex4.
  • SEC size exclusion chromatography
  • MALDI-TOF mass spectrometer MALDI-TOF mass spectrometer
  • Example 1 80 min. 93% C40-PEG 5K -Ex4 (linear)
  • Example 2 80 min. 89% C40-PEG 20K -Ex4 (linear)
  • Example 3 80 min. 91% C40-PEG 20K -Ex4 (branch)
  • Example 4 80 min. 90% C40-PEG 23K -Ex4 (trimer)
  • Example 5 80 min. 85% C40-PEG 50K -Ex4 (trimer)
  • reaction time was 80 minutes in average, production being done with yield of over 90% average (refer to FIG. 7 ).
  • exendin-4 molecular weight: 4186.6, sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
  • succinimidyl activated monomethoxy PEG mPEG-SPA, MW: 5, 20 kDa (Linear type)
  • cysteine introduced exendin-4-Cys and maleimide activated monomethoxy PEG was performed to prepare non-specific PEG bound exendin-4 (refer to FIG. 2 and FIG. 5 ).
  • succinimidyl activated monomethoxy PEG (mPEG-SPA) was purchased from Nippon Oil and Fats, NOF, Tokyo, and used.
  • the reaction time of non-specific primary amine PEG binding reaction was 80 minutes in average, average yield being 20% for Comparative example 1a(Lys 12 -PEG 20K -Ex4) and 31% for Comparative example 1b(Lys 27 -PEG 20K -Ex4) (refer to FIG. 8 ).
  • exendin-4 molecular weight: 4186.6, sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
  • mPEG-ALD monomethoxy PEG-aldehyde
  • cysteine introduced exendin-4-Cys and maleimide activated monomethoxy PEG was performed to prepare non-specific PEG bound exendin-4 (refer to FIG. 3 and FIG. 6 ).
  • the monomethoxy PEG-aldehyde was purchased from Nippon Oil and Fats, NOF, Tokyo and used.
  • Example 1 C40-PEG 5K -Ex4), Comparative example 1a (Lys 12 -PEG 5K -Ex4), Comparative example 1b (Lys 27 -PEG 5K -Ex4) and Comparative example 2 (N ter -PEG 5K -Ex4) prepared in Example 1, Comparative example 1 and 2.
  • GLP-1R GLP-1 receptor
  • Islet cells (RIN-m5F, ATCC, Manassas, Va.) expressing vast quantity of GLP-1 receptor (GLP-1R) were inoculated in 12-wells plates. It was washed twice with binding buffer (120 mM NaCl, 1.2 mM MgSO 4 , 13 mM sodium acetate, 5 mM KCl, 1.2 g/l Tris, 2 g/l bovine serum albumin, 1.8 g/l glucose, pH 7.6) after 48 hours and unmarked PEG bound exendin-4 analogue (final concentration range: 0.001-1000 nM) and exendin-4 marked with 30 pM concentration I-125 (9-39, PerkinElmer, Boston, Mass.) were treated simultaneously.
  • binding buffer 120 mM NaCl, 1.2 mM MgSO 4 , 13 mM sodium acetate, 5 mM KCl, 1.2 g/l Tris, 2 g/l bovine serum albumin, 1.8 g
  • C40 site specific PEG bound exendin-4 composition according to the present invention not only can solve the weakness of quick excretion of medications due to low molecular weight of exendin-4, but also can be used beneficially as a diabetes medication since GLP-1 receptor affinity shows similar biological activity as exendin-4 (refer to FIG. 10 ).
  • Type 2 diabetic C57BL/6 db/db mice male, 4-5 weeks old, Central Lab. Animal Inc. were used, and animals were exposed to light at 12 hours cycle and were grown after having stabilized two week by allowing free intake of foods and water.
  • the experimental animals were managed following the guideline of National Institute of Health (NIH) and authorized by Institutional Animal Care and Use Committee of Sungkyunkwan University, and the experiment was performed humanely.
  • NASH National Institute of Health
  • C40-PEG 5K -Ex4 (linear), C40-PEG-Ex4 (linear), C40-PEG 20K -Ex4 (branch), C40-PEG 23K -Ex4 (trimer) and C40-PEG 50K -Ex4 (trimer) prepared from the Example 1 to 5 and Lys 27 -PEG 20K -Ex4 prepared in Comparative example 1 b were intraperitoneally injected with 25 nmol/kg dose to male db/db mice (6-7 weeks old), blood was collected from tail vein of mice following the float time:0, 0.5, 1, 2, 3, 4, 6, 8, 12, 24, 36, 48, 60, 72, 96 hours and blood glucose concentration was measured with ACCU-CHEK Sensor (Roche Diagnostics Corp., USA). Afterwards, the low blood glucose sustaining time (blood glucose level ⁇ 8.35 mmol/l (150 mg/dL)) was additionally measured and shown in Table 4 and FIG. 12 . In the present experiment, exendin-4 was used as the control group
  • Example 4 Example 5 (Lys 27 - group Untreated (h) (PEG 5K ) (PEG 20K ) (PEG 20K ) (PEG 23K ) (PEG 50K ) PEG 20K -Ex4) (Ex-4) group 0 23.38 24.28 24.44 24.22 24.56 24.13 22.61 24.23 0.5 7.62 7.96 7.86 7.97 7.63 7.97 6.95 24.21 1 7.36 6.13 6.89 6.99 6.25 6.56 6.41 23.44 2 5.09 5.29 5.04 4.96 5.45 5.24 5.80 24.58 3 4.46 4.18 4.15 4.11 4.64 4.22 5.85 22.96 4 4.93 4.34 4.66 4.54 4.23 4.29 8.02 24.54 6 5.73 4.9 4.67 4.87 4.26 4.85 10.69 23.43 8 9.04 4.57 5.11 4.66 4.69 5.13 16.01 24.94 12
  • C40 site specific PEG bound exendin-4 composition according to the present invention can be used beneficially as a diabetes medication by having solved the weakness of quick excretion of medications due to low molecular weight of exendin-4 and consequently sustaining blood glucose level 7-8 times more stable than the Comparative examples.
  • C40 site specific PEG bound exendin-4 analogue according to the present invention can be formulated into various forms following purposes.
  • the following is an illustration of few formulation methods that include C40 site specific PEG bound exendin-4 analogue according to the present invention as an active ingredient, and the present invention is not limited thereof.
  • the ingredients were mixed and stuffed in sealed packages to prepare powders.
  • C40 site specific PEG bound exendin-4 analogue 100 mg Corn starch 100 mg Lactose 100 mg Magnesium stearate 2 mg
  • the ingredients were mixed and compressed according to general preparation methods for tablets to prepare tablets.
  • C40 site specific PEG bound exendin-4 analogue 100 mg Corn starch 100 mg Lactose 100 mg Magnesium stearate 2 mg
  • the ingredients were mixed and stuffed in gelatin capsules according to general preparation methods for capsules to prepare capsules.
  • the ingredients were included with the given quantity according to general preparation methods for injections to prepare injections.
  • the yield of an exendin-4 analogue in which a cysteine (Cys) is introduced into #40 site of the C-terminal and is PEGylated with polyethylene glycol (PEG) or a derivative thereof can be increased and the treatment effect of medications can be increased, and thus the exendin-4 analogue can be beneficially used as a composition for prevention or treatment of diseases caused by insulin hypersecretion.
  • Cys cysteine
  • PEG polyethylene glycol

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Epidemiology (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Molecular Biology (AREA)
  • Endocrinology (AREA)
  • Organic Chemistry (AREA)
  • Zoology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Vascular Medicine (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Immunology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Inorganic Chemistry (AREA)
  • General Chemical & Material Sciences (AREA)
  • Diabetes (AREA)
  • Genetics & Genomics (AREA)
  • Toxicology (AREA)
  • Dermatology (AREA)
  • Oil, Petroleum & Natural Gas (AREA)
  • Obesity (AREA)
  • Hematology (AREA)
  • Emergency Medicine (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Medicinal Preparation (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Peptides Or Proteins (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
US13/882,361 2011-06-28 2012-06-28 Exendin-4 analogue pegylated with polyethylene glycol or derivative thereof, preparation method thereof, and pharmaceutical compostion for preventing or treating diabetes, containing same as active ingredient Abandoned US20130217622A1 (en)

Applications Claiming Priority (3)

Application Number Priority Date Filing Date Title
KR10-2011-0062858 2011-06-28
KR1020110062858A KR101357117B1 (ko) 2011-06-28 2011-06-28 폴리에틸렌글라이콜 또는 이의 유도체로 페길화된 엑센딘-4 유사체, 이의 제조방법 및 이를 유효성분으로 함유하는 당뇨병 예방 또는 치료용 약학적 조성물
PCT/KR2012/005137 WO2013002580A2 (ko) 2011-06-28 2012-06-28 폴리에틸렌글라이콜 또는 이의 유도체로 페길화된 엑센딘-4 유사체, 이의 제조방법 및 이를 유효성분으로 함유하는 당뇨병 예방 또는 치료용 약학적 조성물

Related Parent Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2012/005137 A-371-Of-International WO2013002580A2 (ko) 2011-06-28 2012-06-28 폴리에틸렌글라이콜 또는 이의 유도체로 페길화된 엑센딘-4 유사체, 이의 제조방법 및 이를 유효성분으로 함유하는 당뇨병 예방 또는 치료용 약학적 조성물

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US15/413,029 Continuation US10406230B2 (en) 2011-06-28 2017-01-23 Exendin-4 analogue pegylated with polyethylene glycol or derivative thereof, preparation method thereof, and pharmaceutical composition for preventing or treating diabetes, containing same as active ingredient

Publications (1)

Publication Number Publication Date
US20130217622A1 true US20130217622A1 (en) 2013-08-22

Family

ID=47424684

Family Applications (2)

Application Number Title Priority Date Filing Date
US13/882,361 Abandoned US20130217622A1 (en) 2011-06-28 2012-06-28 Exendin-4 analogue pegylated with polyethylene glycol or derivative thereof, preparation method thereof, and pharmaceutical compostion for preventing or treating diabetes, containing same as active ingredient
US15/413,029 Active 2032-12-06 US10406230B2 (en) 2011-06-28 2017-01-23 Exendin-4 analogue pegylated with polyethylene glycol or derivative thereof, preparation method thereof, and pharmaceutical composition for preventing or treating diabetes, containing same as active ingredient

Family Applications After (1)

Application Number Title Priority Date Filing Date
US15/413,029 Active 2032-12-06 US10406230B2 (en) 2011-06-28 2017-01-23 Exendin-4 analogue pegylated with polyethylene glycol or derivative thereof, preparation method thereof, and pharmaceutical composition for preventing or treating diabetes, containing same as active ingredient

Country Status (10)

Country Link
US (2) US20130217622A1 (enExample)
EP (1) EP2727605B1 (enExample)
JP (1) JP6084215B2 (enExample)
KR (1) KR101357117B1 (enExample)
CN (1) CN103338790B (enExample)
AU (1) AU2012276478B2 (enExample)
CA (1) CA2839410C (enExample)
DK (1) DK2727605T3 (enExample)
ES (1) ES2674581T3 (enExample)
WO (1) WO2013002580A2 (enExample)

Cited By (16)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9670261B2 (en) 2012-12-21 2017-06-06 Sanofi Functionalized exendin-4 derivatives
WO2017112889A1 (en) 2015-12-23 2017-06-29 The Johns Hopkins University Long-acting glp-1r agonist as a therapy of neurological and neurodegenerative conditions
US9694053B2 (en) 2013-12-13 2017-07-04 Sanofi Dual GLP-1/glucagon receptor agonists
US9751926B2 (en) 2013-12-13 2017-09-05 Sanofi Dual GLP-1/GIP receptor agonists
US9750788B2 (en) 2013-12-13 2017-09-05 Sanofi Non-acylated exendin-4 peptide analogues
US9758561B2 (en) 2014-04-07 2017-09-12 Sanofi Dual GLP-1/glucagon receptor agonists derived from exendin-4
US9771406B2 (en) 2014-04-07 2017-09-26 Sanofi Peptidic dual GLP-1/glucagon receptor agonists derived from exendin-4
US9775904B2 (en) 2014-04-07 2017-10-03 Sanofi Exendin-4 derivatives as peptidic dual GLP-1/glucagon receptor agonists
US9789165B2 (en) 2013-12-13 2017-10-17 Sanofi Exendin-4 peptide analogues as dual GLP-1/GIP receptor agonists
US9932381B2 (en) 2014-06-18 2018-04-03 Sanofi Exendin-4 derivatives as selective glucagon receptor agonists
US9982029B2 (en) 2015-07-10 2018-05-29 Sanofi Exendin-4 derivatives as selective peptidic dual GLP-1/glucagon receptor agonists
US10758592B2 (en) 2012-10-09 2020-09-01 Sanofi Exendin-4 derivatives as dual GLP1/glucagon agonists
US10806797B2 (en) 2015-06-05 2020-10-20 Sanofi Prodrugs comprising an GLP-1/glucagon dual agonist linker hyaluronic acid conjugate
US10894076B2 (en) 2015-12-29 2021-01-19 Pegbio Co., Ltd. Composition comprising GLP-1 receptor agonist and glucagon receptor agonist and application thereof
WO2023028554A1 (en) 2021-08-25 2023-03-02 Neuraly, Inc. Glp-1r agonists for use in a treatment of neurological impairment associated with viral infection
WO2024229006A1 (en) * 2023-05-01 2024-11-07 Neuraly, Inc. Glucagon-like peptide-1 receptor agonist variants and methods thereof

Families Citing this family (17)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2851429B1 (en) 2012-05-18 2019-07-24 Adda Biotech Inc. Protein and protein conjugate for diabetes treatment, and applications thereof
CN105934257B (zh) 2013-12-06 2020-10-09 韩捷 用于含氮和羟基的药物的生物可逆引入基团
CN105985425B (zh) * 2014-12-11 2019-12-17 浙江海昶生物医药技术有限公司 一种聚乙二醇修饰的exendin类似物及其制备方法和应用
WO2017024182A1 (en) 2015-08-04 2017-02-09 Duke University Genetically encoded intrinsically disordered stealth polymers for delivery and methods of using same
US11752213B2 (en) 2015-12-21 2023-09-12 Duke University Surfaces having reduced non-specific binding and antigenicity
US11467156B2 (en) 2016-06-01 2022-10-11 Duke University Nonfouling biosensors
WO2018057847A1 (en) 2016-09-23 2018-03-29 Duke University Unstructured non-repetitive polypeptides having lcst behavior
US11648200B2 (en) 2017-01-12 2023-05-16 Duke University Genetically encoded lipid-polypeptide hybrid biomaterials that exhibit temperature triggered hierarchical self-assembly
WO2018213320A1 (en) 2017-05-15 2018-11-22 Duke University Recombinant production of hybrid lipid-biopolymer materials that self-assemble and encapsulate agents
WO2019147954A1 (en) 2018-01-26 2019-08-01 Duke University Albumin binding peptide-drug (aibiped) conjugates and methods of making and using same
WO2019213150A1 (en) 2018-04-30 2019-11-07 Duke University Stimuli-responsive peg-like polymer-based drug delivery platform
KR20200135618A (ko) * 2019-05-23 2020-12-03 ㈜ 디앤디파마텍 폴리펩티드를 포함하는 비알코올성 지방간 질환의 예방 또는 치료용 약학 조성물
US11649275B2 (en) 2018-08-02 2023-05-16 Duke University Dual agonist fusion proteins
US11512314B2 (en) 2019-07-12 2022-11-29 Duke University Amphiphilic polynucleotides
KR102193211B1 (ko) * 2019-11-27 2020-12-18 (주)디앤디파마텍 비오틴 모이어티가 결합된 폴리펩티드 및 이를 포함하는 경구 투여용 약학적 조성물
US20240181013A1 (en) * 2021-04-01 2024-06-06 Duke University Poegma copolymer conjugates and methods of treating diseases
KR20240155737A (ko) 2023-04-20 2024-10-29 전북대학교산학협력단 폴리에틸렌글리콜을 이용한 분자 전달 방법

Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2000069911A1 (en) * 1999-05-17 2000-11-23 Conjuchem, Inc. Long lasting insulinotropic peptides
US20060286066A1 (en) * 2003-06-30 2006-12-21 Domantis Limited Pegylated immunoglobulin variable region polypeptides
WO2007075534A2 (en) * 2005-12-16 2007-07-05 Nektar Therapeutics Al, Corporation Polymer conjugates of glp-1
WO2008130066A1 (en) * 2007-04-20 2008-10-30 Kang Choon Lee Mono modified exendin with polyethylene glycol or its derivatives and uses thereof
WO2010121559A1 (zh) * 2009-04-23 2010-10-28 派格生物医药(苏州)有限公司 新型exendin变体及其缀合物

Family Cites Families (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
ES2343072T3 (es) * 1999-01-14 2010-07-22 Amylin Pharmaceuticals, Inc. Exendina para la supresion del glucagon.
EP1539210A4 (en) * 2002-09-06 2006-06-07 Bayer Pharmaceuticals Corp GLP-1 RECEPTOR MODIFIED AGONISTS AND THEIR PHARMACOLOGICAL METHODS OF USE
JP2008516621A (ja) * 2004-10-18 2008-05-22 ノボ ノルディスク アクティーゼルスカブ 成長ホルモン結合体
KR100890989B1 (ko) * 2006-06-01 2009-03-31 이강춘 폴리에틸렌글리콜 또는 이의 유도체로 단일 수식된 엑센딘,이의 제조방법 및 이의 용도
KR101112578B1 (ko) * 2009-07-16 2012-02-16 성균관대학교산학협력단 엑센딘의 비강투여용 약제학적 조성물 및 이의 제조방법

Patent Citations (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2000069911A1 (en) * 1999-05-17 2000-11-23 Conjuchem, Inc. Long lasting insulinotropic peptides
US20060286066A1 (en) * 2003-06-30 2006-12-21 Domantis Limited Pegylated immunoglobulin variable region polypeptides
WO2007075534A2 (en) * 2005-12-16 2007-07-05 Nektar Therapeutics Al, Corporation Polymer conjugates of glp-1
WO2008130066A1 (en) * 2007-04-20 2008-10-30 Kang Choon Lee Mono modified exendin with polyethylene glycol or its derivatives and uses thereof
WO2010121559A1 (zh) * 2009-04-23 2010-10-28 派格生物医药(苏州)有限公司 新型exendin变体及其缀合物
US20120196795A1 (en) * 2009-04-23 2012-08-02 Pegbio Co., Ltd. Novel exendin variant and conjugate thereof

Non-Patent Citations (12)

* Cited by examiner, † Cited by third party
Title
Berendsen, A Glimpae of the Holy Grail?, Science, 1998, 282, pages 642-643. *
Bradley et al., Limits of Cooperativity in a Structurally Modular Protein: Response of the Notch Ankyrin Domain to Analogous Alanine Substitutions in Each Repeat, J. Mol. BIoL (2002) 324, 373-386. *
Definition of Analogue and Derivative, On-line Medical Dictionary, accessed March 5, 2000. *
Jaime Davidson, Advances in therapy for type 2 diabetes: GLP-1 receptor agonists and DPP-4 inhibitors, CLEVELAND CLINIC JOURNAL OF MEDICINE VOLUME 76 , SUPPLEMENT 5 DECEMBER 2009. *
Ngo et al, Computational Complexity, Protein Structure Protection, and the Levinthal Paradox, 1994, pages 491-494. *
Rudinger, Peptide Hormones, JA Parsons, Ed., 1976, pages 1-7. *
SIGMA, 2004, pages 1-2. *
Song Xue, Exendin-4 treatment of nonobese diabetic mice increases beta-cell proliferation and fractional insulin reactive area, Journal of Diabetes and Its Complications 24 (2010) 163-167. *
The definition of dimer, thefreedictionary.com, accessed on 12/8/2014. *
The definition of trimer, thefreedictionary.com, accessed on 12/8/2014. *
The Mayo Clinic, Diabetes, Diabetes Symptoms, www.mayoclinic.org/diseases-conditions/diabetes/in-depth/diabetes-symptoms/art, accessed on 12/9/2014. *
Voet et al, Biochemistry, John Wiley & Sons Inc., 1995, pages 235-241. *

Cited By (21)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10758592B2 (en) 2012-10-09 2020-09-01 Sanofi Exendin-4 derivatives as dual GLP1/glucagon agonists
US10253079B2 (en) 2012-12-21 2019-04-09 Sanofi Functionalized Exendin-4 derivatives
US9745360B2 (en) 2012-12-21 2017-08-29 Sanofi Dual GLP1/GIP or trigonal GLP1/GIP/glucagon agonists
US9670261B2 (en) 2012-12-21 2017-06-06 Sanofi Functionalized exendin-4 derivatives
US9694053B2 (en) 2013-12-13 2017-07-04 Sanofi Dual GLP-1/glucagon receptor agonists
US9751926B2 (en) 2013-12-13 2017-09-05 Sanofi Dual GLP-1/GIP receptor agonists
US9750788B2 (en) 2013-12-13 2017-09-05 Sanofi Non-acylated exendin-4 peptide analogues
US9789165B2 (en) 2013-12-13 2017-10-17 Sanofi Exendin-4 peptide analogues as dual GLP-1/GIP receptor agonists
US9758561B2 (en) 2014-04-07 2017-09-12 Sanofi Dual GLP-1/glucagon receptor agonists derived from exendin-4
US9771406B2 (en) 2014-04-07 2017-09-26 Sanofi Peptidic dual GLP-1/glucagon receptor agonists derived from exendin-4
US9775904B2 (en) 2014-04-07 2017-10-03 Sanofi Exendin-4 derivatives as peptidic dual GLP-1/glucagon receptor agonists
US9932381B2 (en) 2014-06-18 2018-04-03 Sanofi Exendin-4 derivatives as selective glucagon receptor agonists
US10806797B2 (en) 2015-06-05 2020-10-20 Sanofi Prodrugs comprising an GLP-1/glucagon dual agonist linker hyaluronic acid conjugate
US9982029B2 (en) 2015-07-10 2018-05-29 Sanofi Exendin-4 derivatives as selective peptidic dual GLP-1/glucagon receptor agonists
WO2017112889A1 (en) 2015-12-23 2017-06-29 The Johns Hopkins University Long-acting glp-1r agonist as a therapy of neurological and neurodegenerative conditions
US11123405B2 (en) 2015-12-23 2021-09-21 The Johns Hopkins University Long-acting GLP-1R agonist as a therapy of neurological and neurodegenerative conditions
EP3393496B1 (en) * 2015-12-23 2023-10-11 The Johns Hopkins University Long-acting glp-1r agonist as a therapy of neurological and neurodegenerative conditions
US12233109B2 (en) 2015-12-23 2025-02-25 The Johns Hopkins University Long-acting GLP-1r agonist as a therapy of neurological and neurodegenerative conditions
US10894076B2 (en) 2015-12-29 2021-01-19 Pegbio Co., Ltd. Composition comprising GLP-1 receptor agonist and glucagon receptor agonist and application thereof
WO2023028554A1 (en) 2021-08-25 2023-03-02 Neuraly, Inc. Glp-1r agonists for use in a treatment of neurological impairment associated with viral infection
WO2024229006A1 (en) * 2023-05-01 2024-11-07 Neuraly, Inc. Glucagon-like peptide-1 receptor agonist variants and methods thereof

Also Published As

Publication number Publication date
WO2013002580A2 (ko) 2013-01-03
KR101357117B1 (ko) 2014-02-06
JP2014520798A (ja) 2014-08-25
CN103338790B (zh) 2018-01-23
EP2727605B1 (en) 2018-04-04
ES2674581T3 (es) 2018-07-02
WO2013002580A3 (ko) 2013-04-11
CN103338790A (zh) 2013-10-02
EP2727605A4 (en) 2014-12-24
CA2839410C (en) 2019-05-14
CA2839410A1 (en) 2013-01-03
DK2727605T3 (en) 2018-06-25
AU2012276478A1 (en) 2014-01-23
US10406230B2 (en) 2019-09-10
JP6084215B2 (ja) 2017-02-22
KR20130008665A (ko) 2013-01-23
EP2727605A2 (en) 2014-05-07
US20170189545A1 (en) 2017-07-06
AU2012276478B2 (en) 2016-02-25

Similar Documents

Publication Publication Date Title
US10406230B2 (en) Exendin-4 analogue pegylated with polyethylene glycol or derivative thereof, preparation method thereof, and pharmaceutical composition for preventing or treating diabetes, containing same as active ingredient
KR102449145B1 (ko) 지속형 인슐린 아날로그 결합체 및 지속형 인슐린 분비 펩타이드 결합체를 포함하는 당뇨병 치료용 조성물
AU739263B2 (en) Antagonists of intestinotrophic GLP-2 peptides
US20110020345A1 (en) Drug fusions and conjugates
WO2021022149A1 (en) Insulin analogs and methods of using the same
KR100890989B1 (ko) 폴리에틸렌글리콜 또는 이의 유도체로 단일 수식된 엑센딘,이의 제조방법 및 이의 용도
CN111194223A (zh) 与白蛋白具有较佳结合亲和力的药物分子
US11807672B2 (en) Conjugates of islet neogenesis peptides and analogs, and methods thereof
CA2950266C (en) Composition for treating diabetes, comprising long-acting insulin analogue conjugate and long-acting insulinotropic peptide conjugate
KR20120104459A (ko) 페길화된 엑센딘-4 이량체, 이의 제조방법 및 이를 유효성분으로 함유하는 약학적 조성물
NZ726959B2 (en) Composition for treating diabetes comprising long-acting insulin analogue conjugate and long-acting insulinotropic peptide conjugate
HK1230958A1 (en) Composition for treating diabetes, containing long-acting insulin analog conjugate and long-acting insulin secretion peptide conjugate
HK1230958B (en) Composition for treating diabetes, containing long-acting insulin analog conjugate and long-acting insulin secretion peptide conjugate

Legal Events

Date Code Title Description
AS Assignment

Owner name: B&L DELIPHARM, CORP., KOREA, REPUBLIC OF

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:LEE, SUNG KWON;KIM, WON BAE;LEE, SEULKI;AND OTHERS;REEL/FRAME:030308/0450

Effective date: 20130404

AS Assignment

Owner name: THERALY PHARMACEUTICALS INC., MARYLAND

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:B&L DELIPHARM, CORP.;REEL/FRAME:033521/0483

Effective date: 20140708

STCB Information on status: application discontinuation

Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION