US20130217622A1 - Exendin-4 analogue pegylated with polyethylene glycol or derivative thereof, preparation method thereof, and pharmaceutical compostion for preventing or treating diabetes, containing same as active ingredient - Google Patents
Exendin-4 analogue pegylated with polyethylene glycol or derivative thereof, preparation method thereof, and pharmaceutical compostion for preventing or treating diabetes, containing same as active ingredient Download PDFInfo
- Publication number
- US20130217622A1 US20130217622A1 US13/882,361 US201213882361A US2013217622A1 US 20130217622 A1 US20130217622 A1 US 20130217622A1 US 201213882361 A US201213882361 A US 201213882361A US 2013217622 A1 US2013217622 A1 US 2013217622A1
- Authority
- US
- United States
- Prior art keywords
- exendin
- analogue
- derivative
- polyethylene glycol
- peg
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/02—Inorganic compounds
-
- A61K47/48215—
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/22—Hormones
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/22—Hormones
- A61K38/2278—Vasoactive intestinal peptide [VIP]; Related peptides (e.g. Exendin)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/06—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
- A61K47/26—Carbohydrates, e.g. sugar alcohols, amino sugars, nucleic acids, mono-, di- or oligo-saccharides; Derivatives thereof, e.g. polysorbates, sorbitan fatty acid esters or glycyrrhizin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/30—Macromolecular organic or inorganic compounds, e.g. inorganic polyphosphates
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/56—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule
- A61K47/59—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes
- A61K47/60—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes the organic macromolecular compound being a polyoxyalkylene oligomer, polymer or dendrimer, e.g. PEG, PPG, PEO or polyglycerol
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/0012—Galenical forms characterised by the site of application
- A61K9/0019—Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/20—Pills, tablets, discs, rods
- A61K9/2004—Excipients; Inactive ingredients
- A61K9/2013—Organic compounds, e.g. phospholipids, fats
- A61K9/2018—Sugars, or sugar alcohols, e.g. lactose, mannitol; Derivatives thereof, e.g. polysorbates
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/20—Pills, tablets, discs, rods
- A61K9/2004—Excipients; Inactive ingredients
- A61K9/2022—Organic macromolecular compounds
- A61K9/205—Polysaccharides, e.g. alginate, gums; Cyclodextrin
- A61K9/2059—Starch, including chemically or physically modified derivatives; Amylose; Amylopectin; Dextrin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/48—Preparations in capsules, e.g. of gelatin, of chocolate
- A61K9/4841—Filling excipients; Inactive ingredients
- A61K9/4858—Organic compounds
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/48—Preparations in capsules, e.g. of gelatin, of chocolate
- A61K9/4841—Filling excipients; Inactive ingredients
- A61K9/4866—Organic macromolecular compounds
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
- C07K14/57563—Vasoactive intestinal peptide [VIP]; Related peptides
Definitions
- the present disclosure relates to an exendin-4 analogue PEGylated with polyethylene glycol or a derivative thereof, a preparation method thereof, and a pharmaceutical composition for prevention or treatment of diabetes containing the same as an active ingredient.
- PEGylation of peptides and proteins for the purpose of treatment is the most effective technology.
- PEGylation of peptides and proteins increases molecular weight thereof, protein degradation site defense and immunogenicity site defense, which consequently increases half-life of in vivo medications and reduce immunogenicity of peptides and proteins. Therefore, PEGylation technology has an effect of increasing treatment effect by solving problems of original medications, and due to such strength, serves an important role in increasing effects of PEGylated peptide and protein medication delivery system.
- peptides and proteins increase treatment effect by covalently bonding with polyethylene glycol (PEG).
- PEG polyethylene glycol
- Such technology increases molecular weight, defense of a metabolism site and inhibition of an immunogenicity site, increasing in vivo half-life and stability and reducing immunogenicity.
- kidney excretion of peptides and proteins bound with PEG is reduced due to the increase of molecular weights of peptides and proteins by PEG, so that PEGylation has advantages of increasing effects in both pharmacokinetically and pharmacodynamically.
- PEGylation reacting sites of peptides and proteins are randomly dispersed and are occasionally close to bioactive sites.
- traditional PEGylation employs nonspecific PEGylation methods that do not consider PEG reacting site, number of PEG bonds and biological activity.
- nonspecific PEGylation method reduces treatment effects by bringing insufficient conformation by producing various branched type PEG-bonded isomers that have different physiochemical, biological and pharmacokinetic characteristics.
- Specific PEGylation methods have been studied to solve such problems, and recently the specific PEGylation methods are rapidly developing to become a method of maximizing medications' treatment effects as genetic engineering technology and selective functional group introducing technology are quickly developing.
- G-CSF granulocyte stimulating factor
- Exendin-4 is a polypeptide substance and is the first incretin analogue, a diabetes medication prepared by synthesizing exendin-4, a salivary substance of Gila monster. Exendin-4 is different from exendin-3 for only #2 and #3 sites, is known to have a longer half-life than glucagon like peptide-1 (GLP-1) which is a diabetes medication having a half-life shorter than two minutes for DPP-IV, an enzyme that is resistant for directly degrading incretin enzyme that is produced in mammals' stomachs after ingestion by DPP-IV (dipeptidyl peptidase-4) to serve beneficial roles of promoting insulin secretion and lowering blood sugar level, and also, it shows 2-4 hours of half-life in vivo experiment, and it has been confirmed that it can reach enough blood concentration with 2-3 times of intraperitoneal injection per day.
- GLP-1 glucagon like peptide-1
- exendin-4 is known to control gastrointestinal tracts' motility, reduces food intake and suppresses blood plasma glucagon, and recently PLGA microsphere type synthetic exendin-4 (product name: Byetta) has been authorized by US FDA and is about to be released.
- This Byetta LAR product has complicated preparation process and is short in vivo half-life for exendin-4, which is about 4-6 hours, frequent administration of high dose exendin-4 is required, and the problem of medication release control based on quick excretion due to the low molecular weight of lower than 4200, and problems such as immunogenicity still exist.
- One object of the present invention is to provide an exendin-4 analogue in which a cysteine (Cys) is introduced into #40 site of C-terminal and is PEGylated with polyethylene glycol (PEG) or derivatives thereof.
- Cys cysteine
- PEG polyethylene glycol
- Another object of the present invention is to provide a method of preparing the exendin-4 analogue.
- Still another object of the present invention is to provide a pharmaceutical composition for prevention or treatment of diseases caused by insulin hypersecretion, containing the exendin-4 analogue as an active ingredient.
- the present invention provides an exendin-4 analogue that has a cysteine (Cys) introduced into #40 site of C-terminal, which is PEGylated with polyethylene glycol (PEG) or derivatives thereof.
- Cys cysteine
- PEG polyethylene glycol
- the present invention also provides a method of preparing the exendin-4 analogue.
- the present invention provides a pharmaceutical composition for prevention or treatment of diseases caused by insulin hypersecretion containing the exendin-4 analogue as an active ingredient.
- the yield of an exendin-4 analogue in which a cysteine (Cys) is introduced into #40 site of the C-terminal and is PEGylated with polyethylene glycol (PEG) or derivatives thereof can be increased, and treatment effect of medications can be increased, and thus the exendin-4 analogue can be beneficially used as a composition for prevention or treatment of diseases caused by insulin hypersecretion.
- Cys cysteine
- PEG polyethylene glycol
- FIG. 1 is a schematic view illustrating PEGylation of exendin-4 in which cysteine (Cys 40) is introduced into the C-terminal of example 1 of the present invention.
- FIG. 2 is a schematic view illustrating PEGylation for lycine amine of exendin-4 of comparative example 1 of the present invention.
- FIG. 3 is a schematic view illustrating PEGylation for N-terminal of exendin-4 of comparative example 2 of the present invention.
- FIG. 4 is a view illustrating light absorbance of example 1 of the present invention.
- FIG. 5 is a view illustrating light absorbance of comparative examples 1a to 1c of the present invention.
- FIG. 6 is a view illustrating light absorbance of comparative example 2 of the present invention.
- FIG. 7 is a view illustrating the production yield of example 1 of the present invention.
- FIG. 8 is a drawing illustrating product yield of comparative examples 1a to 1c of the present invention.
- FIG. 9 is a view illustrating the production yield of comparative example 2 of the present invention.
- FIG. 10 is a view illustrating the affinity of a PEG bound exendin-4 analogue to a GLP-1 receptor according to an example of the present invention.
- FIG. 11 is a schematic view illustrating PEG bound exendin-4 analogues of examples 4 and 5 of the present invention.
- FIG. 12 is a view illustrating blood glucose level for diabetic mice administrated with a PEG bound exendin-4 analogue according to an example of the present invention.
- the present invention provides an exendin-4 analogue in which a cysteine (Cys) is introduced into #40 site of the C-terminal and is PEGylated with polyethylene glycol (PEG) or a derivative thereof.
- Cys cysteine
- PEG polyethylene glycol
- the molecular weight of polyethylene glycol or a derivative thereof according to the present invention is 5-60 kDa, and preferably 20-50 kDa, but is not limited thereto.
- the polyethylene glycol or a derivative thereof according to the present invention is a linear type or a branched type, and for the branched type, preferably a dimeric type or a trimeric type may be used, and more preferably a trimeric type may be used.
- the polyethylene glycol derivative is, for example, methoxypolyethylene glycol succinimidylpropionate, methoxypolyethylene glycol N-hydroxysuccinimide, methoxypolyethylene glycol propionaldehyde, methoxypolyethylene glycol maleimide, or multiple branched types of these derivatives.
- the polyethylene glycol derivative is linear methoxypolyethylene glycol maleimide, branch type methoxypolyethylene glycol maleimide or trimeric methoxypolyethylene glycol maleimide, and more preferably is trimeric methoxypolyethylene glycol maleimide.
- the present invention provides a method of preparing an exendin-4 analogue PEGylated with the polyethylene glycol or a derivative thereof, which includes a process of dissolving exendin-4 in which cysteine is introduced into #40 site of the C-terminal, and polyethylene glycol or a derivative thereof in phosphate buffer saline solution and reacting them at room temperature.
- an exendin-4 analogue PEGylated with polyethylene glycol or a derivative thereof may be prepared by adding exendin-4 in which cysteine is introduced into #40 site of the C-terminal, and polyethylene glycol or a derivative thereof in a phosphate buffer saline solution in a mole ratio of 1:1-3 in a phosphate buffer saline having a pH range of 7.2-7.8, preferably pH 7.5, dissolving these ingredients, and perform a reaction for 1-3 hours at room temperature although the reaction temperature is not particularly limited, and performing a column chromatography after the reaction is completed.
- the yield may decrease.
- the molecular structure of the exendin-4 analogue may be confirmed by a mass spectroscope, a liquid chromatography, an X-ray diffraction analysis, a polarimetry, and comparison between calculated values and measured values of representative elements constituting the exendin-4 analogue.
- the present invention provides a pharmaceutical composition for prevention or treatment of diseases caused by insulin hypersecretion, containing the exendin-4 analogue as an active ingredient.
- the present invention provides a treatment method characterized with administration of the exendin-4 analogue PEGylated with polyethylene glycol or a derivative thereof to patients in need of treating the diseases caused by insulin hypersecretion.
- the diseases caused by insulin hypersecretion may include Type 1 diabetes, Type 2 diabetes and diabetes complications.
- FIG. 11 a schematic diagram of the present invention's exendin-4 bound with a trimeric PEG at C40 site is shown in FIG. 11 .
- the C40 site specific PEG bound exendin-4 compound according to the present invention can solve the drawback of quick excretion of medications due to the low molecular weight of existing exendin-4, has excellent affinity to the GLP-1 receptor, and has strong low blood glucose maintaining ability capable of maintaining blood glucose level up to 3-4 days after having administrated the medications, so it can be used beneficially for preventing or treating insulin hypersecretion related Type 1 diabetes, Type 2 diabetes and diseases related with diabetes complications.
- the pharmaceutical composition containing the exendin-4 analogue PEGylated with polyethylene glycol or a derivative thereof may be administrated after having formulated into various oral or non-oral administration forms as the following in case of clinical administration, but is not limited thereof.
- formulations for example, there are tablets, pellets, hard/soft capsules, liquids, suspensions, emulsifiers, syrups, granules, elixirs, troches, etc., and these formulations include diluents (example: lactose, dextrose, sucrose, mannitol, sorbitol, cellulose and/or glycine), slip modifiers (example: silica, talc, stearate and its magnesium or calcium salt and/or polyethylene glycol) in addition to the active ingredient.
- diluents example: lactose, dextrose, sucrose, mannitol, sorbitol, cellulose and/or glycine
- slip modifiers example: silica, talc, stearate and its magnesium or calcium salt and/or polyethylene glycol
- Tablets may also include binders such as magnesium aluminum silicate, starch paste, gelatin, methyl cellulose, sodium carboxymethyl cellulose and/or polyvinyl pyrrolidine, and may include disintegrating agents such as starch, agar, alginic acid or sodium salt thereof or boiling mixture and/or absorbents, coloring agents, flavoring agents and sweetening agents if needed.
- binders such as magnesium aluminum silicate, starch paste, gelatin, methyl cellulose, sodium carboxymethyl cellulose and/or polyvinyl pyrrolidine
- disintegrating agents such as starch, agar, alginic acid or sodium salt thereof or boiling mixture and/or absorbents, coloring agents, flavoring agents and sweetening agents if needed.
- the pharmaceutical composition containing the exendin-4 analogue PEGylated with polyethylene glycol or a derivative thereof may be non-orally administrated, and the administration is done by subcutaneous injection, intravenous injection, intramuscular injection or intrathoracic injection.
- the exendin-4 analogue PEGylated with polyethylene glycol or a derivative thereof may be may be prepared into liquid or suspension by having mixed it with stabilizer or buffer in water to formulize it into non-orally administration purposed formulation, and this may be prepared into ampoule or vial unit administration form.
- the composition is sterilized and/or may include adjuvants such as antiseptics, stabilizers, hydrators or emulsify stimulators, osmotic pressure controlling purposed salts and/or buffers, and other substances beneficial for treatments, and may be formulated according to traditional methods of mixture, granulation or coating.
- the human body dose of the pharmaceutical composition containing the exendin-4 analogue PEGylated with polyethylene glycol or a derivative thereof according to the present invention may vary depending on the age, body weight, gender, administration form, health status and level of disease of patients, and may be administrated via oral or non-oral route following decisions of doctors or pharmacists with preferably dose of 0.01 to 200 mg/kg/day.
- exendin-4-Cys in which cysteine is introduced into the C-terminal site (#40 site) was used (exendin-Cys, molecular weight: 4290.7, sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSC), and maleimide activated monomethoxy PEG (mPEG-MAL, MW: 5, 20 kDa(Linear type), 20 kDa (Branch type), 23, 50 kDa (Trimer type)) was purchased from Nippon Oil and Fats, NOF, Tokyo, and used.
- exendin-4-Cys and mPEG-MAL (MW: 5, 20 (linear type), 20 (branch type), 23, 50 kDa) were completely dissolved in a mole ratio of 1:2 in a 20 mM phosphate buffer saline (pH 7.5) and were reacted for two hours at room temperature (refer to FIG. 1 ).
- the reacted solution was separated by a reversed phase chromatography with Capcell-pak RP-18 column (250 ⁇ 10 mm, 5 ⁇ m, Shiseido, Japan) at a flow speed of 5.0 ml/min. The separation was monitored at 215 nm wavelength ultraviolet ray.
- the mobile phase was separated using a linear concentration gradient method (36-42% B over 30 min) for 0.1% TFA distilled water (mobile phase A) and 0.1% TFA acetonitrile (mobile phase B) (refer to FIG. 4 ).
- the peaks separated by the method were collected separately, acetonitrile was removed using nitrogen gas, and the removed solution was concentrated using Centricon-10 (Mw cut off 3000, Millipore Corp., Billerica, Mass.).
- the prepared substance was stored at 4° C. and prepared by mixing 1 ⁇ l sample-matrix sample solution and 2 ⁇ l matrix solution, and the matrix solution was prepared by dissolving ⁇ -cyanohydroxycinnamic acid ( ⁇ -CHCA) with water/CAN (50:50) solution containing 0.1% (v/v) TFA.
- the prepared 1 ⁇ l sample-matrix solution was put on a sample plate, dried at vacuum status and analyzed with size exclusion chromatography (SEC) and MALDI-TOF mass spectrometer, and C40 site specific PEG bonding reaction (C40-PEG-Ex4) was analyzed at 0, 20, 40, 60 and 80 minutes and was shown with chromatogram area ratio in comparison with the initial status of exendin-4 and C40-PEG-Ex4.
- SEC size exclusion chromatography
- MALDI-TOF mass spectrometer MALDI-TOF mass spectrometer
- Example 1 80 min. 93% C40-PEG 5K -Ex4 (linear)
- Example 2 80 min. 89% C40-PEG 20K -Ex4 (linear)
- Example 3 80 min. 91% C40-PEG 20K -Ex4 (branch)
- Example 4 80 min. 90% C40-PEG 23K -Ex4 (trimer)
- Example 5 80 min. 85% C40-PEG 50K -Ex4 (trimer)
- reaction time was 80 minutes in average, production being done with yield of over 90% average (refer to FIG. 7 ).
- exendin-4 molecular weight: 4186.6, sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
- succinimidyl activated monomethoxy PEG mPEG-SPA, MW: 5, 20 kDa (Linear type)
- cysteine introduced exendin-4-Cys and maleimide activated monomethoxy PEG was performed to prepare non-specific PEG bound exendin-4 (refer to FIG. 2 and FIG. 5 ).
- succinimidyl activated monomethoxy PEG (mPEG-SPA) was purchased from Nippon Oil and Fats, NOF, Tokyo, and used.
- the reaction time of non-specific primary amine PEG binding reaction was 80 minutes in average, average yield being 20% for Comparative example 1a(Lys 12 -PEG 20K -Ex4) and 31% for Comparative example 1b(Lys 27 -PEG 20K -Ex4) (refer to FIG. 8 ).
- exendin-4 molecular weight: 4186.6, sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
- mPEG-ALD monomethoxy PEG-aldehyde
- cysteine introduced exendin-4-Cys and maleimide activated monomethoxy PEG was performed to prepare non-specific PEG bound exendin-4 (refer to FIG. 3 and FIG. 6 ).
- the monomethoxy PEG-aldehyde was purchased from Nippon Oil and Fats, NOF, Tokyo and used.
- Example 1 C40-PEG 5K -Ex4), Comparative example 1a (Lys 12 -PEG 5K -Ex4), Comparative example 1b (Lys 27 -PEG 5K -Ex4) and Comparative example 2 (N ter -PEG 5K -Ex4) prepared in Example 1, Comparative example 1 and 2.
- GLP-1R GLP-1 receptor
- Islet cells (RIN-m5F, ATCC, Manassas, Va.) expressing vast quantity of GLP-1 receptor (GLP-1R) were inoculated in 12-wells plates. It was washed twice with binding buffer (120 mM NaCl, 1.2 mM MgSO 4 , 13 mM sodium acetate, 5 mM KCl, 1.2 g/l Tris, 2 g/l bovine serum albumin, 1.8 g/l glucose, pH 7.6) after 48 hours and unmarked PEG bound exendin-4 analogue (final concentration range: 0.001-1000 nM) and exendin-4 marked with 30 pM concentration I-125 (9-39, PerkinElmer, Boston, Mass.) were treated simultaneously.
- binding buffer 120 mM NaCl, 1.2 mM MgSO 4 , 13 mM sodium acetate, 5 mM KCl, 1.2 g/l Tris, 2 g/l bovine serum albumin, 1.8 g
- C40 site specific PEG bound exendin-4 composition according to the present invention not only can solve the weakness of quick excretion of medications due to low molecular weight of exendin-4, but also can be used beneficially as a diabetes medication since GLP-1 receptor affinity shows similar biological activity as exendin-4 (refer to FIG. 10 ).
- Type 2 diabetic C57BL/6 db/db mice male, 4-5 weeks old, Central Lab. Animal Inc. were used, and animals were exposed to light at 12 hours cycle and were grown after having stabilized two week by allowing free intake of foods and water.
- the experimental animals were managed following the guideline of National Institute of Health (NIH) and authorized by Institutional Animal Care and Use Committee of Sungkyunkwan University, and the experiment was performed humanely.
- NASH National Institute of Health
- C40-PEG 5K -Ex4 (linear), C40-PEG-Ex4 (linear), C40-PEG 20K -Ex4 (branch), C40-PEG 23K -Ex4 (trimer) and C40-PEG 50K -Ex4 (trimer) prepared from the Example 1 to 5 and Lys 27 -PEG 20K -Ex4 prepared in Comparative example 1 b were intraperitoneally injected with 25 nmol/kg dose to male db/db mice (6-7 weeks old), blood was collected from tail vein of mice following the float time:0, 0.5, 1, 2, 3, 4, 6, 8, 12, 24, 36, 48, 60, 72, 96 hours and blood glucose concentration was measured with ACCU-CHEK Sensor (Roche Diagnostics Corp., USA). Afterwards, the low blood glucose sustaining time (blood glucose level ⁇ 8.35 mmol/l (150 mg/dL)) was additionally measured and shown in Table 4 and FIG. 12 . In the present experiment, exendin-4 was used as the control group
- Example 4 Example 5 (Lys 27 - group Untreated (h) (PEG 5K ) (PEG 20K ) (PEG 20K ) (PEG 23K ) (PEG 50K ) PEG 20K -Ex4) (Ex-4) group 0 23.38 24.28 24.44 24.22 24.56 24.13 22.61 24.23 0.5 7.62 7.96 7.86 7.97 7.63 7.97 6.95 24.21 1 7.36 6.13 6.89 6.99 6.25 6.56 6.41 23.44 2 5.09 5.29 5.04 4.96 5.45 5.24 5.80 24.58 3 4.46 4.18 4.15 4.11 4.64 4.22 5.85 22.96 4 4.93 4.34 4.66 4.54 4.23 4.29 8.02 24.54 6 5.73 4.9 4.67 4.87 4.26 4.85 10.69 23.43 8 9.04 4.57 5.11 4.66 4.69 5.13 16.01 24.94 12
- C40 site specific PEG bound exendin-4 composition according to the present invention can be used beneficially as a diabetes medication by having solved the weakness of quick excretion of medications due to low molecular weight of exendin-4 and consequently sustaining blood glucose level 7-8 times more stable than the Comparative examples.
- C40 site specific PEG bound exendin-4 analogue according to the present invention can be formulated into various forms following purposes.
- the following is an illustration of few formulation methods that include C40 site specific PEG bound exendin-4 analogue according to the present invention as an active ingredient, and the present invention is not limited thereof.
- the ingredients were mixed and stuffed in sealed packages to prepare powders.
- C40 site specific PEG bound exendin-4 analogue 100 mg Corn starch 100 mg Lactose 100 mg Magnesium stearate 2 mg
- the ingredients were mixed and compressed according to general preparation methods for tablets to prepare tablets.
- C40 site specific PEG bound exendin-4 analogue 100 mg Corn starch 100 mg Lactose 100 mg Magnesium stearate 2 mg
- the ingredients were mixed and stuffed in gelatin capsules according to general preparation methods for capsules to prepare capsules.
- the ingredients were included with the given quantity according to general preparation methods for injections to prepare injections.
- the yield of an exendin-4 analogue in which a cysteine (Cys) is introduced into #40 site of the C-terminal and is PEGylated with polyethylene glycol (PEG) or a derivative thereof can be increased and the treatment effect of medications can be increased, and thus the exendin-4 analogue can be beneficially used as a composition for prevention or treatment of diseases caused by insulin hypersecretion.
- Cys cysteine
- PEG polyethylene glycol
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Epidemiology (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Molecular Biology (AREA)
- Endocrinology (AREA)
- Organic Chemistry (AREA)
- Zoology (AREA)
- Gastroenterology & Hepatology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Vascular Medicine (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Immunology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Inorganic Chemistry (AREA)
- General Chemical & Material Sciences (AREA)
- Diabetes (AREA)
- Genetics & Genomics (AREA)
- Toxicology (AREA)
- Dermatology (AREA)
- Oil, Petroleum & Natural Gas (AREA)
- Obesity (AREA)
- Hematology (AREA)
- Emergency Medicine (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Medicinal Preparation (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
Applications Claiming Priority (3)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| KR10-2011-0062858 | 2011-06-28 | ||
| KR1020110062858A KR101357117B1 (ko) | 2011-06-28 | 2011-06-28 | 폴리에틸렌글라이콜 또는 이의 유도체로 페길화된 엑센딘-4 유사체, 이의 제조방법 및 이를 유효성분으로 함유하는 당뇨병 예방 또는 치료용 약학적 조성물 |
| PCT/KR2012/005137 WO2013002580A2 (ko) | 2011-06-28 | 2012-06-28 | 폴리에틸렌글라이콜 또는 이의 유도체로 페길화된 엑센딘-4 유사체, 이의 제조방법 및 이를 유효성분으로 함유하는 당뇨병 예방 또는 치료용 약학적 조성물 |
Related Parent Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/KR2012/005137 A-371-Of-International WO2013002580A2 (ko) | 2011-06-28 | 2012-06-28 | 폴리에틸렌글라이콜 또는 이의 유도체로 페길화된 엑센딘-4 유사체, 이의 제조방법 및 이를 유효성분으로 함유하는 당뇨병 예방 또는 치료용 약학적 조성물 |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US15/413,029 Continuation US10406230B2 (en) | 2011-06-28 | 2017-01-23 | Exendin-4 analogue pegylated with polyethylene glycol or derivative thereof, preparation method thereof, and pharmaceutical composition for preventing or treating diabetes, containing same as active ingredient |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| US20130217622A1 true US20130217622A1 (en) | 2013-08-22 |
Family
ID=47424684
Family Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US13/882,361 Abandoned US20130217622A1 (en) | 2011-06-28 | 2012-06-28 | Exendin-4 analogue pegylated with polyethylene glycol or derivative thereof, preparation method thereof, and pharmaceutical compostion for preventing or treating diabetes, containing same as active ingredient |
| US15/413,029 Active 2032-12-06 US10406230B2 (en) | 2011-06-28 | 2017-01-23 | Exendin-4 analogue pegylated with polyethylene glycol or derivative thereof, preparation method thereof, and pharmaceutical composition for preventing or treating diabetes, containing same as active ingredient |
Family Applications After (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US15/413,029 Active 2032-12-06 US10406230B2 (en) | 2011-06-28 | 2017-01-23 | Exendin-4 analogue pegylated with polyethylene glycol or derivative thereof, preparation method thereof, and pharmaceutical composition for preventing or treating diabetes, containing same as active ingredient |
Country Status (10)
| Country | Link |
|---|---|
| US (2) | US20130217622A1 (enExample) |
| EP (1) | EP2727605B1 (enExample) |
| JP (1) | JP6084215B2 (enExample) |
| KR (1) | KR101357117B1 (enExample) |
| CN (1) | CN103338790B (enExample) |
| AU (1) | AU2012276478B2 (enExample) |
| CA (1) | CA2839410C (enExample) |
| DK (1) | DK2727605T3 (enExample) |
| ES (1) | ES2674581T3 (enExample) |
| WO (1) | WO2013002580A2 (enExample) |
Cited By (16)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US9670261B2 (en) | 2012-12-21 | 2017-06-06 | Sanofi | Functionalized exendin-4 derivatives |
| WO2017112889A1 (en) | 2015-12-23 | 2017-06-29 | The Johns Hopkins University | Long-acting glp-1r agonist as a therapy of neurological and neurodegenerative conditions |
| US9694053B2 (en) | 2013-12-13 | 2017-07-04 | Sanofi | Dual GLP-1/glucagon receptor agonists |
| US9751926B2 (en) | 2013-12-13 | 2017-09-05 | Sanofi | Dual GLP-1/GIP receptor agonists |
| US9750788B2 (en) | 2013-12-13 | 2017-09-05 | Sanofi | Non-acylated exendin-4 peptide analogues |
| US9758561B2 (en) | 2014-04-07 | 2017-09-12 | Sanofi | Dual GLP-1/glucagon receptor agonists derived from exendin-4 |
| US9771406B2 (en) | 2014-04-07 | 2017-09-26 | Sanofi | Peptidic dual GLP-1/glucagon receptor agonists derived from exendin-4 |
| US9775904B2 (en) | 2014-04-07 | 2017-10-03 | Sanofi | Exendin-4 derivatives as peptidic dual GLP-1/glucagon receptor agonists |
| US9789165B2 (en) | 2013-12-13 | 2017-10-17 | Sanofi | Exendin-4 peptide analogues as dual GLP-1/GIP receptor agonists |
| US9932381B2 (en) | 2014-06-18 | 2018-04-03 | Sanofi | Exendin-4 derivatives as selective glucagon receptor agonists |
| US9982029B2 (en) | 2015-07-10 | 2018-05-29 | Sanofi | Exendin-4 derivatives as selective peptidic dual GLP-1/glucagon receptor agonists |
| US10758592B2 (en) | 2012-10-09 | 2020-09-01 | Sanofi | Exendin-4 derivatives as dual GLP1/glucagon agonists |
| US10806797B2 (en) | 2015-06-05 | 2020-10-20 | Sanofi | Prodrugs comprising an GLP-1/glucagon dual agonist linker hyaluronic acid conjugate |
| US10894076B2 (en) | 2015-12-29 | 2021-01-19 | Pegbio Co., Ltd. | Composition comprising GLP-1 receptor agonist and glucagon receptor agonist and application thereof |
| WO2023028554A1 (en) | 2021-08-25 | 2023-03-02 | Neuraly, Inc. | Glp-1r agonists for use in a treatment of neurological impairment associated with viral infection |
| WO2024229006A1 (en) * | 2023-05-01 | 2024-11-07 | Neuraly, Inc. | Glucagon-like peptide-1 receptor agonist variants and methods thereof |
Families Citing this family (17)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP2851429B1 (en) | 2012-05-18 | 2019-07-24 | Adda Biotech Inc. | Protein and protein conjugate for diabetes treatment, and applications thereof |
| CN105934257B (zh) | 2013-12-06 | 2020-10-09 | 韩捷 | 用于含氮和羟基的药物的生物可逆引入基团 |
| CN105985425B (zh) * | 2014-12-11 | 2019-12-17 | 浙江海昶生物医药技术有限公司 | 一种聚乙二醇修饰的exendin类似物及其制备方法和应用 |
| WO2017024182A1 (en) | 2015-08-04 | 2017-02-09 | Duke University | Genetically encoded intrinsically disordered stealth polymers for delivery and methods of using same |
| US11752213B2 (en) | 2015-12-21 | 2023-09-12 | Duke University | Surfaces having reduced non-specific binding and antigenicity |
| US11467156B2 (en) | 2016-06-01 | 2022-10-11 | Duke University | Nonfouling biosensors |
| WO2018057847A1 (en) | 2016-09-23 | 2018-03-29 | Duke University | Unstructured non-repetitive polypeptides having lcst behavior |
| US11648200B2 (en) | 2017-01-12 | 2023-05-16 | Duke University | Genetically encoded lipid-polypeptide hybrid biomaterials that exhibit temperature triggered hierarchical self-assembly |
| WO2018213320A1 (en) | 2017-05-15 | 2018-11-22 | Duke University | Recombinant production of hybrid lipid-biopolymer materials that self-assemble and encapsulate agents |
| WO2019147954A1 (en) | 2018-01-26 | 2019-08-01 | Duke University | Albumin binding peptide-drug (aibiped) conjugates and methods of making and using same |
| WO2019213150A1 (en) | 2018-04-30 | 2019-11-07 | Duke University | Stimuli-responsive peg-like polymer-based drug delivery platform |
| KR20200135618A (ko) * | 2019-05-23 | 2020-12-03 | ㈜ 디앤디파마텍 | 폴리펩티드를 포함하는 비알코올성 지방간 질환의 예방 또는 치료용 약학 조성물 |
| US11649275B2 (en) | 2018-08-02 | 2023-05-16 | Duke University | Dual agonist fusion proteins |
| US11512314B2 (en) | 2019-07-12 | 2022-11-29 | Duke University | Amphiphilic polynucleotides |
| KR102193211B1 (ko) * | 2019-11-27 | 2020-12-18 | (주)디앤디파마텍 | 비오틴 모이어티가 결합된 폴리펩티드 및 이를 포함하는 경구 투여용 약학적 조성물 |
| US20240181013A1 (en) * | 2021-04-01 | 2024-06-06 | Duke University | Poegma copolymer conjugates and methods of treating diseases |
| KR20240155737A (ko) | 2023-04-20 | 2024-10-29 | 전북대학교산학협력단 | 폴리에틸렌글리콜을 이용한 분자 전달 방법 |
Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2000069911A1 (en) * | 1999-05-17 | 2000-11-23 | Conjuchem, Inc. | Long lasting insulinotropic peptides |
| US20060286066A1 (en) * | 2003-06-30 | 2006-12-21 | Domantis Limited | Pegylated immunoglobulin variable region polypeptides |
| WO2007075534A2 (en) * | 2005-12-16 | 2007-07-05 | Nektar Therapeutics Al, Corporation | Polymer conjugates of glp-1 |
| WO2008130066A1 (en) * | 2007-04-20 | 2008-10-30 | Kang Choon Lee | Mono modified exendin with polyethylene glycol or its derivatives and uses thereof |
| WO2010121559A1 (zh) * | 2009-04-23 | 2010-10-28 | 派格生物医药(苏州)有限公司 | 新型exendin变体及其缀合物 |
Family Cites Families (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| ES2343072T3 (es) * | 1999-01-14 | 2010-07-22 | Amylin Pharmaceuticals, Inc. | Exendina para la supresion del glucagon. |
| EP1539210A4 (en) * | 2002-09-06 | 2006-06-07 | Bayer Pharmaceuticals Corp | GLP-1 RECEPTOR MODIFIED AGONISTS AND THEIR PHARMACOLOGICAL METHODS OF USE |
| JP2008516621A (ja) * | 2004-10-18 | 2008-05-22 | ノボ ノルディスク アクティーゼルスカブ | 成長ホルモン結合体 |
| KR100890989B1 (ko) * | 2006-06-01 | 2009-03-31 | 이강춘 | 폴리에틸렌글리콜 또는 이의 유도체로 단일 수식된 엑센딘,이의 제조방법 및 이의 용도 |
| KR101112578B1 (ko) * | 2009-07-16 | 2012-02-16 | 성균관대학교산학협력단 | 엑센딘의 비강투여용 약제학적 조성물 및 이의 제조방법 |
-
2011
- 2011-06-28 KR KR1020110062858A patent/KR101357117B1/ko active Active
-
2012
- 2012-06-28 WO PCT/KR2012/005137 patent/WO2013002580A2/ko not_active Ceased
- 2012-06-28 DK DK12804683.6T patent/DK2727605T3/en active
- 2012-06-28 EP EP12804683.6A patent/EP2727605B1/en active Active
- 2012-06-28 AU AU2012276478A patent/AU2012276478B2/en active Active
- 2012-06-28 CN CN201280003243.XA patent/CN103338790B/zh active Active
- 2012-06-28 US US13/882,361 patent/US20130217622A1/en not_active Abandoned
- 2012-06-28 ES ES12804683.6T patent/ES2674581T3/es active Active
- 2012-06-28 CA CA2839410A patent/CA2839410C/en active Active
- 2012-06-28 JP JP2014518803A patent/JP6084215B2/ja active Active
-
2017
- 2017-01-23 US US15/413,029 patent/US10406230B2/en active Active
Patent Citations (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2000069911A1 (en) * | 1999-05-17 | 2000-11-23 | Conjuchem, Inc. | Long lasting insulinotropic peptides |
| US20060286066A1 (en) * | 2003-06-30 | 2006-12-21 | Domantis Limited | Pegylated immunoglobulin variable region polypeptides |
| WO2007075534A2 (en) * | 2005-12-16 | 2007-07-05 | Nektar Therapeutics Al, Corporation | Polymer conjugates of glp-1 |
| WO2008130066A1 (en) * | 2007-04-20 | 2008-10-30 | Kang Choon Lee | Mono modified exendin with polyethylene glycol or its derivatives and uses thereof |
| WO2010121559A1 (zh) * | 2009-04-23 | 2010-10-28 | 派格生物医药(苏州)有限公司 | 新型exendin变体及其缀合物 |
| US20120196795A1 (en) * | 2009-04-23 | 2012-08-02 | Pegbio Co., Ltd. | Novel exendin variant and conjugate thereof |
Non-Patent Citations (12)
| Title |
|---|
| Berendsen, A Glimpae of the Holy Grail?, Science, 1998, 282, pages 642-643. * |
| Bradley et al., Limits of Cooperativity in a Structurally Modular Protein: Response of the Notch Ankyrin Domain to Analogous Alanine Substitutions in Each Repeat, J. Mol. BIoL (2002) 324, 373-386. * |
| Definition of Analogue and Derivative, On-line Medical Dictionary, accessed March 5, 2000. * |
| Jaime Davidson, Advances in therapy for type 2 diabetes: GLP-1 receptor agonists and DPP-4 inhibitors, CLEVELAND CLINIC JOURNAL OF MEDICINE VOLUME 76 , SUPPLEMENT 5 DECEMBER 2009. * |
| Ngo et al, Computational Complexity, Protein Structure Protection, and the Levinthal Paradox, 1994, pages 491-494. * |
| Rudinger, Peptide Hormones, JA Parsons, Ed., 1976, pages 1-7. * |
| SIGMA, 2004, pages 1-2. * |
| Song Xue, Exendin-4 treatment of nonobese diabetic mice increases beta-cell proliferation and fractional insulin reactive area, Journal of Diabetes and Its Complications 24 (2010) 163-167. * |
| The definition of dimer, thefreedictionary.com, accessed on 12/8/2014. * |
| The definition of trimer, thefreedictionary.com, accessed on 12/8/2014. * |
| The Mayo Clinic, Diabetes, Diabetes Symptoms, www.mayoclinic.org/diseases-conditions/diabetes/in-depth/diabetes-symptoms/art, accessed on 12/9/2014. * |
| Voet et al, Biochemistry, John Wiley & Sons Inc., 1995, pages 235-241. * |
Cited By (21)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10758592B2 (en) | 2012-10-09 | 2020-09-01 | Sanofi | Exendin-4 derivatives as dual GLP1/glucagon agonists |
| US10253079B2 (en) | 2012-12-21 | 2019-04-09 | Sanofi | Functionalized Exendin-4 derivatives |
| US9745360B2 (en) | 2012-12-21 | 2017-08-29 | Sanofi | Dual GLP1/GIP or trigonal GLP1/GIP/glucagon agonists |
| US9670261B2 (en) | 2012-12-21 | 2017-06-06 | Sanofi | Functionalized exendin-4 derivatives |
| US9694053B2 (en) | 2013-12-13 | 2017-07-04 | Sanofi | Dual GLP-1/glucagon receptor agonists |
| US9751926B2 (en) | 2013-12-13 | 2017-09-05 | Sanofi | Dual GLP-1/GIP receptor agonists |
| US9750788B2 (en) | 2013-12-13 | 2017-09-05 | Sanofi | Non-acylated exendin-4 peptide analogues |
| US9789165B2 (en) | 2013-12-13 | 2017-10-17 | Sanofi | Exendin-4 peptide analogues as dual GLP-1/GIP receptor agonists |
| US9758561B2 (en) | 2014-04-07 | 2017-09-12 | Sanofi | Dual GLP-1/glucagon receptor agonists derived from exendin-4 |
| US9771406B2 (en) | 2014-04-07 | 2017-09-26 | Sanofi | Peptidic dual GLP-1/glucagon receptor agonists derived from exendin-4 |
| US9775904B2 (en) | 2014-04-07 | 2017-10-03 | Sanofi | Exendin-4 derivatives as peptidic dual GLP-1/glucagon receptor agonists |
| US9932381B2 (en) | 2014-06-18 | 2018-04-03 | Sanofi | Exendin-4 derivatives as selective glucagon receptor agonists |
| US10806797B2 (en) | 2015-06-05 | 2020-10-20 | Sanofi | Prodrugs comprising an GLP-1/glucagon dual agonist linker hyaluronic acid conjugate |
| US9982029B2 (en) | 2015-07-10 | 2018-05-29 | Sanofi | Exendin-4 derivatives as selective peptidic dual GLP-1/glucagon receptor agonists |
| WO2017112889A1 (en) | 2015-12-23 | 2017-06-29 | The Johns Hopkins University | Long-acting glp-1r agonist as a therapy of neurological and neurodegenerative conditions |
| US11123405B2 (en) | 2015-12-23 | 2021-09-21 | The Johns Hopkins University | Long-acting GLP-1R agonist as a therapy of neurological and neurodegenerative conditions |
| EP3393496B1 (en) * | 2015-12-23 | 2023-10-11 | The Johns Hopkins University | Long-acting glp-1r agonist as a therapy of neurological and neurodegenerative conditions |
| US12233109B2 (en) | 2015-12-23 | 2025-02-25 | The Johns Hopkins University | Long-acting GLP-1r agonist as a therapy of neurological and neurodegenerative conditions |
| US10894076B2 (en) | 2015-12-29 | 2021-01-19 | Pegbio Co., Ltd. | Composition comprising GLP-1 receptor agonist and glucagon receptor agonist and application thereof |
| WO2023028554A1 (en) | 2021-08-25 | 2023-03-02 | Neuraly, Inc. | Glp-1r agonists for use in a treatment of neurological impairment associated with viral infection |
| WO2024229006A1 (en) * | 2023-05-01 | 2024-11-07 | Neuraly, Inc. | Glucagon-like peptide-1 receptor agonist variants and methods thereof |
Also Published As
| Publication number | Publication date |
|---|---|
| WO2013002580A2 (ko) | 2013-01-03 |
| KR101357117B1 (ko) | 2014-02-06 |
| JP2014520798A (ja) | 2014-08-25 |
| CN103338790B (zh) | 2018-01-23 |
| EP2727605B1 (en) | 2018-04-04 |
| ES2674581T3 (es) | 2018-07-02 |
| WO2013002580A3 (ko) | 2013-04-11 |
| CN103338790A (zh) | 2013-10-02 |
| EP2727605A4 (en) | 2014-12-24 |
| CA2839410C (en) | 2019-05-14 |
| CA2839410A1 (en) | 2013-01-03 |
| DK2727605T3 (en) | 2018-06-25 |
| AU2012276478A1 (en) | 2014-01-23 |
| US10406230B2 (en) | 2019-09-10 |
| JP6084215B2 (ja) | 2017-02-22 |
| KR20130008665A (ko) | 2013-01-23 |
| EP2727605A2 (en) | 2014-05-07 |
| US20170189545A1 (en) | 2017-07-06 |
| AU2012276478B2 (en) | 2016-02-25 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US10406230B2 (en) | Exendin-4 analogue pegylated with polyethylene glycol or derivative thereof, preparation method thereof, and pharmaceutical composition for preventing or treating diabetes, containing same as active ingredient | |
| KR102449145B1 (ko) | 지속형 인슐린 아날로그 결합체 및 지속형 인슐린 분비 펩타이드 결합체를 포함하는 당뇨병 치료용 조성물 | |
| AU739263B2 (en) | Antagonists of intestinotrophic GLP-2 peptides | |
| US20110020345A1 (en) | Drug fusions and conjugates | |
| WO2021022149A1 (en) | Insulin analogs and methods of using the same | |
| KR100890989B1 (ko) | 폴리에틸렌글리콜 또는 이의 유도체로 단일 수식된 엑센딘,이의 제조방법 및 이의 용도 | |
| CN111194223A (zh) | 与白蛋白具有较佳结合亲和力的药物分子 | |
| US11807672B2 (en) | Conjugates of islet neogenesis peptides and analogs, and methods thereof | |
| CA2950266C (en) | Composition for treating diabetes, comprising long-acting insulin analogue conjugate and long-acting insulinotropic peptide conjugate | |
| KR20120104459A (ko) | 페길화된 엑센딘-4 이량체, 이의 제조방법 및 이를 유효성분으로 함유하는 약학적 조성물 | |
| NZ726959B2 (en) | Composition for treating diabetes comprising long-acting insulin analogue conjugate and long-acting insulinotropic peptide conjugate | |
| HK1230958A1 (en) | Composition for treating diabetes, containing long-acting insulin analog conjugate and long-acting insulin secretion peptide conjugate | |
| HK1230958B (en) | Composition for treating diabetes, containing long-acting insulin analog conjugate and long-acting insulin secretion peptide conjugate |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| AS | Assignment |
Owner name: B&L DELIPHARM, CORP., KOREA, REPUBLIC OF Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:LEE, SUNG KWON;KIM, WON BAE;LEE, SEULKI;AND OTHERS;REEL/FRAME:030308/0450 Effective date: 20130404 |
|
| AS | Assignment |
Owner name: THERALY PHARMACEUTICALS INC., MARYLAND Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:B&L DELIPHARM, CORP.;REEL/FRAME:033521/0483 Effective date: 20140708 |
|
| STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |