US20110020403A1 - immunizing composition - Google Patents
immunizing composition Download PDFInfo
- Publication number
- US20110020403A1 US20110020403A1 US12/747,843 US74784308A US2011020403A1 US 20110020403 A1 US20110020403 A1 US 20110020403A1 US 74784308 A US74784308 A US 74784308A US 2011020403 A1 US2011020403 A1 US 2011020403A1
- Authority
- US
- United States
- Prior art keywords
- protein
- polypeptide
- seq
- equi
- composition
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 239000000203 mixture Substances 0.000 title claims abstract description 90
- 230000003053 immunization Effects 0.000 title claims abstract description 21
- 108090000623 proteins and genes Proteins 0.000 claims abstract description 175
- 102000004169 proteins and genes Human genes 0.000 claims abstract description 133
- 229960005486 vaccine Drugs 0.000 claims abstract description 79
- 239000000427 antigen Substances 0.000 claims abstract description 72
- 102000036639 antigens Human genes 0.000 claims abstract description 72
- 108091007433 antigens Proteins 0.000 claims abstract description 72
- 230000000890 antigenic effect Effects 0.000 claims abstract description 59
- 241000120569 Streptococcus equi subsp. zooepidemicus Species 0.000 claims abstract description 33
- 241001339231 Streptococcus equi subsp. equi Species 0.000 claims abstract description 25
- 241000282414 Homo sapiens Species 0.000 claims abstract description 21
- 238000002649 immunization Methods 0.000 claims abstract description 21
- 241000194048 Streptococcus equi Species 0.000 claims description 77
- 229920001184 polypeptide Polymers 0.000 claims description 67
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 67
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 67
- 208000015181 infectious disease Diseases 0.000 claims description 47
- 241001465754 Metazoa Species 0.000 claims description 35
- 241000283086 Equidae Species 0.000 claims description 32
- 238000000034 method Methods 0.000 claims description 29
- 239000012634 fragment Substances 0.000 claims description 24
- 239000002773 nucleotide Substances 0.000 claims description 24
- 125000003729 nucleotide group Chemical group 0.000 claims description 24
- 230000002163 immunogen Effects 0.000 claims description 21
- 239000013598 vector Substances 0.000 claims description 21
- 239000002671 adjuvant Substances 0.000 claims description 18
- 238000002360 preparation method Methods 0.000 claims description 15
- 241000283073 Equus caballus Species 0.000 claims description 14
- 210000002966 serum Anatomy 0.000 claims description 8
- 241000124008 Mammalia Species 0.000 claims description 7
- 238000007920 subcutaneous administration Methods 0.000 claims description 7
- 230000005875 antibody response Effects 0.000 claims description 6
- 230000028993 immune response Effects 0.000 claims description 6
- 108091033319 polynucleotide Proteins 0.000 claims description 6
- 102000040430 polynucleotide Human genes 0.000 claims description 6
- 239000002157 polynucleotide Substances 0.000 claims description 6
- 230000000069 prophylactic effect Effects 0.000 claims description 6
- 238000004519 manufacturing process Methods 0.000 claims description 5
- 239000003937 drug carrier Substances 0.000 claims description 4
- 239000013604 expression vector Substances 0.000 claims description 4
- 238000001042 affinity chromatography Methods 0.000 claims description 3
- 238000011081 inoculation Methods 0.000 claims description 3
- 239000013612 plasmid Substances 0.000 claims description 3
- 230000001225 therapeutic effect Effects 0.000 claims description 3
- 238000004587 chromatography analysis Methods 0.000 claims description 2
- 238000012258 culturing Methods 0.000 claims description 2
- 238000001727 in vivo Methods 0.000 claims description 2
- 238000002156 mixing Methods 0.000 claims description 2
- 210000003097 mucus Anatomy 0.000 claims description 2
- 239000013603 viral vector Substances 0.000 claims description 2
- 125000003275 alpha amino acid group Chemical group 0.000 claims 18
- 238000002255 vaccination Methods 0.000 description 53
- 150000001413 amino acids Chemical group 0.000 description 48
- 102100022810 Potassium voltage-gated channel subfamily H member 1 Human genes 0.000 description 45
- 239000013615 primer Substances 0.000 description 23
- 210000001165 lymph node Anatomy 0.000 description 20
- 241000699670 Mus sp. Species 0.000 description 19
- 238000002965 ELISA Methods 0.000 description 18
- 102000008946 Fibrinogen Human genes 0.000 description 16
- 108010049003 Fibrinogen Proteins 0.000 description 16
- 229940012952 fibrinogen Drugs 0.000 description 16
- 210000000440 neutrophil Anatomy 0.000 description 15
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 12
- 206010037660 Pyrexia Diseases 0.000 description 11
- 239000002953 phosphate buffered saline Substances 0.000 description 11
- 238000010561 standard procedure Methods 0.000 description 11
- 230000027950 fever generation Effects 0.000 description 10
- 229940068196 placebo Drugs 0.000 description 10
- 239000000902 placebo Substances 0.000 description 10
- 241000894006 Bacteria Species 0.000 description 9
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 9
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 9
- 210000004027 cell Anatomy 0.000 description 8
- 108020004414 DNA Proteins 0.000 description 7
- 210000004369 blood Anatomy 0.000 description 7
- 239000008280 blood Substances 0.000 description 7
- 238000003776 cleavage reaction Methods 0.000 description 7
- 201000010099 disease Diseases 0.000 description 7
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 7
- 238000011886 postmortem examination Methods 0.000 description 7
- 241000588724 Escherichia coli Species 0.000 description 6
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 6
- 241001505901 Streptococcus sp. 'group A' Species 0.000 description 6
- 238000009472 formulation Methods 0.000 description 6
- 230000007170 pathology Effects 0.000 description 6
- 239000000047 product Substances 0.000 description 6
- 230000001047 pyretic effect Effects 0.000 description 6
- 230000007017 scission Effects 0.000 description 6
- 208000016261 weight loss Diseases 0.000 description 6
- 230000004580 weight loss Effects 0.000 description 6
- 206010050167 Lymph node abscess Diseases 0.000 description 5
- 240000004371 Panax ginseng Species 0.000 description 5
- 108010047495 alanylglycine Proteins 0.000 description 5
- 238000004458 analytical method Methods 0.000 description 5
- 230000002354 daily effect Effects 0.000 description 5
- 210000002919 epithelial cell Anatomy 0.000 description 5
- 230000002441 reversible effect Effects 0.000 description 5
- 229930182490 saponin Natural products 0.000 description 5
- 150000007949 saponins Chemical class 0.000 description 5
- 235000017709 saponins Nutrition 0.000 description 5
- 102000014914 Carrier Proteins Human genes 0.000 description 4
- 102000010834 Extracellular Matrix Proteins Human genes 0.000 description 4
- 108010037362 Extracellular Matrix Proteins Proteins 0.000 description 4
- 108050001049 Extracellular proteins Proteins 0.000 description 4
- WSFSSNUMVMOOMR-UHFFFAOYSA-N Formaldehyde Chemical compound O=C WSFSSNUMVMOOMR-UHFFFAOYSA-N 0.000 description 4
- 241000880493 Leptailurus serval Species 0.000 description 4
- GPJGFSFYBJGYRX-YUMQZZPRSA-N Lys-Gly-Asp Chemical compound NCCCC[C@H](N)C(=O)NCC(=O)N[C@H](C(O)=O)CC(O)=O GPJGFSFYBJGYRX-YUMQZZPRSA-N 0.000 description 4
- 235000005035 Panax pseudoginseng ssp. pseudoginseng Nutrition 0.000 description 4
- 235000003140 Panax quinquefolius Nutrition 0.000 description 4
- 206010039101 Rhinorrhoea Diseases 0.000 description 4
- 206010000269 abscess Diseases 0.000 description 4
- 230000002238 attenuated effect Effects 0.000 description 4
- 108091008324 binding proteins Proteins 0.000 description 4
- 239000000872 buffer Substances 0.000 description 4
- 238000010367 cloning Methods 0.000 description 4
- 230000003111 delayed effect Effects 0.000 description 4
- 238000010790 dilution Methods 0.000 description 4
- 239000012895 dilution Substances 0.000 description 4
- 230000000694 effects Effects 0.000 description 4
- 210000002744 extracellular matrix Anatomy 0.000 description 4
- 235000008434 ginseng Nutrition 0.000 description 4
- 230000036541 health Effects 0.000 description 4
- 208000010753 nasal discharge Diseases 0.000 description 4
- 238000000746 purification Methods 0.000 description 4
- 150000003242 quaternary ammonium salts Chemical class 0.000 description 4
- 230000004044 response Effects 0.000 description 4
- 108091008146 restriction endonucleases Proteins 0.000 description 4
- 238000010254 subcutaneous injection Methods 0.000 description 4
- 239000007929 subcutaneous injection Substances 0.000 description 4
- 210000001519 tissue Anatomy 0.000 description 4
- 102000016359 Fibronectins Human genes 0.000 description 3
- LCMWVZLBCUVDAZ-IUCAKERBSA-N Lys-Gly-Glu Chemical compound [NH3+]CCCC[C@H]([NH3+])C(=O)NCC(=O)N[C@H](C([O-])=O)CCC([O-])=O LCMWVZLBCUVDAZ-IUCAKERBSA-N 0.000 description 3
- DLCAXBGXGOVUCD-PPCPHDFISA-N Lys-Thr-Ile Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O DLCAXBGXGOVUCD-PPCPHDFISA-N 0.000 description 3
- 101710085938 Matrix protein Proteins 0.000 description 3
- 102000018697 Membrane Proteins Human genes 0.000 description 3
- 108010052285 Membrane Proteins Proteins 0.000 description 3
- 101710127721 Membrane protein Proteins 0.000 description 3
- 241000699666 Mus <mouse, genus> Species 0.000 description 3
- 102100032965 Myomesin-2 Human genes 0.000 description 3
- 101710197954 N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase Proteins 0.000 description 3
- ABSSTGUCBCDKMU-UWVGGRQHSA-N Pro-Lys-Gly Chemical compound NCCCC[C@@H](C(=O)NCC(O)=O)NC(=O)[C@@H]1CCCN1 ABSSTGUCBCDKMU-UWVGGRQHSA-N 0.000 description 3
- 241000193996 Streptococcus pyogenes Species 0.000 description 3
- 101000815632 Streptococcus suis (strain 05ZYH33) Rqc2 homolog RqcH Proteins 0.000 description 3
- 238000002835 absorbance Methods 0.000 description 3
- 108010087924 alanylproline Proteins 0.000 description 3
- ILRRQNADMUWWFW-UHFFFAOYSA-K aluminium phosphate Chemical compound O1[Al]2OP1(=O)O2 ILRRQNADMUWWFW-UHFFFAOYSA-K 0.000 description 3
- 108010009111 arginyl-glycyl-glutamic acid Proteins 0.000 description 3
- 108010047857 aspartylglycine Proteins 0.000 description 3
- -1 cation lipids Chemical class 0.000 description 3
- 239000003795 chemical substances by application Substances 0.000 description 3
- 238000011161 development Methods 0.000 description 3
- 238000002474 experimental method Methods 0.000 description 3
- 230000004927 fusion Effects 0.000 description 3
- 108010078144 glutaminyl-glycine Proteins 0.000 description 3
- 210000003128 head Anatomy 0.000 description 3
- 230000005847 immunogenicity Effects 0.000 description 3
- 238000002347 injection Methods 0.000 description 3
- 239000007924 injection Substances 0.000 description 3
- 238000005259 measurement Methods 0.000 description 3
- 210000004898 n-terminal fragment Anatomy 0.000 description 3
- 239000013642 negative control Substances 0.000 description 3
- 230000002265 prevention Effects 0.000 description 3
- 238000012545 processing Methods 0.000 description 3
- 238000005070 sampling Methods 0.000 description 3
- 239000011780 sodium chloride Substances 0.000 description 3
- 241000894007 species Species 0.000 description 3
- 238000005406 washing Methods 0.000 description 3
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 2
- 206010067484 Adverse reaction Diseases 0.000 description 2
- MSWSRLGNLKHDEI-ACZMJKKPSA-N Ala-Ser-Glu Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(O)=O MSWSRLGNLKHDEI-ACZMJKKPSA-N 0.000 description 2
- HJRBIWRXULGMOA-ACZMJKKPSA-N Asn-Gln-Asp Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(O)=O HJRBIWRXULGMOA-ACZMJKKPSA-N 0.000 description 2
- SPWXXPFDTMYTRI-IUKAMOBKSA-N Asp-Ile-Thr Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(O)=O SPWXXPFDTMYTRI-IUKAMOBKSA-N 0.000 description 2
- 241000283690 Bos taurus Species 0.000 description 2
- 241000282472 Canis lupus familiaris Species 0.000 description 2
- 244000025254 Cannabis sativa Species 0.000 description 2
- 229920002101 Chitin Polymers 0.000 description 2
- 206010014568 Empyema Diseases 0.000 description 2
- 102000004190 Enzymes Human genes 0.000 description 2
- 108090000790 Enzymes Proteins 0.000 description 2
- 241000282326 Felis catus Species 0.000 description 2
- 108010067306 Fibronectins Proteins 0.000 description 2
- 101710160621 Fusion glycoprotein F0 Proteins 0.000 description 2
- LURQDGKYBFWWJA-MNXVOIDGSA-N Gln-Lys-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(=O)N)N LURQDGKYBFWWJA-MNXVOIDGSA-N 0.000 description 2
- XZLLTYBONVKGLO-SDDRHHMPSA-N Gln-Lys-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(=O)N)N)C(=O)O XZLLTYBONVKGLO-SDDRHHMPSA-N 0.000 description 2
- ZZLDMBMFKZFQMU-NRPADANISA-N Gln-Val-Ala Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C)C(O)=O ZZLDMBMFKZFQMU-NRPADANISA-N 0.000 description 2
- 241000282412 Homo Species 0.000 description 2
- CYHJCEKUMCNDFG-LAEOZQHASA-N Ile-Gln-Gly Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)NCC(=O)O)N CYHJCEKUMCNDFG-LAEOZQHASA-N 0.000 description 2
- 108060003951 Immunoglobulin Proteins 0.000 description 2
- IXHKPDJKKCUKHS-GARJFASQSA-N Lys-Ala-Pro Chemical compound C[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](CCCCN)N IXHKPDJKKCUKHS-GARJFASQSA-N 0.000 description 2
- IRNSXVOWSXSULE-DCAQKATOSA-N Lys-Ala-Val Chemical compound CC(C)[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CCCCN IRNSXVOWSXSULE-DCAQKATOSA-N 0.000 description 2
- YKBSXQFZWFXFIB-VOAKCMCISA-N Lys-Thr-Lys Chemical compound NCCCC[C@H](N)C(=O)N[C@@H]([C@H](O)C)C(=O)N[C@@H](CCCCN)C(O)=O YKBSXQFZWFXFIB-VOAKCMCISA-N 0.000 description 2
- KZNQNBZMBZJQJO-UHFFFAOYSA-N N-glycyl-L-proline Natural products NCC(=O)N1CCCC1C(O)=O KZNQNBZMBZJQJO-UHFFFAOYSA-N 0.000 description 2
- 108010079364 N-glycylalanine Proteins 0.000 description 2
- 108091028043 Nucleic acid sequence Proteins 0.000 description 2
- 238000012408 PCR amplification Methods 0.000 description 2
- 201000007100 Pharyngitis Diseases 0.000 description 2
- DCHQYSOGURGJST-FJXKBIBVSA-N Pro-Thr-Gly Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(O)=O DCHQYSOGURGJST-FJXKBIBVSA-N 0.000 description 2
- CDVFZMOFNJPUDD-ACZMJKKPSA-N Ser-Gln-Asn Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(N)=O)C(O)=O CDVFZMOFNJPUDD-ACZMJKKPSA-N 0.000 description 2
- 206010061372 Streptococcal infection Diseases 0.000 description 2
- 238000000692 Student's t-test Methods 0.000 description 2
- 241000282887 Suidae Species 0.000 description 2
- COYHRQWNJDJCNA-NUJDXYNKSA-N Thr-Thr-Thr Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O COYHRQWNJDJCNA-NUJDXYNKSA-N 0.000 description 2
- KZTLZZQTJMCGIP-ZJDVBMNYSA-N Thr-Val-Thr Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O KZTLZZQTJMCGIP-ZJDVBMNYSA-N 0.000 description 2
- HSBZWINKRYZCSQ-KKUMJFAQSA-N Tyr-Lys-Asp Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(O)=O)C(O)=O HSBZWINKRYZCSQ-KKUMJFAQSA-N 0.000 description 2
- 230000006838 adverse reaction Effects 0.000 description 2
- 229960000723 ampicillin Drugs 0.000 description 2
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 2
- 108010091092 arginyl-glycyl-proline Proteins 0.000 description 2
- 230000001580 bacterial effect Effects 0.000 description 2
- 238000011955 best available control technology Methods 0.000 description 2
- 210000004900 c-terminal fragment Anatomy 0.000 description 2
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 2
- 230000000593 degrading effect Effects 0.000 description 2
- VHJLVAABSRFDPM-QWWZWVQMSA-N dithiothreitol Chemical compound SC[C@@H](O)[C@H](O)CS VHJLVAABSRFDPM-QWWZWVQMSA-N 0.000 description 2
- 210000003527 eukaryotic cell Anatomy 0.000 description 2
- 239000000284 extract Substances 0.000 description 2
- 102000036072 fibronectin binding proteins Human genes 0.000 description 2
- 229930182494 ginsenoside Natural products 0.000 description 2
- VPZXBVLAVMBEQI-UHFFFAOYSA-N glycyl-DL-alpha-alanine Natural products OC(=O)C(C)NC(=O)CN VPZXBVLAVMBEQI-UHFFFAOYSA-N 0.000 description 2
- 108010089804 glycyl-threonine Proteins 0.000 description 2
- 239000001963 growth medium Substances 0.000 description 2
- 102000018358 immunoglobulin Human genes 0.000 description 2
- 238000011065 in-situ storage Methods 0.000 description 2
- 239000002054 inoculum Substances 0.000 description 2
- 230000017730 intein-mediated protein splicing Effects 0.000 description 2
- 238000007918 intramuscular administration Methods 0.000 description 2
- 201000003265 lymphadenitis Diseases 0.000 description 2
- 108010003700 lysyl aspartic acid Proteins 0.000 description 2
- 108010009298 lysylglutamic acid Proteins 0.000 description 2
- 238000012544 monitoring process Methods 0.000 description 2
- 210000001331 nose Anatomy 0.000 description 2
- 230000001717 pathogenic effect Effects 0.000 description 2
- 229920000642 polymer Polymers 0.000 description 2
- 108010014614 prolyl-glycyl-proline Proteins 0.000 description 2
- 238000011002 quantification Methods 0.000 description 2
- 230000002829 reductive effect Effects 0.000 description 2
- 210000002345 respiratory system Anatomy 0.000 description 2
- 206010039083 rhinitis Diseases 0.000 description 2
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 2
- 239000007921 spray Substances 0.000 description 2
- 229940031626 subunit vaccine Drugs 0.000 description 2
- 239000006228 supernatant Substances 0.000 description 2
- 230000008961 swelling Effects 0.000 description 2
- 208000024891 symptom Diseases 0.000 description 2
- 238000012360 testing method Methods 0.000 description 2
- 108010061238 threonyl-glycine Proteins 0.000 description 2
- 108010071097 threonyl-lysyl-proline Proteins 0.000 description 2
- CUVSTAMIHSSVKL-UWVGGRQHSA-N (4s)-4-[(2-aminoacetyl)amino]-5-[[(2s)-6-amino-1-(carboxymethylamino)-1-oxohexan-2-yl]amino]-5-oxopentanoic acid Chemical compound NCCCC[C@@H](C(=O)NCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)CN CUVSTAMIHSSVKL-UWVGGRQHSA-N 0.000 description 1
- SMZOUWXMTYCWNB-UHFFFAOYSA-N 2-(2-methoxy-5-methylphenyl)ethanamine Chemical compound COC1=CC=C(C)C=C1CCN SMZOUWXMTYCWNB-UHFFFAOYSA-N 0.000 description 1
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 1
- 229920001817 Agar Polymers 0.000 description 1
- GORKKVHIBWAQHM-GCJQMDKQSA-N Ala-Asn-Thr Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O GORKKVHIBWAQHM-GCJQMDKQSA-N 0.000 description 1
- KIUYPHAMDKDICO-WHFBIAKZSA-N Ala-Asp-Gly Chemical compound C[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)NCC(O)=O KIUYPHAMDKDICO-WHFBIAKZSA-N 0.000 description 1
- KUDREHRZRIVKHS-UWJYBYFXSA-N Ala-Asp-Tyr Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O KUDREHRZRIVKHS-UWJYBYFXSA-N 0.000 description 1
- OBVSBEYOMDWLRJ-BFHQHQDPSA-N Ala-Gly-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)CNC(=O)[C@H](C)N OBVSBEYOMDWLRJ-BFHQHQDPSA-N 0.000 description 1
- PNALXAODQKTNLV-JBDRJPRFSA-N Ala-Ile-Ala Chemical compound C[C@H](N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(O)=O PNALXAODQKTNLV-JBDRJPRFSA-N 0.000 description 1
- AWZKCUCQJNTBAD-SRVKXCTJSA-N Ala-Leu-Lys Chemical compound C[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(O)=O)CCCCN AWZKCUCQJNTBAD-SRVKXCTJSA-N 0.000 description 1
- OYJCVIGKMXUVKB-GARJFASQSA-N Ala-Leu-Pro Chemical compound C[C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@@H]1C(=O)O)N OYJCVIGKMXUVKB-GARJFASQSA-N 0.000 description 1
- SOBIAADAMRHGKH-CIUDSAMLSA-N Ala-Leu-Ser Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(O)=O SOBIAADAMRHGKH-CIUDSAMLSA-N 0.000 description 1
- MEFILNJXAVSUTO-JXUBOQSCSA-N Ala-Leu-Thr Chemical compound C[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O MEFILNJXAVSUTO-JXUBOQSCSA-N 0.000 description 1
- IPZQNYYAYVRKKK-FXQIFTODSA-N Ala-Pro-Ala Chemical compound C[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C)C(O)=O IPZQNYYAYVRKKK-FXQIFTODSA-N 0.000 description 1
- YHBDGLZYNIARKJ-GUBZILKMSA-N Ala-Pro-Val Chemical compound CC(C)[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H](C)N YHBDGLZYNIARKJ-GUBZILKMSA-N 0.000 description 1
- PEEYDECOOVQKRZ-DLOVCJGASA-N Ala-Ser-Phe Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O PEEYDECOOVQKRZ-DLOVCJGASA-N 0.000 description 1
- VNFSAYFQLXPHPY-CIQUZCHMSA-N Ala-Thr-Ile Chemical compound [H]N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O VNFSAYFQLXPHPY-CIQUZCHMSA-N 0.000 description 1
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 1
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 1
- RVDVDRUZWZIBJQ-CIUDSAMLSA-N Arg-Asn-Glu Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O RVDVDRUZWZIBJQ-CIUDSAMLSA-N 0.000 description 1
- KMSHNDWHPWXPEC-BQBZGAKWSA-N Arg-Asp-Gly Chemical compound NC(N)=NCCC[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)NCC(O)=O KMSHNDWHPWXPEC-BQBZGAKWSA-N 0.000 description 1
- FBLMOFHNVQBKRR-IHRRRGAJSA-N Arg-Asp-Tyr Chemical compound NC(N)=NCCC[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 FBLMOFHNVQBKRR-IHRRRGAJSA-N 0.000 description 1
- QAXCZGMLVICQKS-SRVKXCTJSA-N Arg-Glu-His Chemical compound C1=C(NC=N1)C[C@@H](C(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCCN=C(N)N)N QAXCZGMLVICQKS-SRVKXCTJSA-N 0.000 description 1
- AUFHLLPVPSMEOG-YUMQZZPRSA-N Arg-Gly-Glu Chemical compound NC(N)=NCCC[C@H](N)C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(O)=O AUFHLLPVPSMEOG-YUMQZZPRSA-N 0.000 description 1
- ZATRYQNPUHGXCU-DTWKUNHWSA-N Arg-Gly-Pro Chemical compound C1C[C@@H](N(C1)C(=O)CNC(=O)[C@H](CCCN=C(N)N)N)C(=O)O ZATRYQNPUHGXCU-DTWKUNHWSA-N 0.000 description 1
- NKNILFJYKKHBKE-WPRPVWTQSA-N Arg-Gly-Val Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H](C(C)C)C(O)=O NKNILFJYKKHBKE-WPRPVWTQSA-N 0.000 description 1
- SLQQPJBDBVPVQV-JYJNAYRXSA-N Arg-Phe-Val Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C(C)C)C(O)=O SLQQPJBDBVPVQV-JYJNAYRXSA-N 0.000 description 1
- FVBZXNSRIDVYJS-AVGNSLFASA-N Arg-Pro-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)CCCN=C(N)N FVBZXNSRIDVYJS-AVGNSLFASA-N 0.000 description 1
- UZSQXCMNUPKLCC-FJXKBIBVSA-N Arg-Thr-Gly Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(O)=O UZSQXCMNUPKLCC-FJXKBIBVSA-N 0.000 description 1
- LOVIQNMIPQVIGT-BVSLBCMMSA-N Arg-Trp-Phe Chemical compound C([C@H](NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CCCN=C(N)N)N)C(O)=O)C1=CC=CC=C1 LOVIQNMIPQVIGT-BVSLBCMMSA-N 0.000 description 1
- LFWOQHSQNCKXRU-UFYCRDLUSA-N Arg-Tyr-Phe Chemical compound C([C@H](NC(=O)[C@H](CCCN=C(N)N)N)C(=O)N[C@@H](CC=1C=CC=CC=1)C(O)=O)C1=CC=C(O)C=C1 LFWOQHSQNCKXRU-UFYCRDLUSA-N 0.000 description 1
- IZSMEUDYADKZTJ-KJEVXHAQSA-N Arg-Tyr-Thr Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H]([C@@H](C)O)C(O)=O IZSMEUDYADKZTJ-KJEVXHAQSA-N 0.000 description 1
- 206010060968 Arthritis infective Diseases 0.000 description 1
- APHUDFFMXFYRKP-CIUDSAMLSA-N Asn-Asn-Lys Chemical compound C(CCN)C[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)N)NC(=O)[C@H](CC(=O)N)N APHUDFFMXFYRKP-CIUDSAMLSA-N 0.000 description 1
- KXFCBAHYSLJCCY-ZLUOBGJFSA-N Asn-Asn-Ser Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(O)=O KXFCBAHYSLJCCY-ZLUOBGJFSA-N 0.000 description 1
- CUQUEHYSSFETRD-ACZMJKKPSA-N Asn-Asp-Gln Chemical compound C(CC(=O)N)[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CC(=O)N)N CUQUEHYSSFETRD-ACZMJKKPSA-N 0.000 description 1
- QISZHYWZHJRDAO-CIUDSAMLSA-N Asn-Asp-Lys Chemical compound C(CCN)C[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CC(=O)N)N QISZHYWZHJRDAO-CIUDSAMLSA-N 0.000 description 1
- AYKKKGFJXIDYLX-ACZMJKKPSA-N Asn-Gln-Asn Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(N)=O)C(O)=O AYKKKGFJXIDYLX-ACZMJKKPSA-N 0.000 description 1
- ZTRJUKDEALVRMW-SRVKXCTJSA-N Asn-His-His Chemical compound C1=C(NC=N1)C[C@@H](C(=O)N[C@@H](CC2=CN=CN2)C(=O)O)NC(=O)[C@H](CC(=O)N)N ZTRJUKDEALVRMW-SRVKXCTJSA-N 0.000 description 1
- DJIMLSXHXKWADV-CIUDSAMLSA-N Asn-Leu-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CC(N)=O DJIMLSXHXKWADV-CIUDSAMLSA-N 0.000 description 1
- AWXDRZJQCVHCIT-DCAQKATOSA-N Asn-Pro-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)CC(N)=O AWXDRZJQCVHCIT-DCAQKATOSA-N 0.000 description 1
- GMUOCGCDOYYWPD-FXQIFTODSA-N Asn-Pro-Ser Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(O)=O GMUOCGCDOYYWPD-FXQIFTODSA-N 0.000 description 1
- JBDLMLZNDRLDIX-HJGDQZAQSA-N Asn-Thr-Leu Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(O)=O JBDLMLZNDRLDIX-HJGDQZAQSA-N 0.000 description 1
- KRXIWXCXOARFNT-ZLUOBGJFSA-N Asp-Ala-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC(O)=O KRXIWXCXOARFNT-ZLUOBGJFSA-N 0.000 description 1
- WSOKZUVWBXVJHX-CIUDSAMLSA-N Asp-Arg-Glu Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(O)=O WSOKZUVWBXVJHX-CIUDSAMLSA-N 0.000 description 1
- VBVKSAFJPVXMFJ-CIUDSAMLSA-N Asp-Asn-His Chemical compound C1=C(NC=N1)C[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)N)NC(=O)[C@H](CC(=O)O)N VBVKSAFJPVXMFJ-CIUDSAMLSA-N 0.000 description 1
- BUVNWKQBMZLCDW-UGYAYLCHSA-N Asp-Asn-Ile Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O BUVNWKQBMZLCDW-UGYAYLCHSA-N 0.000 description 1
- VZNOVQKGJQJOCS-SRVKXCTJSA-N Asp-Asp-Tyr Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O VZNOVQKGJQJOCS-SRVKXCTJSA-N 0.000 description 1
- LJRPYAZQQWHEEV-FXQIFTODSA-N Asp-Gln-Gln Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(O)=O LJRPYAZQQWHEEV-FXQIFTODSA-N 0.000 description 1
- SNAWMGHSCHKSDK-GUBZILKMSA-N Asp-Gln-Lys Chemical compound C(CCN)C[C@@H](C(=O)O)NC(=O)[C@H](CCC(=O)N)NC(=O)[C@H](CC(=O)O)N SNAWMGHSCHKSDK-GUBZILKMSA-N 0.000 description 1
- VFUXXFVCYZPOQG-WDSKDSINSA-N Asp-Glu-Gly Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(O)=O VFUXXFVCYZPOQG-WDSKDSINSA-N 0.000 description 1
- SNDBKTFJWVEVPO-WHFBIAKZSA-N Asp-Gly-Ser Chemical compound [H]N[C@@H](CC(O)=O)C(=O)NCC(=O)N[C@@H](CO)C(O)=O SNDBKTFJWVEVPO-WHFBIAKZSA-N 0.000 description 1
- QNFRBNZGVVKBNJ-PEFMBERDSA-N Asp-Ile-Gln Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)O)NC(=O)[C@H](CC(=O)O)N QNFRBNZGVVKBNJ-PEFMBERDSA-N 0.000 description 1
- YFSLJHLQOALGSY-ZPFDUUQYSA-N Asp-Ile-Lys Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CC(=O)O)N YFSLJHLQOALGSY-ZPFDUUQYSA-N 0.000 description 1
- VSMYBNPOHYAXSD-GUBZILKMSA-N Asp-Lys-Glu Chemical compound OC(=O)C[C@H](N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(O)=O VSMYBNPOHYAXSD-GUBZILKMSA-N 0.000 description 1
- LBOVBQONZJRWPV-YUMQZZPRSA-N Asp-Lys-Gly Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)NCC(O)=O LBOVBQONZJRWPV-YUMQZZPRSA-N 0.000 description 1
- NVFSJIXJZCDICF-SRVKXCTJSA-N Asp-Lys-Lys Chemical compound C(CCN)C[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CC(=O)O)N NVFSJIXJZCDICF-SRVKXCTJSA-N 0.000 description 1
- HICVMZCGVFKTPM-BQBZGAKWSA-N Asp-Pro-Gly Chemical compound OC(=O)C[C@H](N)C(=O)N1CCC[C@H]1C(=O)NCC(O)=O HICVMZCGVFKTPM-BQBZGAKWSA-N 0.000 description 1
- DINOVZWPTMGSRF-QXEWZRGKSA-N Asp-Pro-Val Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C(C)C)C(O)=O DINOVZWPTMGSRF-QXEWZRGKSA-N 0.000 description 1
- UTLCRGFJFSZWAW-OLHMAJIHSA-N Asp-Thr-Asn Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)O)NC(=O)[C@H](CC(=O)O)N)O UTLCRGFJFSZWAW-OLHMAJIHSA-N 0.000 description 1
- KBJVTFWQWXCYCQ-IUKAMOBKSA-N Asp-Thr-Ile Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O KBJVTFWQWXCYCQ-IUKAMOBKSA-N 0.000 description 1
- NAAAPCLFJPURAM-HJGDQZAQSA-N Asp-Thr-Lys Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CC(=O)O)N)O NAAAPCLFJPURAM-HJGDQZAQSA-N 0.000 description 1
- XWKPSMRPIKKDDU-RCOVLWMOSA-N Asp-Val-Gly Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)NCC(O)=O XWKPSMRPIKKDDU-RCOVLWMOSA-N 0.000 description 1
- 102000004506 Blood Proteins Human genes 0.000 description 1
- 108010017384 Blood Proteins Proteins 0.000 description 1
- 241000282832 Camelidae Species 0.000 description 1
- 241000282836 Camelus dromedarius Species 0.000 description 1
- 102000000844 Cell Surface Receptors Human genes 0.000 description 1
- 108010001857 Cell Surface Receptors Proteins 0.000 description 1
- 108091026890 Coding region Proteins 0.000 description 1
- 208000003322 Coinfection Diseases 0.000 description 1
- 102000008186 Collagen Human genes 0.000 description 1
- 108010035532 Collagen Proteins 0.000 description 1
- 102000016550 Complement Factor H Human genes 0.000 description 1
- 108010053085 Complement Factor H Proteins 0.000 description 1
- 206010011224 Cough Diseases 0.000 description 1
- CMYVIUWVYHOLRD-ZLUOBGJFSA-N Cys-Ser-Ala Chemical compound [H]N[C@@H](CS)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(O)=O CMYVIUWVYHOLRD-ZLUOBGJFSA-N 0.000 description 1
- 108090000695 Cytokines Proteins 0.000 description 1
- 102000004127 Cytokines Human genes 0.000 description 1
- 102000053602 DNA Human genes 0.000 description 1
- 102000012410 DNA Ligases Human genes 0.000 description 1
- 108010061982 DNA Ligases Proteins 0.000 description 1
- 239000003155 DNA primer Substances 0.000 description 1
- 238000001712 DNA sequencing Methods 0.000 description 1
- 208000004145 Endometritis Diseases 0.000 description 1
- 241000283074 Equus asinus Species 0.000 description 1
- 241001331845 Equus asinus x caballus Species 0.000 description 1
- 241001670226 Equus caballus x asinus Species 0.000 description 1
- 206010015548 Euthanasia Diseases 0.000 description 1
- 102000009123 Fibrin Human genes 0.000 description 1
- 108010073385 Fibrin Proteins 0.000 description 1
- BWGVNKXGVNDBDI-UHFFFAOYSA-N Fibrin monomer Chemical compound CNC(=O)CNC(=O)CN BWGVNKXGVNDBDI-UHFFFAOYSA-N 0.000 description 1
- 101710128530 Fibrinogen-binding protein Proteins 0.000 description 1
- 238000000729 Fisher's exact test Methods 0.000 description 1
- 229930182566 Gentamicin Natural products 0.000 description 1
- CEAZRRDELHUEMR-URQXQFDESA-N Gentamicin Chemical compound O1[C@H](C(C)NC)CC[C@@H](N)[C@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](NC)[C@@](C)(O)CO2)O)[C@H](N)C[C@@H]1N CEAZRRDELHUEMR-URQXQFDESA-N 0.000 description 1
- HHWQMFIGMMOVFK-WDSKDSINSA-N Gln-Ala-Gly Chemical compound OC(=O)CNC(=O)[C@H](C)NC(=O)[C@@H](N)CCC(N)=O HHWQMFIGMMOVFK-WDSKDSINSA-N 0.000 description 1
- PGPJSRSLQNXBDT-YUMQZZPRSA-N Gln-Arg-Gly Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(O)=O PGPJSRSLQNXBDT-YUMQZZPRSA-N 0.000 description 1
- CLPQUWHBWXFJOX-BQBZGAKWSA-N Gln-Gly-Gln Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(O)=O CLPQUWHBWXFJOX-BQBZGAKWSA-N 0.000 description 1
- XSBGUANSZDGULP-IUCAKERBSA-N Gln-Gly-Lys Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)NCC(=O)N[C@@H](CCCCN)C(O)=O XSBGUANSZDGULP-IUCAKERBSA-N 0.000 description 1
- IHSGESFHTMFHRB-GUBZILKMSA-N Gln-Lys-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)CCC(N)=O IHSGESFHTMFHRB-GUBZILKMSA-N 0.000 description 1
- FNAJNWPDTIXYJN-CIUDSAMLSA-N Gln-Pro-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)CCC(N)=O FNAJNWPDTIXYJN-CIUDSAMLSA-N 0.000 description 1
- LGWNISYVKDNJRP-FXQIFTODSA-N Gln-Ser-Gln Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(O)=O LGWNISYVKDNJRP-FXQIFTODSA-N 0.000 description 1
- JILRMFFFCHUUTJ-ACZMJKKPSA-N Gln-Ser-Ser Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(O)=O JILRMFFFCHUUTJ-ACZMJKKPSA-N 0.000 description 1
- ININBLZFFVOQIO-JHEQGTHGSA-N Gln-Thr-Gly Chemical compound C[C@H]([C@@H](C(=O)NCC(=O)O)NC(=O)[C@H](CCC(=O)N)N)O ININBLZFFVOQIO-JHEQGTHGSA-N 0.000 description 1
- FITIQFSXXBKFFM-NRPADANISA-N Gln-Val-Ser Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CO)C(O)=O FITIQFSXXBKFFM-NRPADANISA-N 0.000 description 1
- RUFHOVYUYSNDNY-ACZMJKKPSA-N Glu-Ala-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](N)CCC(O)=O RUFHOVYUYSNDNY-ACZMJKKPSA-N 0.000 description 1
- KBKGRMNVKPSQIF-XDTLVQLUSA-N Glu-Ala-Tyr Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O KBKGRMNVKPSQIF-XDTLVQLUSA-N 0.000 description 1
- NLKVNZUFDPWPNL-YUMQZZPRSA-N Glu-Arg-Gly Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(O)=O NLKVNZUFDPWPNL-YUMQZZPRSA-N 0.000 description 1
- SRZLHYPAOXBBSB-HJGDQZAQSA-N Glu-Arg-Thr Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(O)=O SRZLHYPAOXBBSB-HJGDQZAQSA-N 0.000 description 1
- TUTIHHSZKFBMHM-WHFBIAKZSA-N Glu-Asn Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CC(N)=O)C(O)=O TUTIHHSZKFBMHM-WHFBIAKZSA-N 0.000 description 1
- JPHYJQHPILOKHC-ACZMJKKPSA-N Glu-Asp-Asp Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(O)=O)C(O)=O JPHYJQHPILOKHC-ACZMJKKPSA-N 0.000 description 1
- JVSBYEDSSRZQGV-GUBZILKMSA-N Glu-Asp-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](N)CCC(O)=O JVSBYEDSSRZQGV-GUBZILKMSA-N 0.000 description 1
- PXHABOCPJVTGEK-BQBZGAKWSA-N Glu-Gln-Gly Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)NCC(O)=O PXHABOCPJVTGEK-BQBZGAKWSA-N 0.000 description 1
- FBEJIDRSQCGFJI-GUBZILKMSA-N Glu-Leu-Ser Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(O)=O FBEJIDRSQCGFJI-GUBZILKMSA-N 0.000 description 1
- OQXDUSZKISQQSS-GUBZILKMSA-N Glu-Lys-Ala Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(O)=O OQXDUSZKISQQSS-GUBZILKMSA-N 0.000 description 1
- PMSMKNYRZCKVMC-DRZSPHRISA-N Glu-Phe-Ala Chemical compound C[C@@H](C(=O)O)NC(=O)[C@H](CC1=CC=CC=C1)NC(=O)[C@H](CCC(=O)O)N PMSMKNYRZCKVMC-DRZSPHRISA-N 0.000 description 1
- RXESHTOTINOODU-JYJNAYRXSA-N Glu-Phe-His Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CC2=CN=CN2)C(=O)O)NC(=O)[C@H](CCC(=O)O)N RXESHTOTINOODU-JYJNAYRXSA-N 0.000 description 1
- MIWJDJAMMKHUAR-ZVZYQTTQSA-N Glu-Trp-Val Chemical compound CC(C)[C@@H](C(=O)O)NC(=O)[C@H](CC1=CNC2=CC=CC=C21)NC(=O)[C@H](CCC(=O)O)N MIWJDJAMMKHUAR-ZVZYQTTQSA-N 0.000 description 1
- BKMOHWJHXQLFEX-IRIUXVKKSA-N Glu-Tyr-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](CC1=CC=C(C=C1)O)NC(=O)[C@H](CCC(=O)O)N)O BKMOHWJHXQLFEX-IRIUXVKKSA-N 0.000 description 1
- KIEICAOUSNYOLM-NRPADANISA-N Glu-Val-Ala Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C)C(O)=O KIEICAOUSNYOLM-NRPADANISA-N 0.000 description 1
- WGYHAAXZWPEBDQ-IFFSRLJSSA-N Glu-Val-Thr Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O WGYHAAXZWPEBDQ-IFFSRLJSSA-N 0.000 description 1
- QSDKBRMVXSWAQE-BFHQHQDPSA-N Gly-Ala-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)CN QSDKBRMVXSWAQE-BFHQHQDPSA-N 0.000 description 1
- DWUKOTKSTDWGAE-BQBZGAKWSA-N Gly-Asn-Arg Chemical compound NCC(=O)N[C@@H](CC(N)=O)C(=O)N[C@H](C(O)=O)CCCN=C(N)N DWUKOTKSTDWGAE-BQBZGAKWSA-N 0.000 description 1
- GRIRDMVMJJDZKV-RCOVLWMOSA-N Gly-Asn-Val Chemical compound [H]NCC(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C(C)C)C(O)=O GRIRDMVMJJDZKV-RCOVLWMOSA-N 0.000 description 1
- MHHUEAIBJZWDBH-YUMQZZPRSA-N Gly-Asp-Lys Chemical compound C(CCN)C[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)CN MHHUEAIBJZWDBH-YUMQZZPRSA-N 0.000 description 1
- TZOVVRJYUDETQG-RCOVLWMOSA-N Gly-Asp-Val Chemical compound CC(C)[C@@H](C(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)CN TZOVVRJYUDETQG-RCOVLWMOSA-N 0.000 description 1
- CQZDZKRHFWJXDF-WDSKDSINSA-N Gly-Gln-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)CN CQZDZKRHFWJXDF-WDSKDSINSA-N 0.000 description 1
- KTSZUNRRYXPZTK-BQBZGAKWSA-N Gly-Gln-Glu Chemical compound NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O KTSZUNRRYXPZTK-BQBZGAKWSA-N 0.000 description 1
- AQLHORCVPGXDJW-IUCAKERBSA-N Gly-Gln-Lys Chemical compound C(CCN)C[C@@H](C(=O)O)NC(=O)[C@H](CCC(=O)N)NC(=O)CN AQLHORCVPGXDJW-IUCAKERBSA-N 0.000 description 1
- NPSWCZIRBAYNSB-JHEQGTHGSA-N Gly-Gln-Thr Chemical compound [H]NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O NPSWCZIRBAYNSB-JHEQGTHGSA-N 0.000 description 1
- MOJKRXIRAZPZLW-WDSKDSINSA-N Gly-Glu-Ala Chemical compound [H]NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(O)=O MOJKRXIRAZPZLW-WDSKDSINSA-N 0.000 description 1
- DHDOADIPGZTAHT-YUMQZZPRSA-N Gly-Glu-Arg Chemical compound NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@H](C(O)=O)CCCN=C(N)N DHDOADIPGZTAHT-YUMQZZPRSA-N 0.000 description 1
- HFXJIZNEXNIZIJ-BQBZGAKWSA-N Gly-Glu-Gln Chemical compound NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(N)=O)C(O)=O HFXJIZNEXNIZIJ-BQBZGAKWSA-N 0.000 description 1
- LHRXAHLCRMQBGJ-RYUDHWBXSA-N Gly-Glu-Phe Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)CN LHRXAHLCRMQBGJ-RYUDHWBXSA-N 0.000 description 1
- OLPPXYMMIARYAL-QMMMGPOBSA-N Gly-Gly-Val Chemical compound CC(C)[C@@H](C(O)=O)NC(=O)CNC(=O)CN OLPPXYMMIARYAL-QMMMGPOBSA-N 0.000 description 1
- CLNSYANKYVMZNM-UWVGGRQHSA-N Gly-Lys-Arg Chemical compound NCCCC[C@H](NC(=O)CN)C(=O)N[C@H](C(O)=O)CCCN=C(N)N CLNSYANKYVMZNM-UWVGGRQHSA-N 0.000 description 1
- FHQRLHFYVZAQHU-IUCAKERBSA-N Gly-Lys-Gln Chemical compound [H]NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(O)=O FHQRLHFYVZAQHU-IUCAKERBSA-N 0.000 description 1
- YKJUITHASJAGHO-HOTGVXAUSA-N Gly-Lys-Trp Chemical compound C1=CC=C2C(=C1)C(=CN2)C[C@@H](C(=O)O)NC(=O)[C@H](CCCCN)NC(=O)CN YKJUITHASJAGHO-HOTGVXAUSA-N 0.000 description 1
- MTBIKIMYHUWBRX-QWRGUYRKSA-N Gly-Phe-Asn Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)O)NC(=O)CN MTBIKIMYHUWBRX-QWRGUYRKSA-N 0.000 description 1
- WNZOCXUOGVYYBJ-CDMKHQONSA-N Gly-Phe-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](CC1=CC=CC=C1)NC(=O)CN)O WNZOCXUOGVYYBJ-CDMKHQONSA-N 0.000 description 1
- GGLIDLCEPDHEJO-BQBZGAKWSA-N Gly-Pro-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@@H]1CCCN1C(=O)CN GGLIDLCEPDHEJO-BQBZGAKWSA-N 0.000 description 1
- CAVKXZMMDNOZJU-UHFFFAOYSA-N Gly-Pro-Ala-Gly-Pro Natural products C1CCC(C(O)=O)N1C(=O)CNC(=O)C(C)NC(=O)C1CCCN1C(=O)CN CAVKXZMMDNOZJU-UHFFFAOYSA-N 0.000 description 1
- JYPCXBJRLBHWME-IUCAKERBSA-N Gly-Pro-Arg Chemical compound NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(O)=O JYPCXBJRLBHWME-IUCAKERBSA-N 0.000 description 1
- GAAHQHNCMIAYEX-UWVGGRQHSA-N Gly-Pro-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)CN GAAHQHNCMIAYEX-UWVGGRQHSA-N 0.000 description 1
- FFALDIDGPLUDKV-ZDLURKLDSA-N Gly-Thr-Ser Chemical compound [H]NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(O)=O FFALDIDGPLUDKV-ZDLURKLDSA-N 0.000 description 1
- NWOSHVVPKDQKKT-RYUDHWBXSA-N Gly-Tyr-Gln Chemical compound [H]NCC(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCC(N)=O)C(O)=O NWOSHVVPKDQKKT-RYUDHWBXSA-N 0.000 description 1
- 102000003886 Glycoproteins Human genes 0.000 description 1
- 108090000288 Glycoproteins Proteins 0.000 description 1
- JBCLFWXMTIKCCB-UHFFFAOYSA-N H-Gly-Phe-OH Natural products NCC(=O)NC(C(O)=O)CC1=CC=CC=C1 JBCLFWXMTIKCCB-UHFFFAOYSA-N 0.000 description 1
- HTTJABKRGRZYRN-UHFFFAOYSA-N Heparin Chemical compound OC1C(NC(=O)C)C(O)OC(COS(O)(=O)=O)C1OC1C(OS(O)(=O)=O)C(O)C(OC2C(C(OS(O)(=O)=O)C(OC3C(C(O)C(O)C(O3)C(O)=O)OS(O)(=O)=O)C(CO)O2)NS(O)(=O)=O)C(C(O)=O)O1 HTTJABKRGRZYRN-UHFFFAOYSA-N 0.000 description 1
- HDOYNXLPTRQLAD-JBDRJPRFSA-N Ile-Ala-Ser Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)O)N HDOYNXLPTRQLAD-JBDRJPRFSA-N 0.000 description 1
- HERITAGIPLEJMT-GVARAGBVSA-N Ile-Ala-Tyr Chemical compound CC[C@H](C)[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 HERITAGIPLEJMT-GVARAGBVSA-N 0.000 description 1
- QADCTXFNLZBZAB-GHCJXIJMSA-N Ile-Asn-Ala Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](C)C(=O)O)N QADCTXFNLZBZAB-GHCJXIJMSA-N 0.000 description 1
- IIXDMJNYALIKGP-DJFWLOJKSA-N Ile-Asn-His Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)N IIXDMJNYALIKGP-DJFWLOJKSA-N 0.000 description 1
- QSPLUJGYOPZINY-ZPFDUUQYSA-N Ile-Asp-Lys Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CCCCN)C(=O)O)N QSPLUJGYOPZINY-ZPFDUUQYSA-N 0.000 description 1
- HOLOYAZCIHDQNS-YVNDNENWSA-N Ile-Gln-Glu Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CCC(=O)O)C(=O)O)N HOLOYAZCIHDQNS-YVNDNENWSA-N 0.000 description 1
- OVPYIUNCVSOVNF-ZPFDUUQYSA-N Ile-Gln-Pro Natural products CC[C@H](C)[C@H](N)C(=O)N[C@@H](CCC(N)=O)C(=O)N1CCC[C@H]1C(O)=O OVPYIUNCVSOVNF-ZPFDUUQYSA-N 0.000 description 1
- PHIXPNQDGGILMP-YVNDNENWSA-N Ile-Glu-Glu Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCC(=O)O)C(=O)O)N PHIXPNQDGGILMP-YVNDNENWSA-N 0.000 description 1
- PNDMHTTXXPUQJH-RWRJDSDZSA-N Ile-Glu-Thr Chemical compound N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H]([C@H](O)C)C(=O)O PNDMHTTXXPUQJH-RWRJDSDZSA-N 0.000 description 1
- KCTIFOCXAIUQQK-QXEWZRGKSA-N Ile-Pro-Gly Chemical compound CC[C@H](C)[C@H](N)C(=O)N1CCC[C@H]1C(=O)NCC(O)=O KCTIFOCXAIUQQK-QXEWZRGKSA-N 0.000 description 1
- HXIDVIFHRYRXLZ-NAKRPEOUSA-N Ile-Ser-Val Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(=O)O)N HXIDVIFHRYRXLZ-NAKRPEOUSA-N 0.000 description 1
- SAEWJTCJQVZQNZ-IUKAMOBKSA-N Ile-Thr-Asn Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(=O)N)C(=O)O)N SAEWJTCJQVZQNZ-IUKAMOBKSA-N 0.000 description 1
- YCKPUHHMCFSUMD-IUKAMOBKSA-N Ile-Thr-Asp Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(=O)O)C(=O)O)N YCKPUHHMCFSUMD-IUKAMOBKSA-N 0.000 description 1
- HJDZMPFEXINXLO-QPHKQPEJSA-N Ile-Thr-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)O)N HJDZMPFEXINXLO-QPHKQPEJSA-N 0.000 description 1
- DGTOKVBDZXJHNZ-WZLNRYEVSA-N Ile-Thr-Tyr Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)O)N DGTOKVBDZXJHNZ-WZLNRYEVSA-N 0.000 description 1
- QHUREMVLLMNUAX-OSUNSFLBSA-N Ile-Thr-Val Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)O)N QHUREMVLLMNUAX-OSUNSFLBSA-N 0.000 description 1
- BZUOLKFQVVBTJY-SLBDDTMCSA-N Ile-Trp-Asn Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC1=CNC2=CC=CC=C21)C(=O)N[C@@H](CC(=O)N)C(=O)O)N BZUOLKFQVVBTJY-SLBDDTMCSA-N 0.000 description 1
- OMDWJWGZGMCQND-CFMVVWHZSA-N Ile-Tyr-Asp Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)N[C@@H](CC(=O)O)C(=O)O)N OMDWJWGZGMCQND-CFMVVWHZSA-N 0.000 description 1
- 206010022095 Injection Site reaction Diseases 0.000 description 1
- 108010074328 Interferon-gamma Proteins 0.000 description 1
- 108090000174 Interleukin-10 Proteins 0.000 description 1
- 108010002350 Interleukin-2 Proteins 0.000 description 1
- 108090000978 Interleukin-4 Proteins 0.000 description 1
- PWWVAXIEGOYWEE-UHFFFAOYSA-N Isophenergan Chemical compound C1=CC=C2N(CC(C)N(C)C)C3=CC=CC=C3SC2=C1 PWWVAXIEGOYWEE-UHFFFAOYSA-N 0.000 description 1
- 239000007836 KH2PO4 Substances 0.000 description 1
- UGTHTQWIQKEDEH-BQBZGAKWSA-N L-alanyl-L-prolylglycine zwitterion Chemical compound C[C@H](N)C(=O)N1CCC[C@H]1C(=O)NCC(O)=O UGTHTQWIQKEDEH-BQBZGAKWSA-N 0.000 description 1
- RNKSNIBMTUYWSH-YFKPBYRVSA-N L-prolylglycine Chemical compound [O-]C(=O)CNC(=O)[C@@H]1CCC[NH2+]1 RNKSNIBMTUYWSH-YFKPBYRVSA-N 0.000 description 1
- TYYLDKGBCJGJGW-UHFFFAOYSA-N L-tryptophan-L-tyrosine Natural products C=1NC2=CC=CC=C2C=1CC(N)C(=O)NC(C(O)=O)CC1=CC=C(O)C=C1 TYYLDKGBCJGJGW-UHFFFAOYSA-N 0.000 description 1
- CZCSUZMIRKFFFA-CIUDSAMLSA-N Leu-Ala-Asn Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(N)=O)C(O)=O CZCSUZMIRKFFFA-CIUDSAMLSA-N 0.000 description 1
- BQSLGJHIAGOZCD-CIUDSAMLSA-N Leu-Ala-Ser Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(O)=O BQSLGJHIAGOZCD-CIUDSAMLSA-N 0.000 description 1
- OXKYZSRZKBTVEY-ZPFDUUQYSA-N Leu-Asn-Ile Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O OXKYZSRZKBTVEY-ZPFDUUQYSA-N 0.000 description 1
- WGNOPSQMIQERPK-UHFFFAOYSA-N Leu-Asn-Pro Natural products CC(C)CC(N)C(=O)NC(CC(=O)N)C(=O)N1CCCC1C(=O)O WGNOPSQMIQERPK-UHFFFAOYSA-N 0.000 description 1
- PJYSOYLLTJKZHC-GUBZILKMSA-N Leu-Asp-Gln Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@H](C(O)=O)CCC(N)=O PJYSOYLLTJKZHC-GUBZILKMSA-N 0.000 description 1
- XVSJMWYYLHPDKY-DCAQKATOSA-N Leu-Asp-Met Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCSC)C(O)=O XVSJMWYYLHPDKY-DCAQKATOSA-N 0.000 description 1
- OXRLYTYUXAQTHP-YUMQZZPRSA-N Leu-Gly-Ala Chemical compound [H]N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](C)C(O)=O OXRLYTYUXAQTHP-YUMQZZPRSA-N 0.000 description 1
- VWHGTYCRDRBSFI-ZETCQYMHSA-N Leu-Gly-Gly Chemical compound CC(C)C[C@H](N)C(=O)NCC(=O)NCC(O)=O VWHGTYCRDRBSFI-ZETCQYMHSA-N 0.000 description 1
- USLNHQZCDQJBOV-ZPFDUUQYSA-N Leu-Ile-Asn Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(N)=O)C(O)=O USLNHQZCDQJBOV-ZPFDUUQYSA-N 0.000 description 1
- LXKNSJLSGPNHSK-KKUMJFAQSA-N Leu-Leu-Lys Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)O)N LXKNSJLSGPNHSK-KKUMJFAQSA-N 0.000 description 1
- LZHJZLHSRGWBBE-IHRRRGAJSA-N Leu-Lys-Val Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(O)=O LZHJZLHSRGWBBE-IHRRRGAJSA-N 0.000 description 1
- YRRCOJOXAJNSAX-IHRRRGAJSA-N Leu-Pro-Lys Chemical compound CC(C)C[C@@H](C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)O)N YRRCOJOXAJNSAX-IHRRRGAJSA-N 0.000 description 1
- ZJZNLRVCZWUONM-JXUBOQSCSA-N Leu-Thr-Ala Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C)C(O)=O ZJZNLRVCZWUONM-JXUBOQSCSA-N 0.000 description 1
- QWWPYKKLXWOITQ-VOAKCMCISA-N Leu-Thr-Leu Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@H](C(O)=O)CC(C)C QWWPYKKLXWOITQ-VOAKCMCISA-N 0.000 description 1
- ILDSIMPXNFWKLH-KATARQTJSA-N Leu-Thr-Ser Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(O)=O ILDSIMPXNFWKLH-KATARQTJSA-N 0.000 description 1
- RIHIGSWBLHSGLV-CQDKDKBSSA-N Leu-Tyr-Ala Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](C)C(O)=O RIHIGSWBLHSGLV-CQDKDKBSSA-N 0.000 description 1
- FBNPMTNBFFAMMH-AVGNSLFASA-N Leu-Val-Arg Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@H](C(O)=O)CCCN=C(N)N FBNPMTNBFFAMMH-AVGNSLFASA-N 0.000 description 1
- FBNPMTNBFFAMMH-UHFFFAOYSA-N Leu-Val-Arg Natural products CC(C)CC(N)C(=O)NC(C(C)C)C(=O)NC(C(O)=O)CCCN=C(N)N FBNPMTNBFFAMMH-UHFFFAOYSA-N 0.000 description 1
- 239000006137 Luria-Bertani broth Substances 0.000 description 1
- MPGHETGWWWUHPY-CIUDSAMLSA-N Lys-Ala-Asp Chemical compound OC(=O)C[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CCCCN MPGHETGWWWUHPY-CIUDSAMLSA-N 0.000 description 1
- XFIHDSBIPWEYJJ-YUMQZZPRSA-N Lys-Ala-Gly Chemical compound OC(=O)CNC(=O)[C@H](C)NC(=O)[C@@H](N)CCCCN XFIHDSBIPWEYJJ-YUMQZZPRSA-N 0.000 description 1
- FUKDBQGFSJUXGX-RWMBFGLXSA-N Lys-Arg-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CCCCN)N)C(=O)O FUKDBQGFSJUXGX-RWMBFGLXSA-N 0.000 description 1
- NDORZBUHCOJQDO-GVXVVHGQSA-N Lys-Gln-Val Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C(C)C)C(O)=O NDORZBUHCOJQDO-GVXVVHGQSA-N 0.000 description 1
- LPAJOCKCPRZEAG-MNXVOIDGSA-N Lys-Glu-Ile Chemical compound CC[C@H](C)[C@@H](C(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](N)CCCCN LPAJOCKCPRZEAG-MNXVOIDGSA-N 0.000 description 1
- ULUQBUKAPDUKOC-GVXVVHGQSA-N Lys-Glu-Val Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(O)=O ULUQBUKAPDUKOC-GVXVVHGQSA-N 0.000 description 1
- NKKFVJRLCCUJNA-QWRGUYRKSA-N Lys-Gly-Lys Chemical compound NCCCC[C@H](N)C(=O)NCC(=O)N[C@H](C(O)=O)CCCCN NKKFVJRLCCUJNA-QWRGUYRKSA-N 0.000 description 1
- GFWLIJDQILOEPP-HSCHXYMDSA-N Lys-Ile-Trp Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC1=CNC2=CC=CC=C21)C(=O)O)NC(=O)[C@H](CCCCN)N GFWLIJDQILOEPP-HSCHXYMDSA-N 0.000 description 1
- MUXNCRWTWBMNHX-SRVKXCTJSA-N Lys-Leu-Asp Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(O)=O MUXNCRWTWBMNHX-SRVKXCTJSA-N 0.000 description 1
- GAHJXEMYXKLZRQ-AJNGGQMLSA-N Lys-Lys-Ile Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O GAHJXEMYXKLZRQ-AJNGGQMLSA-N 0.000 description 1
- CNGOEHJCLVCJHN-SRVKXCTJSA-N Lys-Pro-Glu Chemical compound NCCCC[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(O)=O CNGOEHJCLVCJHN-SRVKXCTJSA-N 0.000 description 1
- JHNOXVASMSXSNB-WEDXCCLWSA-N Lys-Thr-Gly Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(O)=O JHNOXVASMSXSNB-WEDXCCLWSA-N 0.000 description 1
- RMKJOQSYLQQRFN-KKUMJFAQSA-N Lys-Tyr-Asp Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(O)=O)C(O)=O RMKJOQSYLQQRFN-KKUMJFAQSA-N 0.000 description 1
- RQILLQOQXLZTCK-KBPBESRZSA-N Lys-Tyr-Gly Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)NCC(O)=O RQILLQOQXLZTCK-KBPBESRZSA-N 0.000 description 1
- MDDUIRLQCYVRDO-NHCYSSNCSA-N Lys-Val-Asn Chemical compound NC(=O)C[C@@H](C(O)=O)NC(=O)[C@H](C(C)C)NC(=O)[C@@H](N)CCCCN MDDUIRLQCYVRDO-NHCYSSNCSA-N 0.000 description 1
- UGCIQUYEJIEHKX-GVXVVHGQSA-N Lys-Val-Glu Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(O)=O)C(O)=O UGCIQUYEJIEHKX-GVXVVHGQSA-N 0.000 description 1
- RPWQJSBMXJSCPD-XUXIUFHCSA-N Lys-Val-Ile Chemical compound CC[C@H](C)[C@H](NC(=O)[C@@H](NC(=O)[C@@H](N)CCCCN)C(C)C)C(O)=O RPWQJSBMXJSCPD-XUXIUFHCSA-N 0.000 description 1
- XBAJINCXDBTJRH-WDSOQIARSA-N Lys-Val-Trp Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CC1=CNC2=CC=CC=C21)C(=O)O)NC(=O)[C@H](CCCCN)N XBAJINCXDBTJRH-WDSOQIARSA-N 0.000 description 1
- HUKLXYYPZWPXCC-KZVJFYERSA-N Met-Ala-Thr Chemical compound CSCC[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O HUKLXYYPZWPXCC-KZVJFYERSA-N 0.000 description 1
- OBCRZLRPJFNLAN-DCAQKATOSA-N Met-His-Asp Chemical compound [H]N[C@@H](CCSC)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(O)=O)C(O)=O OBCRZLRPJFNLAN-DCAQKATOSA-N 0.000 description 1
- RIIFMEBFDDXGCV-VEVYYDQMSA-N Met-Thr-Asn Chemical compound CSCC[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@H](C(O)=O)CC(N)=O RIIFMEBFDDXGCV-VEVYYDQMSA-N 0.000 description 1
- NDJSSFWDYDUQID-YTWAJWBKSA-N Met-Thr-Pro Chemical compound C[C@H]([C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](CCSC)N)O NDJSSFWDYDUQID-YTWAJWBKSA-N 0.000 description 1
- VYDLZDRMOFYOGV-TUAOUCFPSA-N Met-Val-Pro Chemical compound CC(C)[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](CCSC)N VYDLZDRMOFYOGV-TUAOUCFPSA-N 0.000 description 1
- CERQOIWHTDAKMF-UHFFFAOYSA-N Methacrylic acid Chemical compound CC(=C)C(O)=O CERQOIWHTDAKMF-UHFFFAOYSA-N 0.000 description 1
- 241001092142 Molina Species 0.000 description 1
- SITLTJHOQZFJGG-UHFFFAOYSA-N N-L-alpha-glutamyl-L-valine Natural products CC(C)C(C(O)=O)NC(=O)C(N)CCC(O)=O SITLTJHOQZFJGG-UHFFFAOYSA-N 0.000 description 1
- AJHCSUXXECOXOY-UHFFFAOYSA-N N-glycyl-L-tryptophan Natural products C1=CC=C2C(CC(NC(=O)CN)C(O)=O)=CNC2=C1 AJHCSUXXECOXOY-UHFFFAOYSA-N 0.000 description 1
- 206010028720 Nasal abscess Diseases 0.000 description 1
- 102100023206 Neuromodulin Human genes 0.000 description 1
- 108700026244 Open Reading Frames Proteins 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 229930182555 Penicillin Natural products 0.000 description 1
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 1
- 108091005804 Peptidases Proteins 0.000 description 1
- 206010057249 Phagocytosis Diseases 0.000 description 1
- UEEVBGHEGJMDDV-AVGNSLFASA-N Phe-Asp-Gln Chemical compound NC(=O)CC[C@@H](C(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](N)CC1=CC=CC=C1 UEEVBGHEGJMDDV-AVGNSLFASA-N 0.000 description 1
- METZZBCMDXHFMK-BZSNNMDCSA-N Phe-Leu-His Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)NC(=O)[C@H](CC2=CC=CC=C2)N METZZBCMDXHFMK-BZSNNMDCSA-N 0.000 description 1
- JHSRGEODDALISP-XVSYOHENSA-N Phe-Thr-Asn Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(O)=O JHSRGEODDALISP-XVSYOHENSA-N 0.000 description 1
- BPIMVBKDLSBKIJ-FCLVOEFKSA-N Phe-Thr-Phe Chemical compound C([C@H](N)C(=O)N[C@@H]([C@H](O)C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(O)=O)C1=CC=CC=C1 BPIMVBKDLSBKIJ-FCLVOEFKSA-N 0.000 description 1
- KIQUCMUULDXTAZ-HJOGWXRNSA-N Phe-Tyr-Tyr Chemical compound N[C@@H](Cc1ccccc1)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](Cc1ccc(O)cc1)C(O)=O KIQUCMUULDXTAZ-HJOGWXRNSA-N 0.000 description 1
- 206010035664 Pneumonia Diseases 0.000 description 1
- 239000004743 Polypropylene Substances 0.000 description 1
- CGBYDGAJHSOGFQ-LPEHRKFASA-N Pro-Ala-Pro Chemical compound C[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@@H]2CCCN2 CGBYDGAJHSOGFQ-LPEHRKFASA-N 0.000 description 1
- SMCHPSMKAFIERP-FXQIFTODSA-N Pro-Asn-Asp Chemical compound OC(=O)C[C@@H](C(O)=O)NC(=O)[C@H](CC(=O)N)NC(=O)[C@@H]1CCCN1 SMCHPSMKAFIERP-FXQIFTODSA-N 0.000 description 1
- FUVBEZJCRMHWEM-FXQIFTODSA-N Pro-Asn-Ser Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(O)=O FUVBEZJCRMHWEM-FXQIFTODSA-N 0.000 description 1
- ZPPVJIJMIKTERM-YUMQZZPRSA-N Pro-Gln-Gly Chemical compound OC(=O)CNC(=O)[C@H](CCC(=O)N)NC(=O)[C@@H]1CCCN1 ZPPVJIJMIKTERM-YUMQZZPRSA-N 0.000 description 1
- VPEVBAUSTBWQHN-NHCYSSNCSA-N Pro-Glu-Val Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(O)=O VPEVBAUSTBWQHN-NHCYSSNCSA-N 0.000 description 1
- CLNJSLSHKJECME-BQBZGAKWSA-N Pro-Gly-Ala Chemical compound OC(=O)[C@H](C)NC(=O)CNC(=O)[C@@H]1CCCN1 CLNJSLSHKJECME-BQBZGAKWSA-N 0.000 description 1
- VYWNORHENYEQDW-YUMQZZPRSA-N Pro-Gly-Glu Chemical compound OC(=O)CC[C@@H](C(O)=O)NC(=O)CNC(=O)[C@@H]1CCCN1 VYWNORHENYEQDW-YUMQZZPRSA-N 0.000 description 1
- MHHQQZIFLWFZGR-DCAQKATOSA-N Pro-Lys-Ser Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(O)=O MHHQQZIFLWFZGR-DCAQKATOSA-N 0.000 description 1
- BUEIYHBJHCDAMI-UFYCRDLUSA-N Pro-Phe-Phe Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O BUEIYHBJHCDAMI-UFYCRDLUSA-N 0.000 description 1
- SXJOPONICMGFCR-DCAQKATOSA-N Pro-Ser-Lys Chemical compound C1C[C@H](NC1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)O SXJOPONICMGFCR-DCAQKATOSA-N 0.000 description 1
- RMJZWERKFFNNNS-XGEHTFHBSA-N Pro-Thr-Ser Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(O)=O RMJZWERKFFNNNS-XGEHTFHBSA-N 0.000 description 1
- PGSWNLRYYONGPE-JYJNAYRXSA-N Pro-Val-Tyr Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O PGSWNLRYYONGPE-JYJNAYRXSA-N 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 101710132548 Protein F1 Proteins 0.000 description 1
- 108010076504 Protein Sorting Signals Proteins 0.000 description 1
- 235000009001 Quillaja saponaria Nutrition 0.000 description 1
- 241001454523 Quillaja saponaria Species 0.000 description 1
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 description 1
- ZUGXSSFMTXKHJS-ZLUOBGJFSA-N Ser-Ala-Ala Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(O)=O ZUGXSSFMTXKHJS-ZLUOBGJFSA-N 0.000 description 1
- BRKHVZNDAOMAHX-BIIVOSGPSA-N Ser-Ala-Pro Chemical compound C[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](CO)N BRKHVZNDAOMAHX-BIIVOSGPSA-N 0.000 description 1
- WXWDPFVKQRVJBJ-CIUDSAMLSA-N Ser-Asn-His Chemical compound C1=C(NC=N1)C[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)N)NC(=O)[C@H](CO)N WXWDPFVKQRVJBJ-CIUDSAMLSA-N 0.000 description 1
- CXBFHZLODKPIJY-AAEUAGOBSA-N Ser-Gly-Trp Chemical compound C1=CC=C2C(=C1)C(=CN2)C[C@@H](C(=O)O)NC(=O)CNC(=O)[C@H](CO)N CXBFHZLODKPIJY-AAEUAGOBSA-N 0.000 description 1
- OQPNSDWGAMFJNU-QWRGUYRKSA-N Ser-Gly-Tyr Chemical compound OC[C@H](N)C(=O)NCC(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 OQPNSDWGAMFJNU-QWRGUYRKSA-N 0.000 description 1
- XXXAXOWMBOKTRN-XPUUQOCRSA-N Ser-Gly-Val Chemical compound [H]N[C@@H](CO)C(=O)NCC(=O)N[C@@H](C(C)C)C(O)=O XXXAXOWMBOKTRN-XPUUQOCRSA-N 0.000 description 1
- ZOPISOXXPQNOCO-SVSWQMSJSA-N Ser-Ile-Thr Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H]([C@@H](C)O)C(=O)O)NC(=O)[C@H](CO)N ZOPISOXXPQNOCO-SVSWQMSJSA-N 0.000 description 1
- UGTZYIPOBYXWRW-SRVKXCTJSA-N Ser-Phe-Asp Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC(O)=O)C(O)=O UGTZYIPOBYXWRW-SRVKXCTJSA-N 0.000 description 1
- FBLNYDYPCLFTSP-IXOXFDKPSA-N Ser-Phe-Thr Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(O)=O FBLNYDYPCLFTSP-IXOXFDKPSA-N 0.000 description 1
- BMKNXTJLHFIAAH-CIUDSAMLSA-N Ser-Ser-Leu Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(O)=O BMKNXTJLHFIAAH-CIUDSAMLSA-N 0.000 description 1
- FZNNGIHSIPKFRE-QEJZJMRPSA-N Ser-Trp-Gln Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CCC(N)=O)C(O)=O FZNNGIHSIPKFRE-QEJZJMRPSA-N 0.000 description 1
- VVKVHAOOUGNDPJ-SRVKXCTJSA-N Ser-Tyr-Ser Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CO)C(O)=O VVKVHAOOUGNDPJ-SRVKXCTJSA-N 0.000 description 1
- 241000494362 Streptococcus equi subsp. equi 4047 Species 0.000 description 1
- 241001367772 Streptococcus pyogenes JRS4 Species 0.000 description 1
- 241000873260 Streptococcus pyogenes serotype M1 Species 0.000 description 1
- 241001468181 Streptococcus sp. 'group C' Species 0.000 description 1
- 230000029662 T-helper 1 type immune response Effects 0.000 description 1
- 210000001744 T-lymphocyte Anatomy 0.000 description 1
- 239000004098 Tetracycline Substances 0.000 description 1
- FQPQPTHMHZKGFM-XQXXSGGOSA-N Thr-Ala-Glu Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(O)=O FQPQPTHMHZKGFM-XQXXSGGOSA-N 0.000 description 1
- CAJFZCICSVBOJK-SHGPDSBTSA-N Thr-Ala-Thr Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O CAJFZCICSVBOJK-SHGPDSBTSA-N 0.000 description 1
- UKBSDLHIKIXJKH-HJGDQZAQSA-N Thr-Arg-Glu Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(O)=O UKBSDLHIKIXJKH-HJGDQZAQSA-N 0.000 description 1
- GNHRVXYZKWSJTF-HJGDQZAQSA-N Thr-Asp-Lys Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CCCCN)C(=O)O)N)O GNHRVXYZKWSJTF-HJGDQZAQSA-N 0.000 description 1
- FHDLKMFZKRUQCE-HJGDQZAQSA-N Thr-Glu-Arg Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O FHDLKMFZKRUQCE-HJGDQZAQSA-N 0.000 description 1
- SLUWOCTZVGMURC-BFHQHQDPSA-N Thr-Gly-Ala Chemical compound C[C@@H](O)[C@H](N)C(=O)NCC(=O)N[C@@H](C)C(O)=O SLUWOCTZVGMURC-BFHQHQDPSA-N 0.000 description 1
- AQAMPXBRJJWPNI-JHEQGTHGSA-N Thr-Gly-Glu Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(O)=O AQAMPXBRJJWPNI-JHEQGTHGSA-N 0.000 description 1
- BVOVIGCHYNFJBZ-JXUBOQSCSA-N Thr-Leu-Ala Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(O)=O BVOVIGCHYNFJBZ-JXUBOQSCSA-N 0.000 description 1
- VTVVYQOXJCZVEB-WDCWCFNPSA-N Thr-Leu-Glu Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(O)=O VTVVYQOXJCZVEB-WDCWCFNPSA-N 0.000 description 1
- SGAOHNPSEPVAFP-ZDLURKLDSA-N Thr-Ser-Gly Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(=O)NCC(O)=O SGAOHNPSEPVAFP-ZDLURKLDSA-N 0.000 description 1
- AHERARIZBPOMNU-KATARQTJSA-N Thr-Ser-Leu Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(O)=O AHERARIZBPOMNU-KATARQTJSA-N 0.000 description 1
- QJIODPFLAASXJC-JHYOHUSXSA-N Thr-Thr-Phe Chemical compound C[C@H]([C@@H](C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)O)N)O QJIODPFLAASXJC-JHYOHUSXSA-N 0.000 description 1
- KHTIUAKJRUIEMA-HOUAVDHOSA-N Thr-Trp-Asp Chemical compound C1=CC=C2C(C[C@H](NC(=O)[C@@H](N)[C@H](O)C)C(=O)N[C@@H](CC(O)=O)C(O)=O)=CNC2=C1 KHTIUAKJRUIEMA-HOUAVDHOSA-N 0.000 description 1
- CYCGARJWIQWPQM-YJRXYDGGSA-N Thr-Tyr-Ser Chemical compound C[C@@H](O)[C@H]([NH3+])C(=O)N[C@H](C(=O)N[C@@H](CO)C([O-])=O)CC1=CC=C(O)C=C1 CYCGARJWIQWPQM-YJRXYDGGSA-N 0.000 description 1
- LVRFMARKDGGZMX-IZPVPAKOSA-N Thr-Tyr-Thr Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@H](C(=O)N[C@@H]([C@@H](C)O)C(O)=O)CC1=CC=C(O)C=C1 LVRFMARKDGGZMX-IZPVPAKOSA-N 0.000 description 1
- OGOYMQWIWHGTGH-KZVJFYERSA-N Thr-Val-Ala Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C)C(O)=O OGOYMQWIWHGTGH-KZVJFYERSA-N 0.000 description 1
- XGFYGMKZKFRGAI-RCWTZXSCSA-N Thr-Val-Arg Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@H](C(O)=O)CCCN=C(N)N XGFYGMKZKFRGAI-RCWTZXSCSA-N 0.000 description 1
- BKIOKSLLAAZYTC-KKHAAJSZSA-N Thr-Val-Asn Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(N)=O)C(O)=O BKIOKSLLAAZYTC-KKHAAJSZSA-N 0.000 description 1
- QGVBFDIREUUSHX-IFFSRLJSSA-N Thr-Val-Gln Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(N)=O)C(O)=O QGVBFDIREUUSHX-IFFSRLJSSA-N 0.000 description 1
- PWONLXBUSVIZPH-RHYQMDGZSA-N Thr-Val-Lys Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)O)N)O PWONLXBUSVIZPH-RHYQMDGZSA-N 0.000 description 1
- 229920004890 Triton X-100 Polymers 0.000 description 1
- KWTRGSQOQHZKIA-PMVMPFDFSA-N Trp-Lys-Tyr Chemical compound C([C@H](NC(=O)[C@@H](NC(=O)[C@@H](N)CC=1C2=CC=CC=C2NC=1)CCCCN)C(O)=O)C1=CC=C(O)C=C1 KWTRGSQOQHZKIA-PMVMPFDFSA-N 0.000 description 1
- GAYLGYUVTDMLKC-UWJYBYFXSA-N Tyr-Asp-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 GAYLGYUVTDMLKC-UWJYBYFXSA-N 0.000 description 1
- UXUFNBVCPAWACG-SIUGBPQLSA-N Tyr-Gln-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H](CCC(=O)N)NC(=O)[C@H](CC1=CC=C(C=C1)O)N UXUFNBVCPAWACG-SIUGBPQLSA-N 0.000 description 1
- UNUZEBFXGWVAOP-DZKIICNBSA-N Tyr-Glu-Val Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(O)=O UNUZEBFXGWVAOP-DZKIICNBSA-N 0.000 description 1
- WVGKPKDWYQXWLU-BZSNNMDCSA-N Tyr-His-Lys Chemical compound C1=CC(=CC=C1C[C@@H](C(=O)N[C@@H](CC2=CN=CN2)C(=O)N[C@@H](CCCCN)C(=O)O)N)O WVGKPKDWYQXWLU-BZSNNMDCSA-N 0.000 description 1
- AXWBYOVVDRBOGU-SIUGBPQLSA-N Tyr-Ile-Gln Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)O)NC(=O)[C@H](CC1=CC=C(C=C1)O)N AXWBYOVVDRBOGU-SIUGBPQLSA-N 0.000 description 1
- FMXFHNSFABRVFZ-BZSNNMDCSA-N Tyr-Lys-Leu Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(O)=O FMXFHNSFABRVFZ-BZSNNMDCSA-N 0.000 description 1
- QKXAEWMHAAVVGS-KKUMJFAQSA-N Tyr-Pro-Glu Chemical compound N[C@@H](Cc1ccc(O)cc1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(O)=O QKXAEWMHAAVVGS-KKUMJFAQSA-N 0.000 description 1
- 208000006374 Uterine Cervicitis Diseases 0.000 description 1
- JFAWZADYPRMRCO-UBHSHLNASA-N Val-Ala-Phe Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 JFAWZADYPRMRCO-UBHSHLNASA-N 0.000 description 1
- SLLKXDSRVAOREO-KZVJFYERSA-N Val-Ala-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](C)NC(=O)[C@H](C(C)C)N)O SLLKXDSRVAOREO-KZVJFYERSA-N 0.000 description 1
- UUYCNAXCCDNULB-QXEWZRGKSA-N Val-Arg-Asn Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CC(N)=O)C(O)=O UUYCNAXCCDNULB-QXEWZRGKSA-N 0.000 description 1
- VVZDBPBZHLQPPB-XVKPBYJWSA-N Val-Glu-Gly Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(O)=O VVZDBPBZHLQPPB-XVKPBYJWSA-N 0.000 description 1
- YTPLVNUZZOBFFC-SCZZXKLOSA-N Val-Gly-Pro Chemical compound CC(C)[C@H](N)C(=O)NCC(=O)N1CCC[C@@H]1C(O)=O YTPLVNUZZOBFFC-SCZZXKLOSA-N 0.000 description 1
- BVWPHWLFGRCECJ-JSGCOSHPSA-N Val-Gly-Tyr Chemical compound CC(C)[C@@H](C(=O)NCC(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)O)N BVWPHWLFGRCECJ-JSGCOSHPSA-N 0.000 description 1
- XXROXFHCMVXETG-UWVGGRQHSA-N Val-Gly-Val Chemical compound CC(C)[C@H](N)C(=O)NCC(=O)N[C@@H](C(C)C)C(O)=O XXROXFHCMVXETG-UWVGGRQHSA-N 0.000 description 1
- YMTOEGGOCHVGEH-IHRRRGAJSA-N Val-Lys-Lys Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(O)=O YMTOEGGOCHVGEH-IHRRRGAJSA-N 0.000 description 1
- VPGCVZRRBYOGCD-AVGNSLFASA-N Val-Lys-Val Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(O)=O VPGCVZRRBYOGCD-AVGNSLFASA-N 0.000 description 1
- UQMPYVLTQCGRSK-IFFSRLJSSA-N Val-Thr-Gln Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)O)NC(=O)[C@H](C(C)C)N)O UQMPYVLTQCGRSK-IFFSRLJSSA-N 0.000 description 1
- LCHZBEUVGAVMKS-RHYQMDGZSA-N Val-Thr-Leu Chemical compound CC(C)C[C@H](NC(=O)[C@@H](NC(=O)[C@@H](N)C(C)C)[C@@H](C)O)C(O)=O LCHZBEUVGAVMKS-RHYQMDGZSA-N 0.000 description 1
- HTONZBWRYUKUKC-RCWTZXSCSA-N Val-Thr-Val Chemical compound CC(C)[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(O)=O HTONZBWRYUKUKC-RCWTZXSCSA-N 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- 206010000210 abortion Diseases 0.000 description 1
- 231100000176 abortion Toxicity 0.000 description 1
- 239000002253 acid Substances 0.000 description 1
- 239000013543 active substance Substances 0.000 description 1
- 239000008272 agar Substances 0.000 description 1
- 239000011543 agarose gel Substances 0.000 description 1
- 108010069020 alanyl-prolyl-glycine Proteins 0.000 description 1
- 108010044940 alanylglutamine Proteins 0.000 description 1
- 125000003342 alkenyl group Chemical group 0.000 description 1
- KOSRFJWDECSPRO-UHFFFAOYSA-N alpha-L-glutamyl-L-glutamic acid Natural products OC(=O)CCC(N)C(=O)NC(CCC(O)=O)C(O)=O KOSRFJWDECSPRO-UHFFFAOYSA-N 0.000 description 1
- WNROFYMDJYEPJX-UHFFFAOYSA-K aluminium hydroxide Chemical compound [OH-].[OH-].[OH-].[Al+3] WNROFYMDJYEPJX-UHFFFAOYSA-K 0.000 description 1
- 238000000137 annealing Methods 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 229940088710 antibiotic agent Drugs 0.000 description 1
- 230000030741 antigen processing and presentation Effects 0.000 description 1
- 230000008350 antigen-specific antibody response Effects 0.000 description 1
- 108010062796 arginyllysine Proteins 0.000 description 1
- 108010060035 arginylproline Proteins 0.000 description 1
- 108010040443 aspartyl-aspartic acid Proteins 0.000 description 1
- 108010069205 aspartyl-phenylalanine Proteins 0.000 description 1
- 108010038633 aspartylglutamate Proteins 0.000 description 1
- 108010092854 aspartyllysine Proteins 0.000 description 1
- 244000052616 bacterial pathogen Species 0.000 description 1
- 230000000721 bacterilogical effect Effects 0.000 description 1
- 239000011324 bead Substances 0.000 description 1
- 230000003115 biocidal effect Effects 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 239000006161 blood agar Substances 0.000 description 1
- 238000010241 blood sampling Methods 0.000 description 1
- 230000036760 body temperature Effects 0.000 description 1
- 210000004556 brain Anatomy 0.000 description 1
- 229940041514 candida albicans extract Drugs 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 206010008323 cervicitis Diseases 0.000 description 1
- 239000003610 charcoal Substances 0.000 description 1
- 235000012000 cholesterol Nutrition 0.000 description 1
- 239000013611 chromosomal DNA Substances 0.000 description 1
- 229920001436 collagen Polymers 0.000 description 1
- 229960005188 collagen Drugs 0.000 description 1
- 238000004590 computer program Methods 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- OORMXZNMRWBSTK-UHFFFAOYSA-N dammaran Natural products C1CCC(C)(C)C2CCC3(C)C4(C)CCC(C(C)CCCC(C)C)C4CCC3C21C OORMXZNMRWBSTK-UHFFFAOYSA-N 0.000 description 1
- 230000007423 decrease Effects 0.000 description 1
- 230000007812 deficiency Effects 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 1
- 231100000676 disease causative agent Toxicity 0.000 description 1
- BNIILDVGGAEEIG-UHFFFAOYSA-L disodium hydrogen phosphate Chemical compound [Na+].[Na+].OP([O-])([O-])=O BNIILDVGGAEEIG-UHFFFAOYSA-L 0.000 description 1
- 229910000397 disodium phosphate Inorganic materials 0.000 description 1
- 238000009826 distribution Methods 0.000 description 1
- 239000003651 drinking water Substances 0.000 description 1
- 235000020188 drinking water Nutrition 0.000 description 1
- 101150113410 eag gene Proteins 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 230000003203 everyday effect Effects 0.000 description 1
- 230000001747 exhibiting effect Effects 0.000 description 1
- 229950003499 fibrin Drugs 0.000 description 1
- 102000025748 fibrinogen binding proteins Human genes 0.000 description 1
- 230000003325 follicular Effects 0.000 description 1
- 230000008014 freezing Effects 0.000 description 1
- 238000007710 freezing Methods 0.000 description 1
- 229960002518 gentamicin Drugs 0.000 description 1
- 108010013768 glutamyl-aspartyl-proline Proteins 0.000 description 1
- 108010055341 glutamyl-glutamic acid Proteins 0.000 description 1
- 108010049041 glutamylalanine Proteins 0.000 description 1
- 229930182470 glycoside Natural products 0.000 description 1
- JYPCXBJRLBHWME-UHFFFAOYSA-N glycyl-L-prolyl-L-arginine Natural products NCC(=O)N1CCCC1C(=O)NC(CCCN=C(N)N)C(O)=O JYPCXBJRLBHWME-UHFFFAOYSA-N 0.000 description 1
- 108010078326 glycyl-glycyl-valine Proteins 0.000 description 1
- 108010050848 glycylleucine Proteins 0.000 description 1
- 229960002897 heparin Drugs 0.000 description 1
- 229920000669 heparin Polymers 0.000 description 1
- 108010037896 heparin-binding hemagglutinin Proteins 0.000 description 1
- 108010085325 histidylproline Proteins 0.000 description 1
- 230000005745 host immune response Effects 0.000 description 1
- 206010020718 hyperplasia Diseases 0.000 description 1
- 210000000987 immune system Anatomy 0.000 description 1
- 230000036039 immunity Effects 0.000 description 1
- 229940072221 immunoglobulins Drugs 0.000 description 1
- 230000003308 immunostimulating effect Effects 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 1
- 210000004731 jugular vein Anatomy 0.000 description 1
- 108010044311 leucyl-glycyl-glycine Proteins 0.000 description 1
- 108010034529 leucyl-lysine Proteins 0.000 description 1
- 108010047926 leucyl-lysyl-tyrosine Proteins 0.000 description 1
- 230000004807 localization Effects 0.000 description 1
- 210000004072 lung Anatomy 0.000 description 1
- 108010025153 lysyl-alanyl-alanine Proteins 0.000 description 1
- 108010076718 lysyl-glutamyl-tryptophan Proteins 0.000 description 1
- 108010045397 lysyl-tyrosyl-lysine Proteins 0.000 description 1
- 108010064235 lysylglycine Proteins 0.000 description 1
- 229920002521 macromolecule Polymers 0.000 description 1
- FPYJFEHAWHCUMM-UHFFFAOYSA-N maleic anhydride Chemical compound O=C1OC(=O)C=C1 FPYJFEHAWHCUMM-UHFFFAOYSA-N 0.000 description 1
- 208000004396 mastitis Diseases 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- 230000001404 mediated effect Effects 0.000 description 1
- 230000037353 metabolic pathway Effects 0.000 description 1
- 230000001394 metastastic effect Effects 0.000 description 1
- 206010061289 metastatic neoplasm Diseases 0.000 description 1
- 229910000402 monopotassium phosphate Inorganic materials 0.000 description 1
- 238000010172 mouse model Methods 0.000 description 1
- 210000004877 mucosa Anatomy 0.000 description 1
- 108010009719 mutanolysin Proteins 0.000 description 1
- 230000035772 mutation Effects 0.000 description 1
- 239000002105 nanoparticle Substances 0.000 description 1
- 210000001989 nasopharynx Anatomy 0.000 description 1
- 231100000957 no side effect Toxicity 0.000 description 1
- 238000013421 nuclear magnetic resonance imaging Methods 0.000 description 1
- 239000007764 o/w emulsion Substances 0.000 description 1
- 230000003287 optical effect Effects 0.000 description 1
- 244000052769 pathogen Species 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- 229940049954 penicillin Drugs 0.000 description 1
- 239000000137 peptide hydrolase inhibitor Substances 0.000 description 1
- 230000008782 phagocytosis Effects 0.000 description 1
- 108010012581 phenylalanylglutamate Proteins 0.000 description 1
- 108010073101 phenylalanylleucine Proteins 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- 150000003904 phospholipids Chemical class 0.000 description 1
- 239000013600 plasmid vector Substances 0.000 description 1
- 238000007747 plating Methods 0.000 description 1
- 229920001155 polypropylene Polymers 0.000 description 1
- 239000013641 positive control Substances 0.000 description 1
- GNSKLFRGEWLPPA-UHFFFAOYSA-M potassium dihydrogen phosphate Chemical compound [K+].OP(O)([O-])=O GNSKLFRGEWLPPA-UHFFFAOYSA-M 0.000 description 1
- 238000003825 pressing Methods 0.000 description 1
- 108010029020 prolylglycine Proteins 0.000 description 1
- 108010053725 prolylvaline Proteins 0.000 description 1
- 235000019419 proteases Nutrition 0.000 description 1
- 238000001742 protein purification Methods 0.000 description 1
- 239000001397 quillaja saponaria molina bark Substances 0.000 description 1
- 238000010188 recombinant method Methods 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 230000000241 respiratory effect Effects 0.000 description 1
- 230000000717 retained effect Effects 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- 230000037390 scarring Effects 0.000 description 1
- 238000012216 screening Methods 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 238000005507 spraying Methods 0.000 description 1
- 108010010318 streptococcal M protein Proteins 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- 230000004083 survival effect Effects 0.000 description 1
- 230000009747 swallowing Effects 0.000 description 1
- 230000009885 systemic effect Effects 0.000 description 1
- 229960002180 tetracycline Drugs 0.000 description 1
- 229930101283 tetracycline Natural products 0.000 description 1
- 235000019364 tetracycline Nutrition 0.000 description 1
- 150000003522 tetracyclines Chemical class 0.000 description 1
- 238000010257 thawing Methods 0.000 description 1
- 239000003053 toxin Substances 0.000 description 1
- 231100000765 toxin Toxicity 0.000 description 1
- 108700012359 toxins Proteins 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 108010044292 tryptophyltyrosine Proteins 0.000 description 1
- 210000001944 turbinate Anatomy 0.000 description 1
- 230000029069 type 2 immune response Effects 0.000 description 1
- 108010051110 tyrosyl-lysine Proteins 0.000 description 1
- 108010003137 tyrosyltyrosine Proteins 0.000 description 1
- 108010073969 valyllysine Proteins 0.000 description 1
- 108010009962 valyltyrosine Proteins 0.000 description 1
- 230000009385 viral infection Effects 0.000 description 1
- 239000012138 yeast extract Substances 0.000 description 1
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/02—Bacterial antigens
- A61K39/09—Lactobacillales, e.g. aerococcus, enterococcus, lactobacillus, lactococcus, streptococcus
- A61K39/092—Streptococcus
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/04—Immunostimulants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
- C07K14/315—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Streptococcus (G), e.g. Enterococci
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/55—Medicinal preparations containing antigens or antibodies characterised by the host/recipient, e.g. newborn with maternal antibodies
- A61K2039/552—Veterinary vaccine
Definitions
- This invention is generally related to antigenic or immunogenic compositions and use thereof for immunization of non-human mammals, e.g. horses, against Streptococcus equi.
- Streptococcal infections in horses are mainly caused by the species Streptococcus equi , which is classified as a Lancefield Group C Streptococcus and comprises two subspecies designated equi and zooepidemicus , respectively.
- Streptococcus equi subsp. equi which is virtually confined to horses, is the causative agent of strangles, a world-wide distributed and highly contagious serious disease of the upper respiratory tract of the Equidae. Strangles is one of the most frequently reported equine diseases world-wide and is characterized by fever, nasal discharge, and abscess formation in the retropharyngeal and mandibular lymph nodes. In some cases the disease shows a metastatic course in the body, so called “bastard strangles”. The disease has a world-wide distribution and causes great economic losses. Moreover, since strangles is a highly contagious disease, not only infected animals but also all other members of e.g. an afflicted stud must be isolated for as long as up to three months.
- S. equi subsp. zooepidemicus is considered as an opportunistic commensal often occurring in the upper respiratory tract of healthy horses. However, after stress or virus infection, it can cause a secondary infection, which results in strangles-like symptoms. Moreover, subsp. zooepidemicus infects not only horses but also a wide range of other animals, like pigs, dogs, cats, and cows. Even human cases of infection due to subsp. zooepidemicus have been reported. This subspecies has been implicated as the primary pathogen in conditions such as endometritis, cervicitis, abortion, mastitis, pneumonia, abscesses and joint infections.
- antibiotics such as penicillin, tetracycline or gentamicin
- an effective prophylactic agent that could prevent outbursts of such infections and obviate or reduce the risk for development of resistant strains associated with antibiotic treatment, would be appreciated.
- Fn fibronectin
- Fn ECM component fibronectin
- binding between Fn-binding bacterial cell-surface proteins and immobilized Fn promotes internalization of streptococci by epithelial cells (Ref. 2, 23, 24).
- Fibronectin is a dimeric glycoprotein found both in plasma and in a fibrillar form in the extracellular matrix.
- the main function of Fn is to mediate substrate adhesion of eukaryotic cells, which involves the binding of specific cell-surface receptors to certain domains of the Fn molecule. Furthermore, it also interacts with several other macromolecules, such as DNA, heparin, fibrin, and collagen.
- Fn-binding proteins from different streptococcal species have been cloned and sequenced previously.
- S. equi one Fn-binding protein has been cloned and characterized, which is a Fn-binding cell-surface protein of subsp. zooepidemicus , that has been designated FNZ (Lindmark et al., 1996, Ref. 9).
- Another Fn-binding protein from S. equi subsp. equi has been cloned and characterized by Lindmark and Guss (1999) (Ref. 12). This latter protein that is designated SFS and its potential use as an active component in a vaccine for protection of horses against strangles are disclosed in WO 00/37496.
- ZAG a protein designated ZAG has been cloned and characterized from S. equi subsp. zooepidemicus that mediates binding to the plasma proteinase inhibitor ⁇ 2 M. It is speculated therein that this protein is similar in function to streptococcal M proteins. This protein, ZAG, is also disclosed in WO 95/07296, where its ⁇ 2 M-binding properties are indicated. However, immunogenic properties or potential use thereof as an active component in a vaccine for protection of e.g. horses against strangles are not disclosed therein. The gene zag encoding ZAG is also disclosed in these references.
- a gene that is similar to the aforesaid zag gene from S. equi subsp. zooepidemicus but is present in subsp. equi has been described by Lindmark et al. (1999) (Ref. 11) and Lindmark (1999) (Ref. 13). This gene is hereafter designated eag and encodes a protein designated EAG.
- antigenic compositions which comprise at least one antigen derived from a protein designated EAG, which protein is present in S. equi , and which composition suitably comprises at least one further antigen selected from a group of proteins which are present in S. equi and are designated FNZ, SFS, SEC and ScIC, respectively.
- subunit immunogenic or vaccine compositions which comprise at least one polypeptide of S. equi having a specific amino acid sequence as shown in the sequence listing attached to said publication or an analog thereof or a fragment thereof which is a part of said polypeptide and contains at least one epitope.
- polypeptide of S. equi having a specific amino acid sequence as shown in the sequence listing attached to said publication or an analog thereof or a fragment thereof which is a part of said polypeptide and contains at least one epitope.
- the present invention is based on an antigenic, suitably an immunogenic, composition
- at least one antigen suitably an immunogen, that comprises at least one antigenic epitope or antigenic determinant derived from a protein present in one or both of S. equi subsp. equi and subsp. zooepidemicus and use thereof for immunization of non-human mammals against S. equi subsp. equi and/or subsp. zooepidemicus.
- the present invention is also directed to a vaccine composition
- a vaccine composition comprising the afore-said antigenic composition as immunizing component; to methods to prepare said antigenic, suitably immunogenic, composition or vaccine composition; to methods to induce an immune response against S. equi in non-human mammals; and to methods for prophylactic or therapeutic treatment of S. equi infection in non-human mammals.
- S. equi refers to one or both of subsp. equi and subsp. zooepidemicus.
- the present invention is directed to a vaccine that protects equines, such as horses, against strangles.
- non-human mammals primarily refers to animals belonging to the family Equidae that consists of horses, donkeys and zebras and to hybrids thereof, such as mules and hinnies. Camels and dromedaries are also encompassed therein.
- non-human mammals in addition refers also to other mammals such as cows, pigs, dogs and cats.
- FIG. 1 shows weight loss of mice given experimental infection with S. equi subsp. equi strain 1866 after vaccination with the polypeptides Eq5 and Eq8 (open symbols) or non-vaccinated (filled symbols);
- FIG. 2 shows nasal growth in mice given experimental infection with S. equi subsp. equi strain 1866 after vaccination with the polypeptides Eq5 and Eq8 (open symbols) or non-vaccinated (filled symbols);
- FIG. 3 shows weight loss of mice given experimental infection with S. equi subsp. equi strain 1866 after vaccination with the polypeptide EAG (filled squares), the polypeptides EAG+IdeE+IdeE2 (open circles) or non-vaccinated controls (filled circles);
- FIG. 4 shows nasal growth in mice given experimental infection with S. equi subsp. equi strain 1866 after vaccination with the polypeptide EAG (filled squares), the polypeptides EAG+IdeE+IdeE2 (open circles) or non-vaccinated controls (filled circles).
- FIGS. 5 a and 5 b show weight loss and nasal growth in mice immunized with EAG+CNE+ScIC i.n. (filled squares), Eq5+Eq8 i.n. (filled circles) and the control (open circles).
- FIG. 6 shows growth of challenge inoculum ( S. equi subsp. equi strain 4047);
- FIG. 7 shows mean pony temperatures during the vaccination phase
- FIG. 8 shows mean nasal score during the vaccination phase
- FIG. 9 shows mean lymph node score during the vaccination phase
- FIG. 10 shows mean counts of S. zooepidemicus in nasal washes during the vaccination phase
- FIG. 11 shows mean pony temperatures after challenge
- FIG. 12 shows mean fibrinogen levels during the challenge phase
- FIG. 13 shows mean neutrophil levels during the challenge phase
- FIG. 14 shows mean lymph node score during the challenge phase
- FIG. 15 shows mean nasal score during the challenge phase
- FIG. 16 shows mean S. zooepidemicus counts during challenge phase
- FIG. 17 shows mean pathology score on post mortem examination
- FIG. 18 shows mean histopathology scores.
- SEQ ID NO 1 shows the amino acid sequence of the protein IdeE2.
- SEQ ID NO 2 shows the amino acid sequence of the recombinant protein IdeE2.
- SEQ ID NO 3 shows the amino acid sequence of the protein Eq5.
- SEQ ID NO 4 shows the amino acid sequence of the recombinant protein Eq5.
- SEQ ID NO 5 shows the amino acid sequence of the protein Eq8.
- SEQ ID NO 6 shows the amino acid sequence of the recombinant protein Eq8.
- SEQ ID NO 7 shows the amino acid sequence of the protein IdeZ2 from subsp. zooepidemicus.
- SEQ ID NO 8 shows the amino acid sequence of the protein Eqz5 from subsp. zooepidemicus.
- SEQ ID NO 9 shows the amino acid sequence of the protein Eqz8 from subsp. zooepidemicus.
- SEQ ID NO 10 shows the amino acid sequence of the protein IdeE.
- SEQ ID NO 11 shows the amino acid sequence of the protein IdeZ from subsp. zooepidemicus.
- SEQ ID NOS 12 and 13 shows, respectively, the nucleotide sequence of the gene eag and the amino acid sequence of the protein EAG4B, which protein is usually designated EAG in connection with the present invention.
- SEQ ID NO 14 shows the nucleotide sequence of the gene ideE2.
- SEQ ID NO 15 shows the nucleotide sequence of the gene eq5.
- SEQ ID NO 16 shows the nucleotide sequence of the gene eq8.
- SEQ ID NO 17 shows the nucleotide sequence of the gene IdeZ2 from subsp. zooepidemicus.
- SEQ ID NO 18 shows the nucleotide sequence of the gene eqz5 from subsp. zooepidemicus.
- SEQ ID NO 19 shows the nucleotide sequence of the gene eqz8 from subsp. zooepidemicus.
- SEQ ID NO 20 shows the nucleotide sequence of the gene ideE.
- SEQ ID NO 21 shows the nucleotide sequence of the gene ideZ from subsp. zooepidemicus.
- SEQ ID NOS 22-27 show nucleotide sequences of oligonucleotide primers.
- SEQ ID NO 28 shows the amino acid sequence of the protein CNE (or SEC 2.16).
- SEQ ID NO 29 shows the amino acid sequence of the protein ScIC.
- SEQ ID NO 30 shows the amino acid sequence of the recombinant IdeE used for immunization.
- SEQ ID NO 31-32 shows the nucleotide sequence of primers.
- the present invention is concerned with identification of polypeptides or proteins of S. equi that are able to elicit an antigenic, suitably an immunogenic, response, when administered to a non-human mammal; and to the identification of polynucleotides or genes encoding these polypeptides or proteins.
- the present invention is also concerned with fragments or analogs of said polypeptides or proteins or of said polynucleotides or genes.
- genes of S. equi encoding extracellular proteins were identified and, subsequently, the corresponding products were expressed and evaluated in vaccine studies.
- the present invention is at least partly based on such studies.
- the present invention relates to an antigenic composition
- an antigenic composition comprising at least one antigen, wherein said at least one antigen comprises at least part of a protein of Streptococcus equi subsp. equi or subsp. zooepidemicus , and said at least part of said protein comprises at least one antigenic epitope or antigenic determinant of Streptococcus equi.
- the present invention is directed to an antigenic composition
- an antigenic composition comprising at least one antigen, wherein said at least one antigen comprises at least part of a protein or polypeptide of Streptococcus equi subsp. equi or subsp. zooepidemicus and said at least part of said protein or polypeptide comprises at least one antigenic epitope or antigenic determinant of Streptococcus equi , and wherein said protein or polypeptide is selected from the group comprising:
- EAG a protein or polypeptide which is designated EAG and has an amino acid sequence as shown in SEQ ID NO: 13;
- IdeE a protein or polypeptide which is designated IdeE and has an amino acid sequence as shown in SEQ ID NO: 10;
- IdeE2 a protein or polypeptide which is designated IdeE2 and has an amino acid sequence as shown in SEQ ID NO: 1;
- Eq5 a protein or polypeptide which is designated Eq5 and has an amino acid sequence as shown in SEQ ID NO: 3;
- Eq8 a protein or polypeptide which is designated Eq8 and has an amino acid sequence as shown in SEQ ID NO: 5;
- IdeZ2 a protein or polypeptide which is designated IdeZ2 and has an amino acid sequence as shown in SEQ ID NO: 7;
- Eqz5 a protein or polypeptide which is designated Eqz5 and has an amino acid sequence as shown in SEQ ID NO: 8;
- Eqz8 a protein or polypeptide which is designated Eqz8 and has an amino acid sequence as shown in SEQ ID NO: 9;
- composition which comprises EAG comprises at least one further antigen, which is a protein or polypeptide, which is selected from the group comprising IdeE, IdeE2, Eq5, Eq8, IdeZ2, Eqz5, and Eqz8.
- EAG, IdeE, IdeE2, Eq5, and Eq8 designate proteins that can be found in S. equi subsp. equi and IdeZ, IdeZ2, Eqz5, and Eqz8 designate proteins that can be found in S. equi subsp. zooepidemicus.
- the antigens or immunogens of the present antigenic or immunogenic compositions may comprise the entire amino acid sequence of said protein or polypeptide or may comprise a fragment, e.g. a C-terminal or N-terminal fragment thereof, or an analog thereof.
- a fragment e.g. a C-terminal or N-terminal fragment thereof, or an analog thereof.
- an N-terminal fragment of EAG is used according to various embodiments of the present invention.
- the present invention is related to an antigenic or immunogenic composition which contains at least 2 or 3 antigens or immunogens selected from the group consisting of EAG, IdeE, IdeE2, Eq5, Eq8, IdeZ, IdeZ2, Eqz5, and Eqz8.
- the present invention is related to an antigenic or immunogenic composition which contains at least 2 or 3 antigens or immunogens selected from the group consisting of EAG, IdeE, IdeE2, Eq5, and Eq8.
- this composition also comprises one or both of the previously described antigens ScIC (SEQ ID NO: 29) and CNE (SEQ ID NO: 28) (also designated SEC e.g. SEC 2.16).
- SEQ ID NO: 29 SEQ ID NO: 29
- CNE SEQ ID NO: 28
- a further embodiment is related to an antigenic composition comprising EAG, ScIC, CNE, Eq5, and Eq8.
- a suitable composition contains 2 antigens or immunogens which are comprised of Eq5 and Eq8, respectively.
- the present invention is directed to a composition that contains 3 antigens or immunogens, which suitably are comprised of EAG, IdeE, and IdeE2.
- the present invention is also related to compositions that comprise one or both of IdeE and IdeE2.
- the present invention is also related to an antigenic composition, wherein said at least one protein or polypeptide is selected from the group consisting of EAG, Eq5 and Eq8 and which composition further comprises at least one antigen, which is selected from the group comprising a protein or a polypeptide designated CNE (or SEC), which has an amino acid sequence as shown in SEQ ID NO: 28, and a protein or a polypeptide designated ScIC, which has an amino acid sequence as shown in SEQ ID NO: 29.
- said at least one protein or polypeptide is selected from the group comprising IdeE and IdeE2.
- Antigenic compositions of the present invention comprise according to one embodiment, the antigens EAG, ScIC, CNE (or SEC), Eq5, Eq8, IdeE and IdeE2, and according to another embodiment, the antigens EAG, ScIC, CNE (or SEC), Eq5, and Eq8.
- the present invention is also related to an antigenic composition, wherein said at least one protein or polypeptide is selected from the group consisting of EAG, Eq8, and IdeE2 and which composition comprises at least one further antigen which is selected from the group comprising IdeE, Eq5, IdeZ2, Eqz5 and Eqz8 and/or ScIC and CNE (or SEC).
- the antigenic composition suitably comprises at least one antigen which is recombinantly produced and/or at least one antigen which is an isolated or purified antigen.
- the present antigens or immunogens that are derived from proteins of Streptococcus equi may comprise the entire protein, a fragment of said protein or an analog of said protein which is antigenic or immunogenic.
- the present invention is not limited to the fragments of proteins that are specifically disclosed herein.
- the antigenic composition of the present invention may comprise at least one recombinant vector and at least one polynucleotide inserted therein that encodes said at least one protein or polypeptide, and which vector is able to express said polypeptide in vivo in a non-human mammal susceptible to infection with S. equi.
- the vector is an expression vector which is a plasmid or a viral vector and wherein said polynucleotide has a nucleotide sequence that encodes an antigen of the present invention.
- a further embodiment of the present invention is concerned with a vaccine composition for protecting non-human mammals against infection of Streptococcus equi , which comprises an antigenic composition as disclosed above as immunizing component, and a pharmaceutically acceptable carrier.
- the present vaccine composition comprises an antigenic or immunogenic composition that contains 2, 3 or more of the present antigens or immunogens as immunizing components.
- these antigens or immunogens are comprised of analogs of said proteins or fragments thereof, e.g. N-terminal or C-terminal fragments.
- the vaccine composition may comprise further components, such as an adjuvant.
- an adjuvant such as an adjuvant.
- said adjuvant stimulates systemic or mucosal immunity.
- Such adjuvants are well known in the art.
- Suitable adjuvants for use according to the present invention comprise (1) polymers of acrylic or methacrylic acid, maleic anhydride and alkenyl derivative polymers, (2) immunostimulating sequences (ISS), (3) an oil in water emulsion, (4) cation lipids containing a quaternary ammonium salt, (5) cytokines, (6) aluminum hydroxide or aluminum phosphate, (7) saponin or (8) nanoparticles.
- a suitable adjuvant for use according to the present invention is the adjuvant Abisco from Isconova AB, Sweden.
- the key components of ISCOMS are Quillaia saponins derived from the bark of the chilean soap bark tree Quillaia saporinaria molina. Quillaia saponins are well known for their ability to activate the immune system. Quillaia saponins mixed with cholesterol, and phospholipids under specific stoichiometry form spherical open cage like structures known as ISCOMS.
- Ginseng is a dry extract prepared from the root of the plant Panax ginseng , C. A. Meyer.
- Ginseng contains a number of active substances named ginsenosides that are a kind of saponins, chemically tri-terpenoid glycosides of the dammaran series.
- the ginsenosides have adjuvant properties and one of the most active adjuvant is the fraction named Rb1. It has been proved that the fraction Rb1 elicits a balanced Th1 and Th2 immune response as determined by measuring the levels of the cytokines IFN- ⁇ , IL-2, IL-4, IL-10 secreted post vaccination with a Rb1 adjuvanted vaccine. In addition ginseng and the fraction Rb1 stimulates a strong antigen specific antibody response.
- the vaccine composition is a vaccine that protects susceptible mammals, suitably horses, against strangles caused by Streptococcus equi subsp. equi.
- the vaccine composition of the present invention is provided in a physiologically administrable form. Suitably, it is administrable by subcutaneous, intramuscular or intranasal inoculation.
- the vaccine composition of the present invention stimulates serum, mucosal and/or bronchial lavage antibody responses directed to Streptococcus equi antigens in mammals susceptible to Streptococcus equi , suitably horses.
- the present invention is also related to a method for producing an antigen or immunogen to be used in an antigenic or immunogenic composition of the present invention, which method comprises
- step (c) culturing said host cell provided in step (b) under conditions required for expression of the product encoded by said DNA fragment;
- said method further comprises a step (e) wherein the isolated product from step (d) is purified, e.g. by affinity chromatography or other chromatographic methods known in the art.
- the antigens of the present invention are usually produced according to recombinant technique.
- a further embodiment of the present invention is concerned with a method for preparation of a vaccine of the present invention, which vaccine contains as immunizing component an antigenic or immunogenic composition as disclosed above, said method comprising mixing said antigenic composition and a pharmaceutically acceptable carrier.
- the present invention is also related to a method for the production of an antiserum, said method comprising administering an antigenic preparation of the present invention to an animal host to produce antibodies in said animal host and recovering antiserum containing said antibodies produced in said animal host.
- the present invention is concerned with a method of prophylactic or therapeutic treatment of S. equi infection in non-human mammals, suitably horses, comprising administering to said mammal an immunologically effective amount of a vaccine or an antiserum of the present invention.
- the present invention is related to a method for protecting horses against Streptococcus equi infection, which method comprises inoculating a horse intramuscular, subcutaneously or intranasally, or a combination of e.g. both subcutaneously and intranasally, with a vaccine composition of the present invention to induce an immune response against Streptococcus equi in said horse.
- an immune response in the form of IgG and/or IgA and/or IgM antibodies in the nasopharyngeal mucus, is induced in said horse.
- the present invention also relates to an antibody preparation comprising at least one, and suitably at least two, antibodies specific for a protein or a polypeptide of the present antigenic composition, which antibody/antibodies is/are polyclonal or monoclonal; or which preparation comprises a fragment of said antibodies.
- the antibody preparation of the present invention could be used prophylactically or therapeutically against strangles and provides passive immunization when administered to a non-human mammal susceptible to infection by Streptococcus equi or infected by Streptococcus equi.
- the present invention describes a vaccine composition comprising one or several antigen components which have been prepared according to the present method using E. coli as host cells.
- the source of these antigens might also be the native bacteria, if methods are developed for expression and purification thereof.
- the antigens of the present invention can also be produced according to methods that are based on fusion strategies where various parts of the respective antigen are recombined resulting in a fusion can in protein consisting of parts from different antigens.
- This fusion strategy could also be suitable for introducing immune reactive part(s), e.g. T-cell epitopes or attenuated toxins (or parts thereof), thereby introducing other features suitable for optimizing the antigen presentation or localization.
- other hosts for expressing the recombinant antigens addition to E. coli also be other suitable species of bacteria and viruses. Today many different systems for expression of heterologus expression are well known in the field of molecular biology.
- Yet another implication of this invention is that it can be used to design specific attenuated mutants of S. equi that lack or have inactivated genes important for survival (i.e. mutations causing deficiency in metabolic pathways) in the host but retain or overproduce the antigens of the present invention.
- Cleavage sites for the restriction enzymes NcoI and XhoI were included in the primer sequences to match the cloning sites in the plasmid vector pTYB4 (New England Biolabs).
- the PCR amplifications were performed using the primers (20 pmol/ ⁇ l) and the ReadyToGoTM PCR beads (GE Healthcare) using the following programme: Step 1, pre-heat 1 minute at 95° C., DNA strand separation; Step 2, 30 seconds at 95° C.; Step 3, annealing 15 seconds at 46° C.; and Step 4, elongation for 2 minutes at 72° C., Steps 2-4 were run for 26 cycles.
- PCR products were analysed on a 1 agarose gel, and thereafter purified using the QIAquick PCR Purification KitTM (Qiagen). Cleavage with the restriction enzymes was performed over night whereupon the fragments were purified one additional time using the same kit.
- Primer Table The primer sequences used to PCR amplify the genes ideE, ideE2, eq5 and eq8.
- the nucleotides underlined correspond to the introduced restriction cleavage sites NcoI and XhoI.
- E. coli strain ER2566 containing the pTYB4 vector (New England Biolabs) was grown according to the manufacturer's instructions, and the vector was purified using the QIAprep Spin Miniprep (Qiagen). Purified vector was digested using restriction endonucleases NcoI and XhoI. After digestion, the vector was treated with the enzyme alkaline phosphatase to reduce the background of re-ligated vector in the later ligation step. For the ligation of the vector and the respective PCR product, the ReadyToGo T4DNA Ligase (GE Healthcare) was used. After ligation, the respective sample were transformed into competent cells of E.
- coli strain ER2566 using electroporation, and spread on LA-Amp plates (Luria-Bertani broth agar plates supplemented with ampicillin, final conc. 50 ⁇ g/ml) and incubated over night at 37° C. Next day colonies were counted and four colonies per construct were cultivated and used for further experiments. To verify the presence of an insert in the respective constructs, plasmids were purified and additional PCR analyses were performed using the respective primer combination. The sequence of the respective insert was also determined by DNA sequencing using primers that hybridise in the vector (T7 universal forward primer and a reverse primer located in the intein coding region).
- ideE gene of S. equi subsp. equi strain 1866 has been reported previously by Lannerg ⁇ rd and Guss (2006).
- GenBank accession number of ideE is DQ508733.
- the part of the gene used to obtain the recombinant IdeE protein used for immunization was cloned using the primers IdEG1 and IdEG2 listed in the Primer Table. After PCR amplification the DNA fragment was digested with restriction enzymes BamHI and XhoI and ligated into the vector pGEX6-P-1 (GE Healthcare), previously digested with the same enzymes.
- the vector used is a part of an E. coli expression and purification system called IMPACTTM T7 (NEB Inc.) Briefly, following the manufacturer's instructions the clones expressing recombinant IdeE2, Eq5 and Eq8, respectively were grown at 37° C. in Luria Bertani growth medium supplemented with ampicillin (final conc. 50 ⁇ g/ml). At an optical density (OD 600 ) ⁇ 0.6, the growth medium was supplemented with IPTG (final conc. 0.4 mM) and the growth temperature shifted to 20° C.
- IMPACTTM T7 NEB Inc.
- the cells were harvested and resuspended in a buffer [20 mM Tris-HCl (pH 8.0), 500 mM NaCl, 0.1 mM EDTA, and 0.1% Triton X100] and lysed by freezing and thawing. After centrifugation, the supernatant was sterile filtrated and applied onto a chitin column. The columns were extensively washed using the same buffer and subsequently treated with cleavage buffer [20 mM Tris-HCl (pH 8.0), 50 mM NaCl, 0.1 mM EDTA, and 30 mM dithiothreitol (DTT)].
- a buffer [20 mM Tris-HCl (pH 8.0), 500 mM NaCl, 0.1 mM EDTA, and 0.1% Triton X100] and lysed by freezing and thawing. After centrifugation, the supernatant was sterile filtrated and applied onto a chi
- the reducing conditions induce an intein-mediated self-cleavage that releases the antigen part from the column while the intein-chitin-binding part is still bound.
- the eluted samples containing the antigens were dialysed against phosphate-buffered saline [PBS; 137 mM NaCl, 2.7 mM KCl, 10 mM Na 2 HPO 4 , 1.4 mM KH 2 PO 4 (pH 7.4)] and concentrated. The amounts of antigens obtained were determined and the quality was checked using SDS-PAGE.
- the recombinant IdeE protein was produced and purified using the GST-affinity chromatography system according to the procedure recommended by the manufacturer (GE Healthcare).
- EAG4B protein is simply called EAG.
- IdE has previously been shown to be a protease that specifically cleaves IgG from various species (Lanneg ⁇ rd and Guss 2006).
- IgG from human, horse and mouse were incubated in PBS at 37° C. for one hour.
- Purified recombinant IdeE was used as a positive control and the negative control was pure IgG. After cleavage, the samples were analysed using 8-25% gradient SDS-PAGE. The result showed that recombinant IdeE2 cleaves cleaves horse IgG much more efficiently than IdeE does.
- mice weighting approximately 23-25 g were kept in cages of five animals in each.
- the mice were immunised intranasally with 12 micrograms of each antigen and 10 microgram of Abisco 300 (Isconova AB, Sweden).
- Fifteen animals were immunised with antigen (Eq5 and Eq8) and 15 were only given Abisco 300 adjuvant to serve as a negative control.
- the total volume was kept to less than 27 ⁇ l and applied into the nostrils twice with 30 minutes interval of mice anaesthetized with Isoflovet (Abbot Laboratories, England). Immunisations were given on days 0, 13 and 32.
- EAG, IdeE and IdeE2 were performed essentially as for Eq5 and Eq8. However, animals were divided into three groups, with ten mice in each group. These were given EAG+IdeE+IdeE2 or EAG only and one group with only adjuvans, Abisco 300, as negative control. Immunisations were given on days 0, 21 and 53. Experimental infection was given on day 60.
- the culture was kept at ⁇ 80° C. in vials and a new vial was used for each experiment.
- bacteria were grown on BG plates at 37° C. in 5% CO 2 overnight, followed by inoculation into THY and grown without shaking over night.
- the cultures was then diluted 10 times into THY and 10% horse serum (Sigma) and grown for 4 hours at 37° C. in 5% CO 2 .
- the culture was centrifuged and resuspended in THB. A dose containing 1 ⁇ 10 6 CFU in 10 ⁇ l was used for all S. equi infections of mice. The animals were followed daily.
- Bacterial nasal growth was scored on a four-graded scale from 0 to +++ by gently pressing the nose of the animal onto a blood agar plate in a reproducible manner. The nasal sample was then spread out onto the entire surface of the plate. One + means 5-100 colonies; two + means more than 100 and three + means confluent growth. The weight was determined every day and the percentage of weight-loss was calculated.
- the percentage weight loss over time was determined.
- FIG. 3 shows that animals vaccinated with EAG+IdeE+IdeE2 lost less weight that control animals. P values were 0.0013, 0.0008 and 0.0009 for days 3, 5 and 6 respectively (Student's t-test). Animals vaccinated with EAG alone also lost weight to a similar magnitude as control animals. Nasal growth of S. equi was also determined daily on a four graded scale.
- FIG. 4 shows that the animals vaccinated with EAG+IdeE+IdeE2 had much less nasal growth than the control group. Again, vaccination with only EAG showed no protection.
- SEQ ID NO: 1 and SEQ ID NO: 14 are combined to show the amino acid sequence of the IdeE2 protein (SEQ ID NO: 1) under the nucleotide sequence of ideE2 (SEQ ID NO: 14)
- SEQ ID NO: 7 and SEQ ID NO: 17 are combined to show the amino acid sequence of the IdeZ2 protein (SEQ ID NO: 7) under the nucleotide sequence of the ideZ2 gene (SEQ ID NO: 17) from S. equi subsp. zooepidemicus
- the nucleotide sequence of the ideE gene (GenBank DQ508733) and the amino acid sequence of the IdeE protein from S. equi subsp. equi are shown.
- nucleotide sequence of the ideZ gene (Genbank DQ826037) and the amino acid sequence of the IdeZ protein from S. equi subsp. zooepidemicus are shown.
- GPLGS DDYQRNATEAYAKEVPHQITSVWTKGVTPLTPEQFRYNNEDVIHA PYLAHQGWYDITKAFDGKDNLLCGAATAGNMLHWWFDQNKTEIEAYLSKH PEKQKIIFNNQELFDLKAAIDTKDSQTNSQLFNYFRDKAFPNLSARQLGV MPDLVLDMFINGYYLNVFKTQSTDVNRPYQDKDKRGGIFDAVFTRGDQTT LLTARHDLKNKGLNDISTIIKQELTEGRALALSHTYANVSISHVINLWGA DFNAEGNLEAIYVTDSDANASIGMKKYFVGINAHRHVAISAKKIEGENIG AQVLGLFTLSSGKDIWQKLS Amino acids in bold originates from the vector.
- the objective of this study was to determine the level of protection conferred on vaccination with Intervacc's new multi-component subunit vaccine following intranasal challenge with wild type S. equi strain 4047 in Welsh Mountain ponies.
- the study has been performed by Animal Health Trust, UK.
- the vaccines used therein, which are designated Nordostrep Septavac or Nordostrep Pentavac A (or only Septavac or Pentavac) are disclosed below.
- the ponies were initially randomised into 3 groups for the vaccination period.
- the Pentavac vaccine consisted of the following five S. equi recombinant proteins: EAG, ScIC, CNE, Eq5 and Eq8.
- EAG S. equi recombinant proteins
- ScIC ScIC
- CNE CNE
- Eq5 Eq5
- Eq8 Eq8
- the five proteins were mixed in PBS (50 ⁇ g/ml of the respective protein), divided in aliquots of 1 ml in vials and stored at ⁇ 20° C.
- the vial was thawed and mixed with 1 ml adjuvant (Abisco 200, 375 ⁇ g/dose, Isconova AB, Sweden).
- PBS 150 ⁇ g/ml of respective protein
- the vial was thawed and mixed with 2 ml adjuvant (Abisco 300, 500 ⁇ g/dose, Isconova AB, Sweden).
- the placebo formulations the S. equi proteins were omitted.
- the placebo for subcutaneous vaccination only contained PBS and Abisco 200, 375 ⁇ g/dose and for intranasal vaccination, the placebo contained only PBS and Abisco 300, 500 ⁇ g/dose.
- the Septavac vaccine consisted of the following seven S. equi recombinant proteins: EAG, ScIC, CNE, Eq5, Eq8, IdeE and IdeE2.
- EAG S. equi recombinant proteins
- ScIC S. equi recombinant proteins
- CNE CNE
- Eq5 Eq8 IdeE
- IdeE2 IdeE2
- IdeE2 IdeE2
- IdeE2 IdeE2
- the seven proteins were mixed in PBS (50 ⁇ g/ml of respective protein) and divided in aliquots of 1 ml in vials and stored at ⁇ 20° C. Immediately before vaccination the vial was thawed and mixed with 1 ml adjuvant (Abisco 200, 375 ⁇ g/dose, Isconova AB, Sweden).
- the seven proteins were mixed in PBS (150 ⁇ g/ml of the respective protein) and divided in aliquots of 2 ml in vials and stored at ⁇ 20° C. Immediately before vaccination, the vial was thawed and mixed with 2 ml adjuvant (Abisco 300, 500 ⁇ g/dose, Isconova AB, Sweden). In the placebo formulations, the S. equi proteins were omitted.
- the placebo for subcutaneous vaccination only contained PBS and Abisco 200, 375 ⁇ g/dose, and for intranasal vaccination, it only contained PBS and Abisco 300, 500 ⁇ g/dose.
- EAG is comprised of the fragment EAG4B and CNE is the fragment designated 2.16.
- the Septavac vaccine was a safe and effective vaccine for the prevention of strangles.
- the invention is not restricted to the Septavac and Pentavac vaccines which have been studied in this Example but many combinations of the present antigens/immunogens are possible candidates for use in vaccine compositions for prevention of strangles.
- Blood and nasal wash samples were taken according to the protocol to determine the equine immune responses to the vaccine subunits. Based on immunogenicity data, one vaccinated group was challenged to quantify the level of protection conferred.
- Each pony was challenged with a total challenge dose of 1 ⁇ 10 8 cfu of S. equi strain 4047 administered via the spraying of a 2 ml culture containing 5 ⁇ 10 7 cfu into both nostrils. This dose regime is believed to optimise the infection rate whilst avoiding overwhelming the host immune response.
- Ponies were carefully monitored for the onset of clinical signs of disease over a period of three weeks post challenge by regular checks, daily physical examination, monitoring of body temperature, the taking of sera to determine seroconversion and the taking of nasal washes for bacteriological analysis. All ponies were subjected to post mortem examination following abscessation or reaching the study endpoint at 3 weeks post challenge to determine the severity of disease pathology according to a scoring system developed at the AHT. Histopathological examination of tissues recovered from the study ponies was used to identify early signs of S. equi infection that were not obvious on post mortem (PM) examination.
- PM post mortem
- the vaccine vials were received by the AHT prior to the first vaccination and stored at ⁇ 20° C. until use in freezer number EQ No. 2305. Placebo (containing no antigens) and adjuvant vials were stored at 4° C. until use in fridge number EQ No. 44.
- vaccines and adjuvants were mixed as stated in the protocol in situ by A Waller, L Prowse or C Robinson at AHT.
- S. equi 4047 was prepared from fresh plates as described in SOP/BACT/25.
- the bacteria grew as expected and the 1:40 diluted culture was harvested when the OD 600nm reached 0.3.
- the growth of the challenge inoculum is shown in FIG. 6 . The following results were obtained.
- Ponies were identified by a microchip in the neck. The 21 ponies were randomly assigned to vaccination groups (Table 3).
- Vaccination groups and pony chip IDs Group Vaccine Pony Chip ID's 1 Septavac 00012, 00159, 00833, 00976, 99123, 99668, 99794 2 Pentavac 01298, 01605, 01724, 99223, 99229, 99773, 99919 3 Placebo 00173, 00427, 01635, 02078, 99549, 99776, 99886
- Ponies in groups 1 and 3 were transferred to the ACVS (Allen Centre), three days prior to challenge to allow acclimatisation. Ponies were separated into two animal rooms according to their vaccination groups, so that ponies from each vaccination group were kept together.
- Vaccinations were given by subcutaneous injection near the retropharyngeal lymph nodes according to AHT SOP/EQU/03 or via intranasal spray according to AHT SOP/EQU/07.
- each pony was challenged by intranasal administration of 2 ml of a fresh S. equi 4047 culture into both nostrils using a flexible tube and spray nozzle according to AHT SOP/BACT32.
- Such a challenge dose was predicted to contain a total of 1 ⁇ 10 8 cfu of S. equi 4047.
- Ponies were examined according to AHT SOP/EQU/02. Each pony was examined clinically on the day of challenge, and on each of the following 21 days for the occurrence of symptoms associated with S. equi infection (demeanor, nasal discharge, lymph node swelling and abscessation, signs of coughing, difficulty swallowing and feeding, and ocular signs).
- Blood samples were taken from the jugular vein according to AHT SOP/EQU/01 and according to the study protocol schedule. Serum was prepared according to AHT SOP/EQU/01 and stored frozen at ⁇ 20° C. or below until use.
- a 500 ⁇ l sample of the nasal wash was added to 500 ⁇ l of Todd-Hewitt Broth in situ at the time of sampling for transportation to the lab to allow quantification of the number of ⁇ -haemolytic streptococci per ml according to AHT SOP/BACT/02.
- the remaining nasal wash sample was centrifuged and the supernatant decanted into a clean 5 ml polypropylene tube and stored at
- Tissue samples were preserved in phosphate buffered formalin and subjected to microscopic examination according to standard techniques and provision of a full and formal report.
- Tissue swabs were taken and the results recorded and used to evaluate the level of S. equi infection.
- Charcoal swabs were taken from each of the areas as stated in the protocol and processed on COBA Streptococcal selective plates to determine the presence of S. equi.
- FIG. 8 There were no obvious differences in nasal score ( FIG. 8 ), lymph node score ( FIG. 9 ) or S. zooepidemicus counts ( FIG. 10 ) between the study groups during the vaccination phase, with the exception of some ponies that had ongoing S. zooepidemicus infections typical of ponies of this age. This resulted in a rise in mean rectal temperature around the original date for V2 (Apr. 3, 2008) as demonstrated in FIG. 7 . Ponies were allowed to recover from this S. zooepidemicus infection and all ponies were vaccinated on Apr. 10, 2008.
- Fibrinogen levels were significantly different between the two study groups on days 6, 8 and 11 post challenge ( FIG. 12 ). All controls developed elevated fibrinogen levels, but only 2 vaccinates (ponies 0976 and 9794) had higher levels.
- Neutrophil levels were also significantly different between the two study groups on days 6, 8 and 11 post challenge ( FIG. 13 ). All controls developed elevated neutrophil levels, but only 1 vaccinate (pony 9794) had higher levels.
- the IgG levels in nasal washings and serum samples of the septavac group were measured using ELISA ( FIGS. 19 and 20 ) showing that the antigens generate mucosal and serum antibodies.
- Ponies 0833 and 0159 showed sparse S. equi in areas other than the lymph node.
- Ponies 0012, 9123 and 9668 showed no S. equi.
- Pentavac A vaccine delayed the onset of infection upon challenge with S. equi and that one of the ponies in the group did not developed strangles.
- One implication of the present invention is that enzymes degrading immunoglobulins can be used as antigens in a vaccine to protect the target animal from infection. Therefore one embodiment of the present invention is that concerning the human pathogenic group A streptococci (GAS) it is possible to construct a vaccine composition which protects humans from infections caused by this bacterium.
- GAS human pathogenic group A streptococci
- Sib35, IdeS or Mac-proteins which share amino acid sequence homologies to IdeE and IdeE2 and therefore in light of the present invention can be purified and used as antigens in a vaccine separately or in combination with other purified extracellular proteins (like M-proteins or M-like proteins or fragments thereof) from group A strains.
- the invention can be used to develop specific antisera, polyclonal or monoclonal antibodies to be used for diagnostic purposes or to be used in passive immunisations of the target animal including humans.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Epidemiology (AREA)
- Mycology (AREA)
- Microbiology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Gastroenterology & Hepatology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Engineering & Computer Science (AREA)
- Communicable Diseases (AREA)
- Oncology (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US12/747,843 US20110020403A1 (en) | 2007-12-13 | 2008-12-12 | immunizing composition |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US1349507P | 2007-12-13 | 2007-12-13 | |
| US8228108P | 2008-07-21 | 2008-07-21 | |
| PCT/SE2008/051445 WO2009075646A1 (en) | 2007-12-13 | 2008-12-12 | Improved immunizing composition |
| US12/747,843 US20110020403A1 (en) | 2007-12-13 | 2008-12-12 | immunizing composition |
Related Parent Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/SE2008/051445 A-371-Of-International WO2009075646A1 (en) | 2007-12-13 | 2008-12-12 | Improved immunizing composition |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US13/893,212 Continuation US9987342B2 (en) | 2007-12-13 | 2013-05-13 | Immunizing composition |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| US20110020403A1 true US20110020403A1 (en) | 2011-01-27 |
Family
ID=40755754
Family Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US12/747,843 Abandoned US20110020403A1 (en) | 2007-12-13 | 2008-12-12 | immunizing composition |
| US13/893,212 Active 2031-08-20 US9987342B2 (en) | 2007-12-13 | 2013-05-13 | Immunizing composition |
Family Applications After (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US13/893,212 Active 2031-08-20 US9987342B2 (en) | 2007-12-13 | 2013-05-13 | Immunizing composition |
Country Status (8)
| Country | Link |
|---|---|
| US (2) | US20110020403A1 (OSRAM) |
| EP (1) | EP2227249B1 (OSRAM) |
| JP (1) | JP2011506433A (OSRAM) |
| CN (1) | CN102026658A (OSRAM) |
| AU (1) | AU2008336295B2 (OSRAM) |
| CA (1) | CA2708260A1 (OSRAM) |
| NZ (1) | NZ586367A (OSRAM) |
| WO (1) | WO2009075646A1 (OSRAM) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN115443288A (zh) * | 2020-06-18 | 2022-12-06 | 上海宝济药业有限公司 | 一种免疫球蛋白降解酶IdeE的突变体 |
Families Citing this family (12)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2011059385A1 (en) * | 2009-11-13 | 2011-05-19 | Bengt Guss | Immunizing composition for reducing streptococcal infections |
| US9333252B2 (en) | 2010-05-26 | 2016-05-10 | Intervacc Ab | Vaccine against streptococcal infections based on recombinant proteins |
| EP2949340A1 (en) * | 2014-05-30 | 2015-12-02 | IDT Biologika GmbH | Vaccine composition against Streptococcus suis infection |
| GB201502306D0 (en) | 2015-02-12 | 2015-04-01 | Hansa Medical Ab | Protein |
| GB201502305D0 (en) | 2015-02-12 | 2015-04-01 | Hansa Medical Ab | Protein |
| EP4321178A4 (en) * | 2021-04-05 | 2024-10-02 | Lg Chem, Ltd. | VACCINE COMPOSITION AGAINST CORONAVIRUS |
| JP2024547125A (ja) | 2021-12-22 | 2024-12-26 | 上海宝済薬業股▲ふん▼有限公司 | 免疫グロブリン分解酵素IdeEの変異体の用途 |
| CN114437235B (zh) * | 2022-01-04 | 2024-02-09 | 中国农业科学院哈尔滨兽医研究所(中国动物卫生与流行病学中心哈尔滨分中心) | 马链球菌马亚种8种蛋白的重组融合蛋白及其制备方法和应用 |
| WO2024108137A2 (en) | 2022-11-18 | 2024-05-23 | Seismic Therapeutic, Inc. | Fc fusion molecules and uses thereof |
| JP2026501731A (ja) | 2023-01-06 | 2026-01-16 | サイズミック セラピューティク インコーポレイテッド | プロテアーゼ変異体及びその使用 |
| WO2025054602A1 (en) * | 2023-09-08 | 2025-03-13 | The Texas A&M University System | Protein for the serological detection of streptococcus equi subspecies equi exposure or infection |
| CN118497176B (zh) * | 2024-07-16 | 2025-01-21 | 苏州康聚生物科技有限公司 | 一种免疫球蛋白降解酶 |
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6120775A (en) * | 1997-07-29 | 2000-09-19 | Akzo Nobel N.V. | Streptococcus equi vaccine |
| US20060140980A1 (en) * | 2002-10-11 | 2006-06-29 | Beng Guss | Immunization of non-human mammals against streptococcus equi |
| US20070243195A1 (en) * | 2006-03-29 | 2007-10-18 | Minke Jules M | Vaccine against streptococci |
Family Cites Families (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| AR241545A1 (es) | 1985-07-12 | 1992-08-31 | Cornell Res Foundation Inc | Un metodo para preparar una cepa de s. equi avirulenta a.t.c.c. 53186 para equinos. |
| US5583014A (en) | 1990-07-03 | 1996-12-10 | Bayer Corporation | Preparation and use of enzyme-detergent extracted Streptococcus zoopidemicus vaccine |
| SE9003374D0 (sv) | 1990-10-22 | 1990-10-22 | Alfa Laval Agri Int | A collagen binding protein as well as its preparation |
| SE9302855D0 (sv) | 1993-09-06 | 1993-09-06 | Martin Lindberg | Method and means for producing plasmaproteinase inhibitor binding proteins |
| IES76925B2 (en) | 1996-07-03 | 1997-11-19 | Provost | Subunit Vaccine for Streptococcus Equi |
| SE9804491D0 (sv) | 1998-12-22 | 1998-12-22 | Bengt Guss | Novel fibronectin-binding protein |
| WO2000076540A2 (en) * | 1999-06-10 | 2000-12-21 | Med Immune, Inc. | Streptococcus pneumoniae proteins and vaccines |
| US6887480B1 (en) | 1999-06-10 | 2005-05-03 | Medimmune, Inc. | Streptococcus pneumoniae proteins and vaccines |
-
2008
- 2008-12-12 AU AU2008336295A patent/AU2008336295B2/en not_active Ceased
- 2008-12-12 EP EP08858722.5A patent/EP2227249B1/en active Active
- 2008-12-12 WO PCT/SE2008/051445 patent/WO2009075646A1/en not_active Ceased
- 2008-12-12 US US12/747,843 patent/US20110020403A1/en not_active Abandoned
- 2008-12-12 CN CN2008801269094A patent/CN102026658A/zh active Pending
- 2008-12-12 JP JP2010537898A patent/JP2011506433A/ja active Pending
- 2008-12-12 NZ NZ586367A patent/NZ586367A/en unknown
- 2008-12-12 CA CA2708260A patent/CA2708260A1/en not_active Abandoned
-
2013
- 2013-05-13 US US13/893,212 patent/US9987342B2/en active Active
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6120775A (en) * | 1997-07-29 | 2000-09-19 | Akzo Nobel N.V. | Streptococcus equi vaccine |
| US20060140980A1 (en) * | 2002-10-11 | 2006-06-29 | Beng Guss | Immunization of non-human mammals against streptococcus equi |
| US20070243195A1 (en) * | 2006-03-29 | 2007-10-18 | Minke Jules M | Vaccine against streptococci |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN115443288A (zh) * | 2020-06-18 | 2022-12-06 | 上海宝济药业有限公司 | 一种免疫球蛋白降解酶IdeE的突变体 |
Also Published As
| Publication number | Publication date |
|---|---|
| AU2008336295B2 (en) | 2013-07-11 |
| CA2708260A1 (en) | 2009-06-18 |
| JP2011506433A (ja) | 2011-03-03 |
| US9987342B2 (en) | 2018-06-05 |
| NZ586367A (en) | 2012-04-27 |
| WO2009075646A1 (en) | 2009-06-18 |
| CN102026658A (zh) | 2011-04-20 |
| EP2227249B1 (en) | 2018-04-25 |
| EP2227249A4 (en) | 2011-08-31 |
| US20140220064A1 (en) | 2014-08-07 |
| AU2008336295A1 (en) | 2009-06-18 |
| EP2227249A1 (en) | 2010-09-15 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US9987342B2 (en) | Immunizing composition | |
| US9795664B2 (en) | Vaccine against streptococcal infections based on recombinant proteins | |
| US10188717B2 (en) | Vaccines and compositions against Streptococcus pneumoniae | |
| CN113769076A (zh) | 抗猪链球菌感染的疫苗组合物 | |
| JP2023503057A (ja) | ヘモフィルス・パラスイスに対する新規ワクチン | |
| JP2025174963A (ja) | ヘモフィルス・パラスイスに対する新規ワクチン | |
| EP2646049B1 (en) | Composition for immunization against streptococcus pneumoniae | |
| CA2501621C (en) | Immunization of non-human mammals against streptococcus equi | |
| US20120225079A1 (en) | Immunizing composition for reducing streptococcal infections | |
| HK1156230A (en) | Improved immunizing composition | |
| BRAMBILA et al. | Two outer membrane lipoproteins from histophilus somni are Immunogenic in rabbits and sheep and induce protection against bacterial challenge in mice | |
| HK1183677B (en) | Vaccine against streptococcal infections based on recombinant proteins | |
| TW202219269A (zh) | 新型多殺性巴斯德氏菌株及具有hyaC與nanP缺失之疫苗 | |
| AU2013205101A1 (en) | Improved immunizing composition | |
| HK1085646B (en) | Antigenic compositions for immunization of non-human mammals against streptococcus equi |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| AS | Assignment |
Owner name: INTERVACC AB, SWEDEN Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:GUSS, BENGT;FLOCK, JAN-INGMAR;FRYKBERG, LARS;AND OTHERS;SIGNING DATES FROM 20100819 TO 20100824;REEL/FRAME:025123/0477 |
|
| STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |