US20110020403A1 - immunizing composition - Google Patents

immunizing composition Download PDF

Info

Publication number
US20110020403A1
US20110020403A1 US12/747,843 US74784308A US2011020403A1 US 20110020403 A1 US20110020403 A1 US 20110020403A1 US 74784308 A US74784308 A US 74784308A US 2011020403 A1 US2011020403 A1 US 2011020403A1
Authority
US
United States
Prior art keywords
protein
polypeptide
seq
equi
composition
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Abandoned
Application number
US12/747,843
Other languages
English (en)
Inventor
Bengt Guss
Jan-Ingmar Flock
Lars Frykberg
Margareta Flock
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Intervacc AB
Original Assignee
Intervacc AB
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Intervacc AB filed Critical Intervacc AB
Priority to US12/747,843 priority Critical patent/US20110020403A1/en
Assigned to INTERVACC AB reassignment INTERVACC AB ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: FRYKBERG, LARS, FLOCK, JAN-INGMAR, FLOCK, MARGARETA, GUSS, BENGT
Publication of US20110020403A1 publication Critical patent/US20110020403A1/en
Abandoned legal-status Critical Current

Links

Images

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/02Bacterial antigens
    • A61K39/09Lactobacillales, e.g. aerococcus, enterococcus, lactobacillus, lactococcus, streptococcus
    • A61K39/092Streptococcus
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/04Antibacterial agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/04Immunostimulants
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • C07K14/315Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Streptococcus (G), e.g. Enterococci
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/55Medicinal preparations containing antigens or antibodies characterised by the host/recipient, e.g. newborn with maternal antibodies
    • A61K2039/552Veterinary vaccine

Definitions

  • This invention is generally related to antigenic or immunogenic compositions and use thereof for immunization of non-human mammals, e.g. horses, against Streptococcus equi.
  • Streptococcal infections in horses are mainly caused by the species Streptococcus equi , which is classified as a Lancefield Group C Streptococcus and comprises two subspecies designated equi and zooepidemicus , respectively.
  • Streptococcus equi subsp. equi which is virtually confined to horses, is the causative agent of strangles, a world-wide distributed and highly contagious serious disease of the upper respiratory tract of the Equidae. Strangles is one of the most frequently reported equine diseases world-wide and is characterized by fever, nasal discharge, and abscess formation in the retropharyngeal and mandibular lymph nodes. In some cases the disease shows a metastatic course in the body, so called “bastard strangles”. The disease has a world-wide distribution and causes great economic losses. Moreover, since strangles is a highly contagious disease, not only infected animals but also all other members of e.g. an afflicted stud must be isolated for as long as up to three months.
  • S. equi subsp. zooepidemicus is considered as an opportunistic commensal often occurring in the upper respiratory tract of healthy horses. However, after stress or virus infection, it can cause a secondary infection, which results in strangles-like symptoms. Moreover, subsp. zooepidemicus infects not only horses but also a wide range of other animals, like pigs, dogs, cats, and cows. Even human cases of infection due to subsp. zooepidemicus have been reported. This subspecies has been implicated as the primary pathogen in conditions such as endometritis, cervicitis, abortion, mastitis, pneumonia, abscesses and joint infections.
  • antibiotics such as penicillin, tetracycline or gentamicin
  • an effective prophylactic agent that could prevent outbursts of such infections and obviate or reduce the risk for development of resistant strains associated with antibiotic treatment, would be appreciated.
  • Fn fibronectin
  • Fn ECM component fibronectin
  • binding between Fn-binding bacterial cell-surface proteins and immobilized Fn promotes internalization of streptococci by epithelial cells (Ref. 2, 23, 24).
  • Fibronectin is a dimeric glycoprotein found both in plasma and in a fibrillar form in the extracellular matrix.
  • the main function of Fn is to mediate substrate adhesion of eukaryotic cells, which involves the binding of specific cell-surface receptors to certain domains of the Fn molecule. Furthermore, it also interacts with several other macromolecules, such as DNA, heparin, fibrin, and collagen.
  • Fn-binding proteins from different streptococcal species have been cloned and sequenced previously.
  • S. equi one Fn-binding protein has been cloned and characterized, which is a Fn-binding cell-surface protein of subsp. zooepidemicus , that has been designated FNZ (Lindmark et al., 1996, Ref. 9).
  • Another Fn-binding protein from S. equi subsp. equi has been cloned and characterized by Lindmark and Guss (1999) (Ref. 12). This latter protein that is designated SFS and its potential use as an active component in a vaccine for protection of horses against strangles are disclosed in WO 00/37496.
  • ZAG a protein designated ZAG has been cloned and characterized from S. equi subsp. zooepidemicus that mediates binding to the plasma proteinase inhibitor ⁇ 2 M. It is speculated therein that this protein is similar in function to streptococcal M proteins. This protein, ZAG, is also disclosed in WO 95/07296, where its ⁇ 2 M-binding properties are indicated. However, immunogenic properties or potential use thereof as an active component in a vaccine for protection of e.g. horses against strangles are not disclosed therein. The gene zag encoding ZAG is also disclosed in these references.
  • a gene that is similar to the aforesaid zag gene from S. equi subsp. zooepidemicus but is present in subsp. equi has been described by Lindmark et al. (1999) (Ref. 11) and Lindmark (1999) (Ref. 13). This gene is hereafter designated eag and encodes a protein designated EAG.
  • antigenic compositions which comprise at least one antigen derived from a protein designated EAG, which protein is present in S. equi , and which composition suitably comprises at least one further antigen selected from a group of proteins which are present in S. equi and are designated FNZ, SFS, SEC and ScIC, respectively.
  • subunit immunogenic or vaccine compositions which comprise at least one polypeptide of S. equi having a specific amino acid sequence as shown in the sequence listing attached to said publication or an analog thereof or a fragment thereof which is a part of said polypeptide and contains at least one epitope.
  • polypeptide of S. equi having a specific amino acid sequence as shown in the sequence listing attached to said publication or an analog thereof or a fragment thereof which is a part of said polypeptide and contains at least one epitope.
  • the present invention is based on an antigenic, suitably an immunogenic, composition
  • at least one antigen suitably an immunogen, that comprises at least one antigenic epitope or antigenic determinant derived from a protein present in one or both of S. equi subsp. equi and subsp. zooepidemicus and use thereof for immunization of non-human mammals against S. equi subsp. equi and/or subsp. zooepidemicus.
  • the present invention is also directed to a vaccine composition
  • a vaccine composition comprising the afore-said antigenic composition as immunizing component; to methods to prepare said antigenic, suitably immunogenic, composition or vaccine composition; to methods to induce an immune response against S. equi in non-human mammals; and to methods for prophylactic or therapeutic treatment of S. equi infection in non-human mammals.
  • S. equi refers to one or both of subsp. equi and subsp. zooepidemicus.
  • the present invention is directed to a vaccine that protects equines, such as horses, against strangles.
  • non-human mammals primarily refers to animals belonging to the family Equidae that consists of horses, donkeys and zebras and to hybrids thereof, such as mules and hinnies. Camels and dromedaries are also encompassed therein.
  • non-human mammals in addition refers also to other mammals such as cows, pigs, dogs and cats.
  • FIG. 1 shows weight loss of mice given experimental infection with S. equi subsp. equi strain 1866 after vaccination with the polypeptides Eq5 and Eq8 (open symbols) or non-vaccinated (filled symbols);
  • FIG. 2 shows nasal growth in mice given experimental infection with S. equi subsp. equi strain 1866 after vaccination with the polypeptides Eq5 and Eq8 (open symbols) or non-vaccinated (filled symbols);
  • FIG. 3 shows weight loss of mice given experimental infection with S. equi subsp. equi strain 1866 after vaccination with the polypeptide EAG (filled squares), the polypeptides EAG+IdeE+IdeE2 (open circles) or non-vaccinated controls (filled circles);
  • FIG. 4 shows nasal growth in mice given experimental infection with S. equi subsp. equi strain 1866 after vaccination with the polypeptide EAG (filled squares), the polypeptides EAG+IdeE+IdeE2 (open circles) or non-vaccinated controls (filled circles).
  • FIGS. 5 a and 5 b show weight loss and nasal growth in mice immunized with EAG+CNE+ScIC i.n. (filled squares), Eq5+Eq8 i.n. (filled circles) and the control (open circles).
  • FIG. 6 shows growth of challenge inoculum ( S. equi subsp. equi strain 4047);
  • FIG. 7 shows mean pony temperatures during the vaccination phase
  • FIG. 8 shows mean nasal score during the vaccination phase
  • FIG. 9 shows mean lymph node score during the vaccination phase
  • FIG. 10 shows mean counts of S. zooepidemicus in nasal washes during the vaccination phase
  • FIG. 11 shows mean pony temperatures after challenge
  • FIG. 12 shows mean fibrinogen levels during the challenge phase
  • FIG. 13 shows mean neutrophil levels during the challenge phase
  • FIG. 14 shows mean lymph node score during the challenge phase
  • FIG. 15 shows mean nasal score during the challenge phase
  • FIG. 16 shows mean S. zooepidemicus counts during challenge phase
  • FIG. 17 shows mean pathology score on post mortem examination
  • FIG. 18 shows mean histopathology scores.
  • SEQ ID NO 1 shows the amino acid sequence of the protein IdeE2.
  • SEQ ID NO 2 shows the amino acid sequence of the recombinant protein IdeE2.
  • SEQ ID NO 3 shows the amino acid sequence of the protein Eq5.
  • SEQ ID NO 4 shows the amino acid sequence of the recombinant protein Eq5.
  • SEQ ID NO 5 shows the amino acid sequence of the protein Eq8.
  • SEQ ID NO 6 shows the amino acid sequence of the recombinant protein Eq8.
  • SEQ ID NO 7 shows the amino acid sequence of the protein IdeZ2 from subsp. zooepidemicus.
  • SEQ ID NO 8 shows the amino acid sequence of the protein Eqz5 from subsp. zooepidemicus.
  • SEQ ID NO 9 shows the amino acid sequence of the protein Eqz8 from subsp. zooepidemicus.
  • SEQ ID NO 10 shows the amino acid sequence of the protein IdeE.
  • SEQ ID NO 11 shows the amino acid sequence of the protein IdeZ from subsp. zooepidemicus.
  • SEQ ID NOS 12 and 13 shows, respectively, the nucleotide sequence of the gene eag and the amino acid sequence of the protein EAG4B, which protein is usually designated EAG in connection with the present invention.
  • SEQ ID NO 14 shows the nucleotide sequence of the gene ideE2.
  • SEQ ID NO 15 shows the nucleotide sequence of the gene eq5.
  • SEQ ID NO 16 shows the nucleotide sequence of the gene eq8.
  • SEQ ID NO 17 shows the nucleotide sequence of the gene IdeZ2 from subsp. zooepidemicus.
  • SEQ ID NO 18 shows the nucleotide sequence of the gene eqz5 from subsp. zooepidemicus.
  • SEQ ID NO 19 shows the nucleotide sequence of the gene eqz8 from subsp. zooepidemicus.
  • SEQ ID NO 20 shows the nucleotide sequence of the gene ideE.
  • SEQ ID NO 21 shows the nucleotide sequence of the gene ideZ from subsp. zooepidemicus.
  • SEQ ID NOS 22-27 show nucleotide sequences of oligonucleotide primers.
  • SEQ ID NO 28 shows the amino acid sequence of the protein CNE (or SEC 2.16).
  • SEQ ID NO 29 shows the amino acid sequence of the protein ScIC.
  • SEQ ID NO 30 shows the amino acid sequence of the recombinant IdeE used for immunization.
  • SEQ ID NO 31-32 shows the nucleotide sequence of primers.
  • the present invention is concerned with identification of polypeptides or proteins of S. equi that are able to elicit an antigenic, suitably an immunogenic, response, when administered to a non-human mammal; and to the identification of polynucleotides or genes encoding these polypeptides or proteins.
  • the present invention is also concerned with fragments or analogs of said polypeptides or proteins or of said polynucleotides or genes.
  • genes of S. equi encoding extracellular proteins were identified and, subsequently, the corresponding products were expressed and evaluated in vaccine studies.
  • the present invention is at least partly based on such studies.
  • the present invention relates to an antigenic composition
  • an antigenic composition comprising at least one antigen, wherein said at least one antigen comprises at least part of a protein of Streptococcus equi subsp. equi or subsp. zooepidemicus , and said at least part of said protein comprises at least one antigenic epitope or antigenic determinant of Streptococcus equi.
  • the present invention is directed to an antigenic composition
  • an antigenic composition comprising at least one antigen, wherein said at least one antigen comprises at least part of a protein or polypeptide of Streptococcus equi subsp. equi or subsp. zooepidemicus and said at least part of said protein or polypeptide comprises at least one antigenic epitope or antigenic determinant of Streptococcus equi , and wherein said protein or polypeptide is selected from the group comprising:
  • EAG a protein or polypeptide which is designated EAG and has an amino acid sequence as shown in SEQ ID NO: 13;
  • IdeE a protein or polypeptide which is designated IdeE and has an amino acid sequence as shown in SEQ ID NO: 10;
  • IdeE2 a protein or polypeptide which is designated IdeE2 and has an amino acid sequence as shown in SEQ ID NO: 1;
  • Eq5 a protein or polypeptide which is designated Eq5 and has an amino acid sequence as shown in SEQ ID NO: 3;
  • Eq8 a protein or polypeptide which is designated Eq8 and has an amino acid sequence as shown in SEQ ID NO: 5;
  • IdeZ2 a protein or polypeptide which is designated IdeZ2 and has an amino acid sequence as shown in SEQ ID NO: 7;
  • Eqz5 a protein or polypeptide which is designated Eqz5 and has an amino acid sequence as shown in SEQ ID NO: 8;
  • Eqz8 a protein or polypeptide which is designated Eqz8 and has an amino acid sequence as shown in SEQ ID NO: 9;
  • composition which comprises EAG comprises at least one further antigen, which is a protein or polypeptide, which is selected from the group comprising IdeE, IdeE2, Eq5, Eq8, IdeZ2, Eqz5, and Eqz8.
  • EAG, IdeE, IdeE2, Eq5, and Eq8 designate proteins that can be found in S. equi subsp. equi and IdeZ, IdeZ2, Eqz5, and Eqz8 designate proteins that can be found in S. equi subsp. zooepidemicus.
  • the antigens or immunogens of the present antigenic or immunogenic compositions may comprise the entire amino acid sequence of said protein or polypeptide or may comprise a fragment, e.g. a C-terminal or N-terminal fragment thereof, or an analog thereof.
  • a fragment e.g. a C-terminal or N-terminal fragment thereof, or an analog thereof.
  • an N-terminal fragment of EAG is used according to various embodiments of the present invention.
  • the present invention is related to an antigenic or immunogenic composition which contains at least 2 or 3 antigens or immunogens selected from the group consisting of EAG, IdeE, IdeE2, Eq5, Eq8, IdeZ, IdeZ2, Eqz5, and Eqz8.
  • the present invention is related to an antigenic or immunogenic composition which contains at least 2 or 3 antigens or immunogens selected from the group consisting of EAG, IdeE, IdeE2, Eq5, and Eq8.
  • this composition also comprises one or both of the previously described antigens ScIC (SEQ ID NO: 29) and CNE (SEQ ID NO: 28) (also designated SEC e.g. SEC 2.16).
  • SEQ ID NO: 29 SEQ ID NO: 29
  • CNE SEQ ID NO: 28
  • a further embodiment is related to an antigenic composition comprising EAG, ScIC, CNE, Eq5, and Eq8.
  • a suitable composition contains 2 antigens or immunogens which are comprised of Eq5 and Eq8, respectively.
  • the present invention is directed to a composition that contains 3 antigens or immunogens, which suitably are comprised of EAG, IdeE, and IdeE2.
  • the present invention is also related to compositions that comprise one or both of IdeE and IdeE2.
  • the present invention is also related to an antigenic composition, wherein said at least one protein or polypeptide is selected from the group consisting of EAG, Eq5 and Eq8 and which composition further comprises at least one antigen, which is selected from the group comprising a protein or a polypeptide designated CNE (or SEC), which has an amino acid sequence as shown in SEQ ID NO: 28, and a protein or a polypeptide designated ScIC, which has an amino acid sequence as shown in SEQ ID NO: 29.
  • said at least one protein or polypeptide is selected from the group comprising IdeE and IdeE2.
  • Antigenic compositions of the present invention comprise according to one embodiment, the antigens EAG, ScIC, CNE (or SEC), Eq5, Eq8, IdeE and IdeE2, and according to another embodiment, the antigens EAG, ScIC, CNE (or SEC), Eq5, and Eq8.
  • the present invention is also related to an antigenic composition, wherein said at least one protein or polypeptide is selected from the group consisting of EAG, Eq8, and IdeE2 and which composition comprises at least one further antigen which is selected from the group comprising IdeE, Eq5, IdeZ2, Eqz5 and Eqz8 and/or ScIC and CNE (or SEC).
  • the antigenic composition suitably comprises at least one antigen which is recombinantly produced and/or at least one antigen which is an isolated or purified antigen.
  • the present antigens or immunogens that are derived from proteins of Streptococcus equi may comprise the entire protein, a fragment of said protein or an analog of said protein which is antigenic or immunogenic.
  • the present invention is not limited to the fragments of proteins that are specifically disclosed herein.
  • the antigenic composition of the present invention may comprise at least one recombinant vector and at least one polynucleotide inserted therein that encodes said at least one protein or polypeptide, and which vector is able to express said polypeptide in vivo in a non-human mammal susceptible to infection with S. equi.
  • the vector is an expression vector which is a plasmid or a viral vector and wherein said polynucleotide has a nucleotide sequence that encodes an antigen of the present invention.
  • a further embodiment of the present invention is concerned with a vaccine composition for protecting non-human mammals against infection of Streptococcus equi , which comprises an antigenic composition as disclosed above as immunizing component, and a pharmaceutically acceptable carrier.
  • the present vaccine composition comprises an antigenic or immunogenic composition that contains 2, 3 or more of the present antigens or immunogens as immunizing components.
  • these antigens or immunogens are comprised of analogs of said proteins or fragments thereof, e.g. N-terminal or C-terminal fragments.
  • the vaccine composition may comprise further components, such as an adjuvant.
  • an adjuvant such as an adjuvant.
  • said adjuvant stimulates systemic or mucosal immunity.
  • Such adjuvants are well known in the art.
  • Suitable adjuvants for use according to the present invention comprise (1) polymers of acrylic or methacrylic acid, maleic anhydride and alkenyl derivative polymers, (2) immunostimulating sequences (ISS), (3) an oil in water emulsion, (4) cation lipids containing a quaternary ammonium salt, (5) cytokines, (6) aluminum hydroxide or aluminum phosphate, (7) saponin or (8) nanoparticles.
  • a suitable adjuvant for use according to the present invention is the adjuvant Abisco from Isconova AB, Sweden.
  • the key components of ISCOMS are Quillaia saponins derived from the bark of the chilean soap bark tree Quillaia saporinaria molina. Quillaia saponins are well known for their ability to activate the immune system. Quillaia saponins mixed with cholesterol, and phospholipids under specific stoichiometry form spherical open cage like structures known as ISCOMS.
  • Ginseng is a dry extract prepared from the root of the plant Panax ginseng , C. A. Meyer.
  • Ginseng contains a number of active substances named ginsenosides that are a kind of saponins, chemically tri-terpenoid glycosides of the dammaran series.
  • the ginsenosides have adjuvant properties and one of the most active adjuvant is the fraction named Rb1. It has been proved that the fraction Rb1 elicits a balanced Th1 and Th2 immune response as determined by measuring the levels of the cytokines IFN- ⁇ , IL-2, IL-4, IL-10 secreted post vaccination with a Rb1 adjuvanted vaccine. In addition ginseng and the fraction Rb1 stimulates a strong antigen specific antibody response.
  • the vaccine composition is a vaccine that protects susceptible mammals, suitably horses, against strangles caused by Streptococcus equi subsp. equi.
  • the vaccine composition of the present invention is provided in a physiologically administrable form. Suitably, it is administrable by subcutaneous, intramuscular or intranasal inoculation.
  • the vaccine composition of the present invention stimulates serum, mucosal and/or bronchial lavage antibody responses directed to Streptococcus equi antigens in mammals susceptible to Streptococcus equi , suitably horses.
  • the present invention is also related to a method for producing an antigen or immunogen to be used in an antigenic or immunogenic composition of the present invention, which method comprises
  • step (c) culturing said host cell provided in step (b) under conditions required for expression of the product encoded by said DNA fragment;
  • said method further comprises a step (e) wherein the isolated product from step (d) is purified, e.g. by affinity chromatography or other chromatographic methods known in the art.
  • the antigens of the present invention are usually produced according to recombinant technique.
  • a further embodiment of the present invention is concerned with a method for preparation of a vaccine of the present invention, which vaccine contains as immunizing component an antigenic or immunogenic composition as disclosed above, said method comprising mixing said antigenic composition and a pharmaceutically acceptable carrier.
  • the present invention is also related to a method for the production of an antiserum, said method comprising administering an antigenic preparation of the present invention to an animal host to produce antibodies in said animal host and recovering antiserum containing said antibodies produced in said animal host.
  • the present invention is concerned with a method of prophylactic or therapeutic treatment of S. equi infection in non-human mammals, suitably horses, comprising administering to said mammal an immunologically effective amount of a vaccine or an antiserum of the present invention.
  • the present invention is related to a method for protecting horses against Streptococcus equi infection, which method comprises inoculating a horse intramuscular, subcutaneously or intranasally, or a combination of e.g. both subcutaneously and intranasally, with a vaccine composition of the present invention to induce an immune response against Streptococcus equi in said horse.
  • an immune response in the form of IgG and/or IgA and/or IgM antibodies in the nasopharyngeal mucus, is induced in said horse.
  • the present invention also relates to an antibody preparation comprising at least one, and suitably at least two, antibodies specific for a protein or a polypeptide of the present antigenic composition, which antibody/antibodies is/are polyclonal or monoclonal; or which preparation comprises a fragment of said antibodies.
  • the antibody preparation of the present invention could be used prophylactically or therapeutically against strangles and provides passive immunization when administered to a non-human mammal susceptible to infection by Streptococcus equi or infected by Streptococcus equi.
  • the present invention describes a vaccine composition comprising one or several antigen components which have been prepared according to the present method using E. coli as host cells.
  • the source of these antigens might also be the native bacteria, if methods are developed for expression and purification thereof.
  • the antigens of the present invention can also be produced according to methods that are based on fusion strategies where various parts of the respective antigen are recombined resulting in a fusion can in protein consisting of parts from different antigens.
  • This fusion strategy could also be suitable for introducing immune reactive part(s), e.g. T-cell epitopes or attenuated toxins (or parts thereof), thereby introducing other features suitable for optimizing the antigen presentation or localization.
  • other hosts for expressing the recombinant antigens addition to E. coli also be other suitable species of bacteria and viruses. Today many different systems for expression of heterologus expression are well known in the field of molecular biology.
  • Yet another implication of this invention is that it can be used to design specific attenuated mutants of S. equi that lack or have inactivated genes important for survival (i.e. mutations causing deficiency in metabolic pathways) in the host but retain or overproduce the antigens of the present invention.
  • Cleavage sites for the restriction enzymes NcoI and XhoI were included in the primer sequences to match the cloning sites in the plasmid vector pTYB4 (New England Biolabs).
  • the PCR amplifications were performed using the primers (20 pmol/ ⁇ l) and the ReadyToGoTM PCR beads (GE Healthcare) using the following programme: Step 1, pre-heat 1 minute at 95° C., DNA strand separation; Step 2, 30 seconds at 95° C.; Step 3, annealing 15 seconds at 46° C.; and Step 4, elongation for 2 minutes at 72° C., Steps 2-4 were run for 26 cycles.
  • PCR products were analysed on a 1 agarose gel, and thereafter purified using the QIAquick PCR Purification KitTM (Qiagen). Cleavage with the restriction enzymes was performed over night whereupon the fragments were purified one additional time using the same kit.
  • Primer Table The primer sequences used to PCR amplify the genes ideE, ideE2, eq5 and eq8.
  • the nucleotides underlined correspond to the introduced restriction cleavage sites NcoI and XhoI.
  • E. coli strain ER2566 containing the pTYB4 vector (New England Biolabs) was grown according to the manufacturer's instructions, and the vector was purified using the QIAprep Spin Miniprep (Qiagen). Purified vector was digested using restriction endonucleases NcoI and XhoI. After digestion, the vector was treated with the enzyme alkaline phosphatase to reduce the background of re-ligated vector in the later ligation step. For the ligation of the vector and the respective PCR product, the ReadyToGo T4DNA Ligase (GE Healthcare) was used. After ligation, the respective sample were transformed into competent cells of E.
  • coli strain ER2566 using electroporation, and spread on LA-Amp plates (Luria-Bertani broth agar plates supplemented with ampicillin, final conc. 50 ⁇ g/ml) and incubated over night at 37° C. Next day colonies were counted and four colonies per construct were cultivated and used for further experiments. To verify the presence of an insert in the respective constructs, plasmids were purified and additional PCR analyses were performed using the respective primer combination. The sequence of the respective insert was also determined by DNA sequencing using primers that hybridise in the vector (T7 universal forward primer and a reverse primer located in the intein coding region).
  • ideE gene of S. equi subsp. equi strain 1866 has been reported previously by Lannerg ⁇ rd and Guss (2006).
  • GenBank accession number of ideE is DQ508733.
  • the part of the gene used to obtain the recombinant IdeE protein used for immunization was cloned using the primers IdEG1 and IdEG2 listed in the Primer Table. After PCR amplification the DNA fragment was digested with restriction enzymes BamHI and XhoI and ligated into the vector pGEX6-P-1 (GE Healthcare), previously digested with the same enzymes.
  • the vector used is a part of an E. coli expression and purification system called IMPACTTM T7 (NEB Inc.) Briefly, following the manufacturer's instructions the clones expressing recombinant IdeE2, Eq5 and Eq8, respectively were grown at 37° C. in Luria Bertani growth medium supplemented with ampicillin (final conc. 50 ⁇ g/ml). At an optical density (OD 600 ) ⁇ 0.6, the growth medium was supplemented with IPTG (final conc. 0.4 mM) and the growth temperature shifted to 20° C.
  • IMPACTTM T7 NEB Inc.
  • the cells were harvested and resuspended in a buffer [20 mM Tris-HCl (pH 8.0), 500 mM NaCl, 0.1 mM EDTA, and 0.1% Triton X100] and lysed by freezing and thawing. After centrifugation, the supernatant was sterile filtrated and applied onto a chitin column. The columns were extensively washed using the same buffer and subsequently treated with cleavage buffer [20 mM Tris-HCl (pH 8.0), 50 mM NaCl, 0.1 mM EDTA, and 30 mM dithiothreitol (DTT)].
  • a buffer [20 mM Tris-HCl (pH 8.0), 500 mM NaCl, 0.1 mM EDTA, and 0.1% Triton X100] and lysed by freezing and thawing. After centrifugation, the supernatant was sterile filtrated and applied onto a chi
  • the reducing conditions induce an intein-mediated self-cleavage that releases the antigen part from the column while the intein-chitin-binding part is still bound.
  • the eluted samples containing the antigens were dialysed against phosphate-buffered saline [PBS; 137 mM NaCl, 2.7 mM KCl, 10 mM Na 2 HPO 4 , 1.4 mM KH 2 PO 4 (pH 7.4)] and concentrated. The amounts of antigens obtained were determined and the quality was checked using SDS-PAGE.
  • the recombinant IdeE protein was produced and purified using the GST-affinity chromatography system according to the procedure recommended by the manufacturer (GE Healthcare).
  • EAG4B protein is simply called EAG.
  • IdE has previously been shown to be a protease that specifically cleaves IgG from various species (Lanneg ⁇ rd and Guss 2006).
  • IgG from human, horse and mouse were incubated in PBS at 37° C. for one hour.
  • Purified recombinant IdeE was used as a positive control and the negative control was pure IgG. After cleavage, the samples were analysed using 8-25% gradient SDS-PAGE. The result showed that recombinant IdeE2 cleaves cleaves horse IgG much more efficiently than IdeE does.
  • mice weighting approximately 23-25 g were kept in cages of five animals in each.
  • the mice were immunised intranasally with 12 micrograms of each antigen and 10 microgram of Abisco 300 (Isconova AB, Sweden).
  • Fifteen animals were immunised with antigen (Eq5 and Eq8) and 15 were only given Abisco 300 adjuvant to serve as a negative control.
  • the total volume was kept to less than 27 ⁇ l and applied into the nostrils twice with 30 minutes interval of mice anaesthetized with Isoflovet (Abbot Laboratories, England). Immunisations were given on days 0, 13 and 32.
  • EAG, IdeE and IdeE2 were performed essentially as for Eq5 and Eq8. However, animals were divided into three groups, with ten mice in each group. These were given EAG+IdeE+IdeE2 or EAG only and one group with only adjuvans, Abisco 300, as negative control. Immunisations were given on days 0, 21 and 53. Experimental infection was given on day 60.
  • the culture was kept at ⁇ 80° C. in vials and a new vial was used for each experiment.
  • bacteria were grown on BG plates at 37° C. in 5% CO 2 overnight, followed by inoculation into THY and grown without shaking over night.
  • the cultures was then diluted 10 times into THY and 10% horse serum (Sigma) and grown for 4 hours at 37° C. in 5% CO 2 .
  • the culture was centrifuged and resuspended in THB. A dose containing 1 ⁇ 10 6 CFU in 10 ⁇ l was used for all S. equi infections of mice. The animals were followed daily.
  • Bacterial nasal growth was scored on a four-graded scale from 0 to +++ by gently pressing the nose of the animal onto a blood agar plate in a reproducible manner. The nasal sample was then spread out onto the entire surface of the plate. One + means 5-100 colonies; two + means more than 100 and three + means confluent growth. The weight was determined every day and the percentage of weight-loss was calculated.
  • the percentage weight loss over time was determined.
  • FIG. 3 shows that animals vaccinated with EAG+IdeE+IdeE2 lost less weight that control animals. P values were 0.0013, 0.0008 and 0.0009 for days 3, 5 and 6 respectively (Student's t-test). Animals vaccinated with EAG alone also lost weight to a similar magnitude as control animals. Nasal growth of S. equi was also determined daily on a four graded scale.
  • FIG. 4 shows that the animals vaccinated with EAG+IdeE+IdeE2 had much less nasal growth than the control group. Again, vaccination with only EAG showed no protection.
  • SEQ ID NO: 1 and SEQ ID NO: 14 are combined to show the amino acid sequence of the IdeE2 protein (SEQ ID NO: 1) under the nucleotide sequence of ideE2 (SEQ ID NO: 14)
  • SEQ ID NO: 7 and SEQ ID NO: 17 are combined to show the amino acid sequence of the IdeZ2 protein (SEQ ID NO: 7) under the nucleotide sequence of the ideZ2 gene (SEQ ID NO: 17) from S. equi subsp. zooepidemicus
  • the nucleotide sequence of the ideE gene (GenBank DQ508733) and the amino acid sequence of the IdeE protein from S. equi subsp. equi are shown.
  • nucleotide sequence of the ideZ gene (Genbank DQ826037) and the amino acid sequence of the IdeZ protein from S. equi subsp. zooepidemicus are shown.
  • GPLGS DDYQRNATEAYAKEVPHQITSVWTKGVTPLTPEQFRYNNEDVIHA PYLAHQGWYDITKAFDGKDNLLCGAATAGNMLHWWFDQNKTEIEAYLSKH PEKQKIIFNNQELFDLKAAIDTKDSQTNSQLFNYFRDKAFPNLSARQLGV MPDLVLDMFINGYYLNVFKTQSTDVNRPYQDKDKRGGIFDAVFTRGDQTT LLTARHDLKNKGLNDISTIIKQELTEGRALALSHTYANVSISHVINLWGA DFNAEGNLEAIYVTDSDANASIGMKKYFVGINAHRHVAISAKKIEGENIG AQVLGLFTLSSGKDIWQKLS Amino acids in bold originates from the vector.
  • the objective of this study was to determine the level of protection conferred on vaccination with Intervacc's new multi-component subunit vaccine following intranasal challenge with wild type S. equi strain 4047 in Welsh Mountain ponies.
  • the study has been performed by Animal Health Trust, UK.
  • the vaccines used therein, which are designated Nordostrep Septavac or Nordostrep Pentavac A (or only Septavac or Pentavac) are disclosed below.
  • the ponies were initially randomised into 3 groups for the vaccination period.
  • the Pentavac vaccine consisted of the following five S. equi recombinant proteins: EAG, ScIC, CNE, Eq5 and Eq8.
  • EAG S. equi recombinant proteins
  • ScIC ScIC
  • CNE CNE
  • Eq5 Eq5
  • Eq8 Eq8
  • the five proteins were mixed in PBS (50 ⁇ g/ml of the respective protein), divided in aliquots of 1 ml in vials and stored at ⁇ 20° C.
  • the vial was thawed and mixed with 1 ml adjuvant (Abisco 200, 375 ⁇ g/dose, Isconova AB, Sweden).
  • PBS 150 ⁇ g/ml of respective protein
  • the vial was thawed and mixed with 2 ml adjuvant (Abisco 300, 500 ⁇ g/dose, Isconova AB, Sweden).
  • the placebo formulations the S. equi proteins were omitted.
  • the placebo for subcutaneous vaccination only contained PBS and Abisco 200, 375 ⁇ g/dose and for intranasal vaccination, the placebo contained only PBS and Abisco 300, 500 ⁇ g/dose.
  • the Septavac vaccine consisted of the following seven S. equi recombinant proteins: EAG, ScIC, CNE, Eq5, Eq8, IdeE and IdeE2.
  • EAG S. equi recombinant proteins
  • ScIC S. equi recombinant proteins
  • CNE CNE
  • Eq5 Eq8 IdeE
  • IdeE2 IdeE2
  • IdeE2 IdeE2
  • IdeE2 IdeE2
  • the seven proteins were mixed in PBS (50 ⁇ g/ml of respective protein) and divided in aliquots of 1 ml in vials and stored at ⁇ 20° C. Immediately before vaccination the vial was thawed and mixed with 1 ml adjuvant (Abisco 200, 375 ⁇ g/dose, Isconova AB, Sweden).
  • the seven proteins were mixed in PBS (150 ⁇ g/ml of the respective protein) and divided in aliquots of 2 ml in vials and stored at ⁇ 20° C. Immediately before vaccination, the vial was thawed and mixed with 2 ml adjuvant (Abisco 300, 500 ⁇ g/dose, Isconova AB, Sweden). In the placebo formulations, the S. equi proteins were omitted.
  • the placebo for subcutaneous vaccination only contained PBS and Abisco 200, 375 ⁇ g/dose, and for intranasal vaccination, it only contained PBS and Abisco 300, 500 ⁇ g/dose.
  • EAG is comprised of the fragment EAG4B and CNE is the fragment designated 2.16.
  • the Septavac vaccine was a safe and effective vaccine for the prevention of strangles.
  • the invention is not restricted to the Septavac and Pentavac vaccines which have been studied in this Example but many combinations of the present antigens/immunogens are possible candidates for use in vaccine compositions for prevention of strangles.
  • Blood and nasal wash samples were taken according to the protocol to determine the equine immune responses to the vaccine subunits. Based on immunogenicity data, one vaccinated group was challenged to quantify the level of protection conferred.
  • Each pony was challenged with a total challenge dose of 1 ⁇ 10 8 cfu of S. equi strain 4047 administered via the spraying of a 2 ml culture containing 5 ⁇ 10 7 cfu into both nostrils. This dose regime is believed to optimise the infection rate whilst avoiding overwhelming the host immune response.
  • Ponies were carefully monitored for the onset of clinical signs of disease over a period of three weeks post challenge by regular checks, daily physical examination, monitoring of body temperature, the taking of sera to determine seroconversion and the taking of nasal washes for bacteriological analysis. All ponies were subjected to post mortem examination following abscessation or reaching the study endpoint at 3 weeks post challenge to determine the severity of disease pathology according to a scoring system developed at the AHT. Histopathological examination of tissues recovered from the study ponies was used to identify early signs of S. equi infection that were not obvious on post mortem (PM) examination.
  • PM post mortem
  • the vaccine vials were received by the AHT prior to the first vaccination and stored at ⁇ 20° C. until use in freezer number EQ No. 2305. Placebo (containing no antigens) and adjuvant vials were stored at 4° C. until use in fridge number EQ No. 44.
  • vaccines and adjuvants were mixed as stated in the protocol in situ by A Waller, L Prowse or C Robinson at AHT.
  • S. equi 4047 was prepared from fresh plates as described in SOP/BACT/25.
  • the bacteria grew as expected and the 1:40 diluted culture was harvested when the OD 600nm reached 0.3.
  • the growth of the challenge inoculum is shown in FIG. 6 . The following results were obtained.
  • Ponies were identified by a microchip in the neck. The 21 ponies were randomly assigned to vaccination groups (Table 3).
  • Vaccination groups and pony chip IDs Group Vaccine Pony Chip ID's 1 Septavac 00012, 00159, 00833, 00976, 99123, 99668, 99794 2 Pentavac 01298, 01605, 01724, 99223, 99229, 99773, 99919 3 Placebo 00173, 00427, 01635, 02078, 99549, 99776, 99886
  • Ponies in groups 1 and 3 were transferred to the ACVS (Allen Centre), three days prior to challenge to allow acclimatisation. Ponies were separated into two animal rooms according to their vaccination groups, so that ponies from each vaccination group were kept together.
  • Vaccinations were given by subcutaneous injection near the retropharyngeal lymph nodes according to AHT SOP/EQU/03 or via intranasal spray according to AHT SOP/EQU/07.
  • each pony was challenged by intranasal administration of 2 ml of a fresh S. equi 4047 culture into both nostrils using a flexible tube and spray nozzle according to AHT SOP/BACT32.
  • Such a challenge dose was predicted to contain a total of 1 ⁇ 10 8 cfu of S. equi 4047.
  • Ponies were examined according to AHT SOP/EQU/02. Each pony was examined clinically on the day of challenge, and on each of the following 21 days for the occurrence of symptoms associated with S. equi infection (demeanor, nasal discharge, lymph node swelling and abscessation, signs of coughing, difficulty swallowing and feeding, and ocular signs).
  • Blood samples were taken from the jugular vein according to AHT SOP/EQU/01 and according to the study protocol schedule. Serum was prepared according to AHT SOP/EQU/01 and stored frozen at ⁇ 20° C. or below until use.
  • a 500 ⁇ l sample of the nasal wash was added to 500 ⁇ l of Todd-Hewitt Broth in situ at the time of sampling for transportation to the lab to allow quantification of the number of ⁇ -haemolytic streptococci per ml according to AHT SOP/BACT/02.
  • the remaining nasal wash sample was centrifuged and the supernatant decanted into a clean 5 ml polypropylene tube and stored at
  • Tissue samples were preserved in phosphate buffered formalin and subjected to microscopic examination according to standard techniques and provision of a full and formal report.
  • Tissue swabs were taken and the results recorded and used to evaluate the level of S. equi infection.
  • Charcoal swabs were taken from each of the areas as stated in the protocol and processed on COBA Streptococcal selective plates to determine the presence of S. equi.
  • FIG. 8 There were no obvious differences in nasal score ( FIG. 8 ), lymph node score ( FIG. 9 ) or S. zooepidemicus counts ( FIG. 10 ) between the study groups during the vaccination phase, with the exception of some ponies that had ongoing S. zooepidemicus infections typical of ponies of this age. This resulted in a rise in mean rectal temperature around the original date for V2 (Apr. 3, 2008) as demonstrated in FIG. 7 . Ponies were allowed to recover from this S. zooepidemicus infection and all ponies were vaccinated on Apr. 10, 2008.
  • Fibrinogen levels were significantly different between the two study groups on days 6, 8 and 11 post challenge ( FIG. 12 ). All controls developed elevated fibrinogen levels, but only 2 vaccinates (ponies 0976 and 9794) had higher levels.
  • Neutrophil levels were also significantly different between the two study groups on days 6, 8 and 11 post challenge ( FIG. 13 ). All controls developed elevated neutrophil levels, but only 1 vaccinate (pony 9794) had higher levels.
  • the IgG levels in nasal washings and serum samples of the septavac group were measured using ELISA ( FIGS. 19 and 20 ) showing that the antigens generate mucosal and serum antibodies.
  • Ponies 0833 and 0159 showed sparse S. equi in areas other than the lymph node.
  • Ponies 0012, 9123 and 9668 showed no S. equi.
  • Pentavac A vaccine delayed the onset of infection upon challenge with S. equi and that one of the ponies in the group did not developed strangles.
  • One implication of the present invention is that enzymes degrading immunoglobulins can be used as antigens in a vaccine to protect the target animal from infection. Therefore one embodiment of the present invention is that concerning the human pathogenic group A streptococci (GAS) it is possible to construct a vaccine composition which protects humans from infections caused by this bacterium.
  • GAS human pathogenic group A streptococci
  • Sib35, IdeS or Mac-proteins which share amino acid sequence homologies to IdeE and IdeE2 and therefore in light of the present invention can be purified and used as antigens in a vaccine separately or in combination with other purified extracellular proteins (like M-proteins or M-like proteins or fragments thereof) from group A strains.
  • the invention can be used to develop specific antisera, polyclonal or monoclonal antibodies to be used for diagnostic purposes or to be used in passive immunisations of the target animal including humans.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Immunology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Epidemiology (AREA)
  • Mycology (AREA)
  • Microbiology (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Oncology (AREA)
  • Communicable Diseases (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Peptides Or Proteins (AREA)
US12/747,843 2007-12-13 2008-12-12 immunizing composition Abandoned US20110020403A1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US12/747,843 US20110020403A1 (en) 2007-12-13 2008-12-12 immunizing composition

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US1349507P 2007-12-13 2007-12-13
US8228108P 2008-07-21 2008-07-21
PCT/SE2008/051445 WO2009075646A1 (en) 2007-12-13 2008-12-12 Improved immunizing composition
US12/747,843 US20110020403A1 (en) 2007-12-13 2008-12-12 immunizing composition

Related Parent Applications (1)

Application Number Title Priority Date Filing Date
PCT/SE2008/051445 A-371-Of-International WO2009075646A1 (en) 2007-12-13 2008-12-12 Improved immunizing composition

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US13/893,212 Continuation US9987342B2 (en) 2007-12-13 2013-05-13 Immunizing composition

Publications (1)

Publication Number Publication Date
US20110020403A1 true US20110020403A1 (en) 2011-01-27

Family

ID=40755754

Family Applications (2)

Application Number Title Priority Date Filing Date
US12/747,843 Abandoned US20110020403A1 (en) 2007-12-13 2008-12-12 immunizing composition
US13/893,212 Active 2031-08-20 US9987342B2 (en) 2007-12-13 2013-05-13 Immunizing composition

Family Applications After (1)

Application Number Title Priority Date Filing Date
US13/893,212 Active 2031-08-20 US9987342B2 (en) 2007-12-13 2013-05-13 Immunizing composition

Country Status (8)

Country Link
US (2) US20110020403A1 (enExample)
EP (1) EP2227249B1 (enExample)
JP (1) JP2011506433A (enExample)
CN (1) CN102026658A (enExample)
AU (1) AU2008336295B2 (enExample)
CA (1) CA2708260A1 (enExample)
NZ (1) NZ586367A (enExample)
WO (1) WO2009075646A1 (enExample)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN115443288A (zh) * 2020-06-18 2022-12-06 上海宝济药业有限公司 一种免疫球蛋白降解酶IdeE的突变体

Families Citing this family (12)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20120225079A1 (en) * 2009-11-13 2012-09-06 Intervacc Ab Immunizing composition for reducing streptococcal infections
CN103068838B (zh) 2010-05-26 2016-03-02 英特瓦克公司 基于重组蛋白的抗链球菌感染疫苗
EP2949340A1 (en) * 2014-05-30 2015-12-02 IDT Biologika GmbH Vaccine composition against Streptococcus suis infection
GB201502305D0 (en) 2015-02-12 2015-04-01 Hansa Medical Ab Protein
GB201502306D0 (en) 2015-02-12 2015-04-01 Hansa Medical Ab Protein
WO2022216011A1 (ko) * 2021-04-05 2022-10-13 주식회사 엘지화학 코로나바이러스 백신 조성물
WO2023116817A1 (zh) * 2021-12-22 2023-06-29 上海宝济药业有限公司 一种免疫球蛋白降解酶IdeE的突变体的用途
CN114437235B (zh) * 2022-01-04 2024-02-09 中国农业科学院哈尔滨兽医研究所(中国动物卫生与流行病学中心哈尔滨分中心) 马链球菌马亚种8种蛋白的重组融合蛋白及其制备方法和应用
KR20250123949A (ko) 2022-11-18 2025-08-18 사이즈믹 테라퓨틱, 인코포레이티드. Fc 융합 분자 및 이의 용도
AU2024206486A1 (en) 2023-01-06 2025-08-14 Seismic Therapeutic, Inc. Protease variants and uses thereof
WO2025054602A1 (en) * 2023-09-08 2025-03-13 The Texas A&M University System Protein for the serological detection of streptococcus equi subspecies equi exposure or infection
CN118497176B (zh) * 2024-07-16 2025-01-21 苏州康聚生物科技有限公司 一种免疫球蛋白降解酶

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6120775A (en) * 1997-07-29 2000-09-19 Akzo Nobel N.V. Streptococcus equi vaccine
US20060140980A1 (en) * 2002-10-11 2006-06-29 Beng Guss Immunization of non-human mammals against streptococcus equi
US20070243195A1 (en) * 2006-03-29 2007-10-18 Minke Jules M Vaccine against streptococci

Family Cites Families (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AR241545A1 (es) 1985-07-12 1992-08-31 Cornell Res Foundation Inc Un metodo para preparar una cepa de s. equi avirulenta a.t.c.c. 53186 para equinos.
US5583014A (en) 1990-07-03 1996-12-10 Bayer Corporation Preparation and use of enzyme-detergent extracted Streptococcus zoopidemicus vaccine
SE9003374D0 (sv) 1990-10-22 1990-10-22 Alfa Laval Agri Int A collagen binding protein as well as its preparation
SE9302855D0 (sv) 1993-09-06 1993-09-06 Martin Lindberg Method and means for producing plasmaproteinase inhibitor binding proteins
IES960488A2 (en) 1996-07-03 1997-11-19 Trinity College Dublin Subunit Vaccine for Streptococcus Equi
SE9804491D0 (sv) 1998-12-22 1998-12-22 Bengt Guss Novel fibronectin-binding protein
US6887480B1 (en) 1999-06-10 2005-05-03 Medimmune, Inc. Streptococcus pneumoniae proteins and vaccines
WO2000076540A2 (en) * 1999-06-10 2000-12-21 Med Immune, Inc. Streptococcus pneumoniae proteins and vaccines

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6120775A (en) * 1997-07-29 2000-09-19 Akzo Nobel N.V. Streptococcus equi vaccine
US20060140980A1 (en) * 2002-10-11 2006-06-29 Beng Guss Immunization of non-human mammals against streptococcus equi
US20070243195A1 (en) * 2006-03-29 2007-10-18 Minke Jules M Vaccine against streptococci

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN115443288A (zh) * 2020-06-18 2022-12-06 上海宝济药业有限公司 一种免疫球蛋白降解酶IdeE的突变体

Also Published As

Publication number Publication date
EP2227249B1 (en) 2018-04-25
EP2227249A1 (en) 2010-09-15
US9987342B2 (en) 2018-06-05
AU2008336295B2 (en) 2013-07-11
AU2008336295A1 (en) 2009-06-18
CN102026658A (zh) 2011-04-20
EP2227249A4 (en) 2011-08-31
CA2708260A1 (en) 2009-06-18
WO2009075646A1 (en) 2009-06-18
US20140220064A1 (en) 2014-08-07
NZ586367A (en) 2012-04-27
JP2011506433A (ja) 2011-03-03

Similar Documents

Publication Publication Date Title
US9987342B2 (en) Immunizing composition
US9795664B2 (en) Vaccine against streptococcal infections based on recombinant proteins
US10188717B2 (en) Vaccines and compositions against Streptococcus pneumoniae
JP2023503057A (ja) ヘモフィルス・パラスイスに対する新規ワクチン
JP2023503058A (ja) ヘモフィルス・パラスイスに対する新規ワクチン
EP2646049B1 (en) Composition for immunization against streptococcus pneumoniae
KR20200076551A (ko) 마이코플라즈마 폐렴 및 흉막폐렴 예방용 백신 조성물
CA2501621C (en) Immunization of non-human mammals against streptococcus equi
US20120225079A1 (en) Immunizing composition for reducing streptococcal infections
HK1156230A (en) Improved immunizing composition
HK1183677B (en) Vaccine against streptococcal infections based on recombinant proteins
TW202219269A (zh) 新型多殺性巴斯德氏菌株及具有hyaC與nanP缺失之疫苗
AU2013205101A1 (en) Improved immunizing composition
HK1085646B (en) Antigenic compositions for immunization of non-human mammals against streptococcus equi

Legal Events

Date Code Title Description
AS Assignment

Owner name: INTERVACC AB, SWEDEN

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:GUSS, BENGT;FLOCK, JAN-INGMAR;FRYKBERG, LARS;AND OTHERS;SIGNING DATES FROM 20100819 TO 20100824;REEL/FRAME:025123/0477

STCB Information on status: application discontinuation

Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION