US20100316651A1 - Cardiovascular related uses of il-1beta antibodies and binding fragments thereof - Google Patents

Cardiovascular related uses of il-1beta antibodies and binding fragments thereof Download PDF

Info

Publication number
US20100316651A1
US20100316651A1 US12/790,738 US79073810A US2010316651A1 US 20100316651 A1 US20100316651 A1 US 20100316651A1 US 79073810 A US79073810 A US 79073810A US 2010316651 A1 US2010316651 A1 US 2010316651A1
Authority
US
United States
Prior art keywords
antibody
subject
binding
cardiovascular event
cardiovascular
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Abandoned
Application number
US12/790,738
Other languages
English (en)
Inventor
Patrick J. Scannon
Alan M. Solinger
Jeffrey D. Feldstein
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Xoma US LLC
Original Assignee
Xoma Technology Ltd USA
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Xoma Technology Ltd USA filed Critical Xoma Technology Ltd USA
Priority to US12/790,738 priority Critical patent/US20100316651A1/en
Assigned to XOMA TECHNOLOGY LTD. reassignment XOMA TECHNOLOGY LTD. ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: FELDSTEIN, JEFFREY D., SOLINGER, ALAN M., SCANNON, PATRICK J.
Publication of US20100316651A1 publication Critical patent/US20100316651A1/en
Assigned to XOMA (US) LLC reassignment XOMA (US) LLC ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: XOMA TECHNOLOGY LTD.
Priority to US15/647,203 priority patent/US10611832B2/en
Assigned to SILICON VALLEY BANK reassignment SILICON VALLEY BANK SECURITY INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: XOMA TECHNOLOGY LTD.
Assigned to SILICON VALLEY BANK reassignment SILICON VALLEY BANK SECURITY INTEREST Assignors: XOMA (US) LLC
Priority to US16/799,707 priority patent/US20210009679A1/en
Assigned to XOMA (US) LLC reassignment XOMA (US) LLC PARTIAL RELEASE OF SECURITY INTEREST Assignors: SILICON VALLEY BANK
Assigned to XOMA TECHNOLOGY LTD. reassignment XOMA TECHNOLOGY LTD. RELEASE OF SECURITY INTEREST Assignors: SILICON VALLEY BANK
Abandoned legal-status Critical Current

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/24Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
    • C07K16/244Interleukins [IL]
    • C07K16/245IL-1
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • A61P9/04Inotropic agents, i.e. stimulants of cardiac contraction; Drugs for heart failure
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • A61P9/10Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • A61P9/12Antihypertensives
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/545Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum

Definitions

  • the present disclosure relates generally to IL-1 ⁇ binding molecules (e.g., IL-1 ⁇ binding antibodies and fragments thereof) for the reduction, prevention or treatment of cardiovascular events and/or cardiovascular diseases (e.g., acute cardiovascular disease or chronic cardiovascular disease).
  • IL-1 ⁇ binding molecules e.g., IL-1 ⁇ binding antibodies and fragments thereof
  • cardiovascular diseases e.g., acute cardiovascular disease or chronic cardiovascular disease.
  • Inflammation has become a central theme in the pathogenesis of cardiovascular disease over the past decade, and a wide range of cardiac diseases has been associated with inflammation and cytokine modulation (Mehra et al., 2005, J. Leukocyte Biol. 78:805-818).
  • Proinflammatory cytokines may be secreted by every nucleated cell type in the myocardium, including the cardiac myocyte, in response to various forms of stress/injury. They are elevated in conditions as diverse as inflammatory myocarditis, allograft rejection, cardiac ischemic states, congestive heart failure (CHF), and reperfusion injury.
  • IL-1 ⁇ is a pro-inflammatory cytokine secreted by a number of different cell types including monocytes and macrophages. When released as part of an inflammatory reaction, IL-1 ⁇ produces a range of biological effects, mainly mediated through induction of other inflammatory mediators such as corticotrophin, platelet factor-4, prostaglandin E2 (PGE2), IL-6, and IL-8. IL-1 ⁇ induces both local and systemic inflammatory effects through the activation of the IL-1 receptor found on almost all cell types.
  • the interleukin-1 (IL-1) family of cytokines has been implicated in a number of disease states. IL-1 family members include IL-1 ⁇ , IL-1 ⁇ , and IL-1Ra.
  • each of these cytokines is different, being expressed by a different gene and having a different primary amino acid sequence. Furthermore, the physiological activities of these cytokines can be distinguished from each other.
  • the present disclosure relates generally to IL-1 ⁇ binding molecules (e.g., IL-1 ⁇ binding antibodies and fragments thereof) for the reduction, prevention or treatment of cardiovascular events and/or cardiovascular diseases, including acute cardiovascular disease or chronic cardiovascular disease.
  • IL-1 ⁇ binding molecules e.g., IL-1 ⁇ binding antibodies and fragments thereof
  • the present disclosure also relates to methods for prevention or treatment of cardiovascular events and/or cardiovascular diseases, including by reducing a cardiovascular event or disease.
  • the present disclosure provides methods of reducing a cardiovascular event in a subject, comprising administering to said subject a therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof, wherein the subject is a subject with a history of a previous cardiovascular event or a history of at least one risk factor for cardiovascular disease, and wherein the cardiovascular event is myocardial infarction, stroke, cardiovascular death, congestive heart failure, cardiac arrest, acute coronary syndrome, angina, or a revascularization procedure.
  • the present disclosure provides methods of reducing a cardiovascular event (e.g., delaying time to event, reducing likelihood or risk of event, preventing an event, reducing severity of event, reducing time to recovery) in a subject with a history of at least one risk factor for cardiovascular disease, comprising administering to said subject a therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof, and wherein the cardiovascular event is myocardial infarction, stroke, cardiovascular death, congestive heart failure, cardiac arrest, acute coronary syndrome, angina, or a revascularization procedure.
  • a cardiovascular event e.g., delaying time to event, reducing likelihood or risk of event, preventing an event, reducing severity of event, reducing time to recovery
  • the present disclosure also provides methods of reducing a cardiovascular event (e.g., delaying time to event, reducing likelihood or risk of event, preventing an event, reducing severity of event, reducing time to recovery) in a subject with a history of a previous cardiovascular event, comprising administering to said subject a therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof, and wherein said cardiovascular event is myocardial infarction, stroke, cardiovascular death, congestive heart failure, cardiac arrest, acute coronary syndrome, angina or a revascularization procedure.
  • the previous cardiovascular event is a first cardiovascular event.
  • the previous or first cardiovascular event is selected from the group consisting of myocardial infarction, stroke, congestive heart failure, acute coronary syndrome, angina and a revascularization procedure.
  • the previous or first cardiovascular event is myocardial infarction or acute coronary syndrome.
  • the myocardial infarction is myocardial infarction with ST elevation (e.g., ST-segment elevation myocardial infarction, STEMI).
  • ST elevation e.g., ST-segment elevation myocardial infarction, STEMI
  • the myocardial infarction is myocardial infarction without ST elevation (e.g., non-ST-segment elevation myocardial infarction, NSTEMI).
  • the presence or absence of ST elevation is determined by electrocardiogram (e.g., ECG, EKG).
  • the method of reducing a cardiovascular event is a method of reducing a second or subsequent cardiovascular event.
  • the cardiovascular event e.g., second or subsequent cardiovascular event
  • the cardiovascular event is selected from the group consisting of myocardial infarction, stroke, cardiovascular death, congestive heart failure, cardiac arrest, acute coronary syndrome, angina and a revascularization procedure.
  • the first cardiovascular event and second cardiovascular event are the same types of cardiovascular events. In some embodiments, the first cardiovascular event and second cardiovascular event are different types of cardiovascular events.
  • the revascularization procedure is a coronary, carotid or peripheral arterial revascularization procedure.
  • the coronary, carotid or peripheral arterial revascularization procedure is a percutaneous coronary intervention (PCI), a stent implant, coronary artery bypass graft (CABG), carotid endarterectomy, peripheral vascular disease bypass surgery, or peripheral angioplasty surgery.
  • PCI percutaneous coronary intervention
  • CABG coronary artery bypass graft
  • carotid endarterectomy carotid endarterectomy
  • peripheral vascular disease bypass surgery or peripheral angioplasty surgery.
  • said subject also has a history of at least one risk factor for cardiovascular disease.
  • the risk factor is manifest coronary heart disease, coronary artery disease, thrombosis, transient ischaemic attack, left ventricular hypertrophy, arteriosclerosis, restenosis, tobacco smoking or peripheral vascular disease.
  • the risk factor is elevated triglycerides, systemic inflammation, high blood phosphorus levels, high parathyroid hormone levels, microalbuminuria, or high homocysteine levels.
  • the risk factor is obesity, hyperglycemia, chronic renal failure, high blood glucose, chronic kidney disease, or metabolic syndrome.
  • the risk factor is end stage renal disease.
  • the risk factor is hypertension, dyslipidemia, hyperlipidemia, elevated total cholesterol, elevated LDL cholesterol, or low HDL cholesterol or atherosclerosis.
  • the hypertension is manifested as a blood pressure of greater than or equal to 180/110 mm Hg.
  • the hypertension is mild-to-moderate, with systolic blood pressure (SBP) of 140 to 180 mm Hg and/or diastolic blood pressure (DBP) of 90 to 110 mm Hg.
  • SBP systolic blood pressure
  • DBP diastolic blood pressure
  • the subject has elevated levels of C-reactive protein (CRP).
  • CRP C-reactive protein
  • the subject is older than 55 years.
  • the subject is older than 65 years.
  • the subject is non-hypertensive.
  • the subject has poorly controlled hypertension.
  • the subject has an arrhythmia.
  • the subject has a “Type A” personality.
  • the subject has a sedentary lifestyle.
  • the subject has diabetes mellitus.
  • said diabetes mellitus is Type 2 diabetes.
  • the subject has a history of two or more said risk factors.
  • the subject has a history of three or more said risk factors.
  • administering said therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof is sufficient to achieve a decrease in CRP levels.
  • the present disclosure also provides methods of reducing mortality following a cardiovascular event in a subject, comprising administering to said subject a therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof.
  • the cardiovascular event is myocardial infarction, stroke, congestive heart failure, acute coronary syndrome, angina or a revascularization procedure. In some embodiments, the cardiovascular event is myocardial infarction or acute coronary syndrome. In some embodiments, the myocardial infarction is myocardial infarction with ST elevation (e.g., ST-segment elevation myocardial infarction, STEMI). In some embodiments, the myocardial infarction is myocardial infarction without ST elevation (e.g., non-ST-segment elevation myocardial infarction, NSTEMI). In some embodiments the presence or absence of ST elevation is determined by electrocardiogram (e.g., ECG, EKG).
  • electrocardiogram e.g., ECG, EKG
  • the revascularization procedure is a coronary, carotid or peripheral arterial revascularization procedure.
  • the coronary, carotid or peripheral arterial revascularization procedure is a percutaneous coronary intervention (PCI), a stent implant, coronary artery bypass graft (CABG), carotid endarterectomy, peripheral vascular disease bypass surgery, or peripheral angioplasty surgery.
  • PCI percutaneous coronary intervention
  • CABG coronary artery bypass graft
  • carotid endarterectomy carotid endarterectomy
  • peripheral vascular disease bypass surgery or peripheral angioplasty surgery.
  • the subject does not have Type 2 diabetes.
  • the subject has survived a previous cardiovascular event of myocardial infarction or stroke.
  • the occurrence of said cardiovascular event is a reoccurrence of a cardiovascular event of myocardial infarction or stroke.
  • the subject has a history of one or more risk factors for cardiovascular disease.
  • the risk factor is manifest coronary heart disease, coronary artery disease, thrombosis, transient ischaemic attack, left ventricular hypertrophy, arteriosclerosis, restenosis, tobacco smoking or peripheral vascular disease.
  • the risk factor is elevated triglycerides, systemic inflammation, high blood phosphorus levels, high parathyroid hormone levels, microalbuminuria, or high homocysteine levels.
  • the risk factor is obesity, hyperglycemia, chronic renal failure, high blood glucose, chronic kidney disease, or metabolic syndrome.
  • the risk factor is end stage renal disease.
  • the risk factor is hypertension, dyslipidemia, hyperlipidemia, elevated total cholesterol, elevated LDL cholesterol, or low HDL cholesterol or atherosclerosis.
  • the hypertension is manifested as a blood pressure of greater than or equal to 180/110 mm Hg.
  • the hypertension is mild-to-moderate, with systolic blood pressure (SBP) of 140 to 180 mm Hg and/or diastolic blood pressure (DBP) of 90 to 110 mm Hg.
  • SBP systolic blood pressure
  • DBP diastolic blood pressure
  • the subject is non-hypertensive.
  • the subject has poorly controlled hypertension.
  • the subject has an arrhythmia.
  • the subject has a “Type A” personality.
  • the subject has a sedentary lifestyle.
  • the subject has a history of two or more said risk factors.
  • the subject has a history of three or more said risk factors.
  • the subject is a patient with cardiovascular disease, including acute cardiovascular disease (e.g., not associated with congestive heart failure) or chronic cardiovascular disease (e.g., associated with multiple risk factors for atherosclerotic cardiovascular disease).
  • acute cardiovascular disease e.g., not associated with congestive heart failure
  • chronic cardiovascular disease e.g., associated with multiple risk factors for atherosclerotic cardiovascular disease
  • administering said therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof is sufficient to achieve a decrease in CRP levels.
  • the present disclosure also provides methods of reducing a cardiovascular event in a subject with a history of at least one risk factor for cardiovascular disease, comprising administering to said subject a therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof, and wherein said risk factor is not Type 2 diabetes, obesity, hyperglycemia, dyslipidemia, hyperlipidemia, chronic renal failure, high blood glucose, chronic kidney disease, hypertension, atherosclerosis or metabolic syndrome.
  • the cardiovascular event is myocardial infarction, stroke, cardiac arrest, congestive heart failure, cardiovascular death, acute coronary syndrome (e.g., diagnosed), angina or a revascularization procedure.
  • the revascularization procedure is a coronary, carotid or peripheral arterial revascularization procedure.
  • the coronary, carotid or peripheral arterial revascularization procedure is a percutaneous coronary intervention (PCI), a stent implant, coronary artery bypass graft (CABG), carotid endarterectomy, peripheral vascular disease bypass surgery, or peripheral angioplasty surgery.
  • PCI percutaneous coronary intervention
  • CABG coronary artery bypass graft
  • CABG coronary artery bypass graft
  • carotid endarterectomy peripheral vascular disease bypass surgery
  • peripheral angioplasty surgery peripheral angioplasty surgery.
  • the risk factor is manifest coronary heart disease, coronary artery disease, thrombosis, transient ischaemic attack, left ventricular hypertrophy, arteriosclerosis, restenosis, tobacco smoking or peripheral vascular disease.
  • the risk factor is elevated triglycerides, systemic inflammation, high blood phosphorus levels, high parathyroid hormone levels, microalbuminuria, or high homocysteine levels.
  • the subject has elevated levels of C-reactive protein (CRP).
  • CRP C-reactive protein
  • the subject is older than 55 years.
  • the subject is older than 65 years.
  • the subject has a history of two or more said risk factors.
  • the subject has a history of three or more said risk factors.
  • the subject is a patient with cardiovascular disease, including acute cardiovascular disease (e.g., not associated with congestive heart failure) or chronic cardiovascular disease (e.g., associated with multiple risk factors for atherosclerotic cardiovascular disease).
  • acute cardiovascular disease e.g., not associated with congestive heart failure
  • chronic cardiovascular disease e.g., associated with multiple risk factors for atherosclerotic cardiovascular disease
  • administering said therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof is sufficient to achieve a decrease in CRP levels.
  • the present disclosure also provides methods of treating a cardiovascular event in a subject, wherein the cardiovascular event is myocardial infarction, stroke, congestive heart failure, acute coronary syndrome or angina, comprising administering to said subject a therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof and at least one other pharmaceutical composition comprising an active agent other than an IL-1 ⁇ antibody or fragment.
  • the cardiovascular event is myocardial infarction or acute coronary syndrome.
  • the myocardial infarction is myocardial infarction with ST elevation (e.g., ST-segment elevation myocardial infarction, STEMI).
  • the myocardial infarction is myocardial infarction without ST elevation (e.g., non-ST-segment elevation myocardial infarction, NSTEMI).
  • the presence or absence of ST elevation is determined by electrocardiogram (e.g., ECG, EKG).
  • the active agent of said at least one other pharmaceutical composition is a cholesterol lowering agent, a statin, an HMG-CoA reductase inhibitor, a calcium channel blocker, a beta blocker, an antihypertensive, a diuretic, aspirin, niacin, an angiotensin-converting enzyme (ACE) inhibitor, an angiotensin II receptor blocker, a vasodilator, an anticoagulant, a inhibitor of platelet aggregation, a thrombolytic or digitalis.
  • ACE angiotensin-converting enzyme
  • the present disclosure also provides methods of treating a cardiovascular event in a subject, wherein the cardiovascular event is myocardial infarction, stroke, congestive heart failure, acute coronary syndrome or angina, comprising administering to said subject a therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof and (e.g., in conjunction with) a revascularization procedure.
  • the cardiovascular event is myocardial infarction or acute coronary syndrome.
  • the myocardial infarction is myocardial infarction with ST elevation (e.g., ST-segment elevation myocardial infarction, STEMI).
  • the myocardial infarction is myocardial infarction without ST elevation (e.g., non-ST-segment elevation myocardial infarction, NSTEMI).
  • the presence or absence of ST elevation is determined by electrocardiogram (e.g., ECG, EKG).
  • the revascularization procedure is a coronary, carotid or peripheral arterial revascularization procedure.
  • the present disclosure also provides methods of treating cardiovascular disease, including, for example, acute cardiovascular disease or chronic cardiovascular disease, in a subject, comprising administering to said subject a therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof and (e.g., in conjunction with) a revascularization procedure.
  • administering said therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof is sufficient to achieve a reduction in the relative risk (e.g., lower risk, frequency, incidence, severity) of MACE (major adverse cardiac event, e.g., myocardial infarction, stroke, death, such as CV death, and/or composite thereof), including, for example, in patients with cardiovascular disease, such as acute cardiovascular disease or chronic cardiovascular disease, or in patients with multiple risk factors for atherosclerotic cardiovascular disease (e.g., age 55, age 65, plus one or more of: CABG, NSTEMI, hypertension, elevated cholesterol or on statins, elevated CRP, prior history of Myocardial infarction/stroke no less than 6 months, prior history of ACS or TIA, smoking, history of PCI, type 2 diabetes).
  • MACE major adverse cardiac event, e.g., myocardial infarction, stroke, death, such as CV death, and/or composite thereof
  • cardiovascular disease such as acute cardiovascular disease or chronic cardiovascular disease
  • administering said therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof is sufficient to achieve an in time to first MACE event, revascularization procedures (e.g., CABG), all cause mortality, peripheral vascular disease, first documented angina endpoint, hospitalization for congestive heart failure (CHF), decrease in number of hospital visits, duration of hospital stay, rehospitalization for ischemic events (e.g., angina and/or CHF), infarct size, diastolic volume, ejection fraction or use of diuretics.
  • revascularization procedures e.g., CABG
  • all cause mortality e.g., peripheral vascular disease, first documented angina endpoint
  • hospitalization for congestive heart failure (CHF) e.g., congestive heart failure
  • CHF congestive heart failure
  • ischemic events e.g., angina and/or CHF
  • infarct size diastolic volume, ejection fraction or use of diuretics.
  • administering said therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof is sufficient to achieve plaque regression, plaque stabilization and/or inhibition of plaque rupture.
  • administering said therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof is sufficient to achieve a decrease in CRP levels, BNP levels, troponin levels, C-peptide levels, LDL levels, blood pressure or blood sugar (HbA1c).
  • administering said therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof is sufficient to achieve a decrease or no increase in SAE, malignancy, hypoglycemia, serious infection rate, infection rate, immunogenicity or heart failure.
  • the present disclosure also provides methods of reducing restenosis in a subject following a revascularization procedure, comprising administering to said subject a therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof.
  • the revascularization procedure is a coronary, carotid or peripheral arterial revascularization procedure.
  • administering said therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof is sufficient to achieve a decrease in CRP levels.
  • the present disclosure also provides methods of treating acute hypertension in a subject comprising administering to said subject a therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof and one or more antihypertensive agents.
  • the subject has a blood pressure of greater than or equal to 180/110 mm Hg.
  • the subject has mild-to-moderate hypertension, with systolic blood pressure (SBP) of 140 to 180 mm Hg and/or diastolic blood pressure (DBP) of 90 to 110 mm Hg.
  • SBP systolic blood pressure
  • DBP diastolic blood pressure
  • the antihypertensive agent is administered intravenously.
  • the antihypertensive agent is selected from the group consisting of alpha/beta-adrenergic blocking agents, angiotensin-converting enzyme inhibitors, angiotensin II receptor antagonists, antiadrenergic agents, beta-adrenergic blocking agents, calcium-channel blocking agents, diuretics, and vasodilators.
  • the antihypertensive agent is carvedilol, labetalol, benazepril, captopril, enalapril, fosinopril, lisinopril, moexipril, perindopril, quinapril, ramipril, trandolapril, candesartan, eprosartan, irbesartan, losartan, telmisartan, valsartan, clonidine, doxazosin, guanabenz, guanadrel, guanethidine, guanfacine, mecamylamine, methyldopa, prazosin, reserpine, terazosin, acebutolol, atenolol, betaxolol, bisoprolol, carteolol, metoprolol, nadolol, penbutolol, pind
  • the present disclosure also provides methods of reducing, preventing or treating a cardiovascular event or disease (e.g., acute cardiovascular disease or chronic cardiovascular disease) in a subject comprising administering to the subject an anti-IL-1 ⁇ binding antibody or binding fragment thereof in combination with (e.g., in conjunction with) (e.g., before, during or after) a medical or surgical intervention.
  • a cardiovascular event or disease e.g., acute cardiovascular disease or chronic cardiovascular disease
  • Such antibodies may be administered in therapeutically effective amounts.
  • Such interventions may be therapeutically effective.
  • a medical intervention is an active agent, such as a drug or a biologic, including, for example, any one or more of the active agents described herein.
  • a medical intervention is an out-patient medical treatment or procedure.
  • a medical intervention is an in-patient hospitalization.
  • a surgical intervention is a revascularization procedure, including, for example, any one or more of the revascularization procedures described herein.
  • a surgical intervention involves a heart valve repair or replacement, coronary bypass surgery, heart transplant or heart pump.
  • a surgical intervention involves a biventricular cardiac pacemaker, internal cardiac defibrillator (ICD) or myectomy.
  • a medical intervention is smoking cessation medication or smoking cessation counseling.
  • the present disclosure also provides methods of reducing a cardiovascular event in a subject with a history of at least one risk factor for cardiovascular disease, comprising (a) identifying, diagnosing or selecting the subject with the history of at least one risk factor for cardiovascular disease and (b) administering to the subject a therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof, and wherein the cardiovascular event is myocardial infarction, stroke, cardiovascular death, congestive heart failure, cardiac arrest, acute coronary syndrome, angina, or a revascularization procedure.
  • the present disclosure also provides methods of reducing a cardiovascular event in a subject with a history of a previous cardiovascular event, comprising (a) identifying, diagnosing or selecting the subject with the history of the previous cardiovascular event and (b) administering to the subject a therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof, and wherein the cardiovascular event is myocardial infarction, stroke, acute coronary syndrome, angina or a revascularization procedure.
  • the previous cardiovascular event is a first cardiovascular event.
  • the previous or first cardiovascular event is selected from the group consisting of myocardial infarction, stroke, congestive heart failure, acute coronary syndrome, angina and a revascularization procedure.
  • the previous or first cardiovascular event is myocardial infarction or acute coronary syndrome.
  • the myocardial infarction is myocardial infarction with ST elevation (e.g., ST-segment elevation myocardial infarction, STEMI).
  • the myocardial infarction is myocardial infarction without ST elevation (e.g., non-ST-segment elevation myocardial infarction, NSTEMI).
  • the presence or absence of ST elevation is determined by electrocardiogram (e.g., ECG, EKG).
  • the method of reducing a cardiovascular event is a method of reducing a second or subsequent cardiovascular event.
  • the cardiovascular event (e.g., second or subsequent cardiovascular event) is selected from the group consisting of myocardial infarction, stroke, cardiovascular death, congestive heart failure, cardiac arrest, acute coronary syndrome, angina and a revascularization procedure.
  • the first cardiovascular event and second cardiovascular event are the same types of cardiovascular events. In some embodiments, the first cardiovascular event and second cardiovascular event are different types of cardiovascular events.
  • the present disclosure also provides methods of reducing mortality following a cardiovascular event in a subject, comprising (a) identifying, diagnosing or selecting the subject having the cardiovascular event and (b) administering to the subject a therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof.
  • the cardiovascular event is selected from the group consisting of myocardial infarction, stroke, congestive heart failure, acute coronary syndrome, angina and a revascularization procedure.
  • the cardiovascular event is myocardial infarction or acute coronary syndrome.
  • the myocardial infarction is myocardial infarction with ST elevation (e.g., ST-segment elevation myocardial infarction, STEMI).
  • the myocardial infarction is myocardial infarction without ST elevation (e.g., non-ST-segment elevation myocardial infarction, NSTEMI).
  • ST elevation e.g., non-ST-segment elevation myocardial infarction, NSTEMI
  • the presence or absence of ST elevation is determined by electrocardiogram (e.g., ECG, EKG).
  • the present disclosure also provides methods of reducing a cardiovascular event in a subject with a history of at least one risk factor for cardiovascular disease, comprising (a) identifying, diagnosing or selecting the subject with the history of at least one risk factor for cardiovascular disease and (b) administering to the subject a therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof, and wherein the risk factor is not Type 2 diabetes, obesity, hyperglycemia, dyslipidemia, hyperlipidemia, chronic renal failure, high blood glucose, chronic kidney disease, hypertension, atherosclerosis or metabolic syndrome.
  • the cardiovascular event is selected from the group consisting of myocardial infarction, stroke, cardiovascular death, congestive heart failure, cardiac arrest, acute coronary syndrome, angina and a revascularization procedure.
  • the present disclosure also provides methods of treating a cardiovascular event in a subject, wherein the cardiovascular event is myocardial infarction, stroke, congestive heart failure, acute coronary syndrome or angina, comprising (a) identifying, diagnosing or selecting the subject with the cardiovascular event and (b) administering to the subject a therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof and at least one other pharmaceutical composition comprising an active agent other than an IL-1 ⁇ antibody or fragment.
  • the previous or first cardiovascular event is myocardial infarction or acute coronary syndrome.
  • the myocardial infarction is myocardial infarction with ST elevation (e.g., ST-segment elevation myocardial infarction, STEMI).
  • the myocardial infarction is myocardial infarction without ST elevation (e.g., non-ST-segment elevation myocardial infarction, NSTEMI).
  • ST elevation e.g., non-ST-segment elevation myocardial infarction, NSTEMI
  • the presence or absence of ST elevation is determined by electrocardiogram (e.g., ECG, EKG).
  • the present disclosure also provides methods for treating a cardiovascular event in a subject, wherein the cardiovascular event is myocardial infarction, stroke, congestive heart failure, acute coronary syndrome or angina, comprising (a) identifying, diagnosing or selecting the subject with the cardiovascular event and (b) administering to the subject a therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof and (e.g., in conjunction with) a revascularization procedure.
  • the previous or first cardiovascular event is myocardial infarction or acute coronary syndrome.
  • the myocardial infarction is myocardial infarction with ST elevation (e.g., ST-segment elevation myocardial infarction, STEMI).
  • the myocardial infarction is myocardial infarction without ST elevation (e.g., non-ST-segment elevation myocardial infarction, NSTEMI).
  • ST elevation e.g., non-ST-segment elevation myocardial infarction, NSTEMI
  • the presence or absence of ST elevation is determined by electrocardiogram (e.g., ECG, EKG).
  • the present disclosure also provides methods of reducing restenosis in a subject following a revascularization procedure, comprising (a) identifying, diagnosing or selecting the subject with the revascularization procedure and (b) administering to the subject a therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof.
  • the present disclosure also provides methods of treating acute hypertension in a subject comprising (a) identifying, diagnosing or selecting the subject with acute hypertension and (b) administering to the subject a therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof and one or more antihypertensive agents.
  • the hypertension is manifested as a blood pressure of greater than or equal to 180/110 mm Hg.
  • the hypertension is mild-to-moderate, with systolic blood pressure (SBP) of 140 to 180 mm Hg and/or diastolic blood pressure (DBP) of 90 to 110 mm Hg.
  • SBP systolic blood pressure
  • DBP diastolic blood pressure
  • administering said therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof may be sufficient to achieve a decrease in CRP levels.
  • the present disclosure also provides pharmaceutical compositions for use in any and/or all of the aforementioned methods, including for example, for the reduction, prevention or treatment of cardiovascular events and/or cardiovascular diseases, including acute cardiovascular disease or chronic cardiovascular disease, by administering a therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof.
  • IL-1 ⁇ binding antibodies and binding fragments thereof as well as suitable dose amounts and dosing regimens that may be used in or with any and/or all of the aforementioned methods and pharmaceutical compositions.
  • the antibody or fragment binds to human IL-1 ⁇ with a dissociation constant of about 1 nM or less. In some embodiments, the antibody or fragment binds to human IL-1 ⁇ with a dissociation constant of about 500 pM or less. In some embodiments, the anti-IL-1 ⁇ binding antibody or binding fragment thereof binds to human IL-1 ⁇ with a dissociation constant of about 250 pM or less. In some embodiments, the anti-IL-1 ⁇ binding antibody or binding fragment thereof binds to human IL-1 ⁇ with a dissociation constant of about 100 pM or less.
  • the anti-IL-1 ⁇ binding antibody or binding fragment thereof binds to human IL-1 ⁇ with a dissociation constant of about 50 pM or less. In some embodiments of any of the methods described above, the anti-IL-1 ⁇ binding antibody or binding fragment thereof binds to human IL-1 ⁇ with a dissociation constant of about 5 pM or less. In some embodiments, the anti-IL-1 ⁇ binding antibody or binding fragment thereof binds to human IL-1 ⁇ with a dissociation constant of about 1 pM or less. In some embodiments, the anti-IL-1 ⁇ binding antibody or binding fragment thereof binds to human IL-1 ⁇ with a dissociation constant of about 0.3 pM or less.
  • the anti-IL-1 ⁇ binding antibody or binding fragment thereof is a neutralizing antibody.
  • the anti-IL-1 ⁇ binding antibody or binding fragment thereof binds to an IL-1 ⁇ epitope such that the bound antibody or fragment substantially permits the binding of IL-1 ⁇ to IL-1 receptor I (IL-1R1).
  • IL-1R1 IL-1 receptor I
  • the anti-IL-1 ⁇ binding antibody or binding fragment thereof does not detectably bind to IL-1 ⁇ , IL-1R or IL-1Ra.
  • the anti-IL-1 ⁇ binding antibody or binding fragment thereof competes with the binding of an antibody having the light chain variable region of SEQ ID NO:1 and the heavy chain variable region of SEQ ID NO:2. In some embodiments of any and/or all of the methods described above, the anti-IL-1 ⁇ binding antibody or binding fragment thereof binds to an epitope that is the same or substantially the same as an epitope that is bound by an antibody having the light chain variable region of SEQ ID NO:1 and the heavy chain variable region of SEQ ID NO:2. In some embodiments of any and/or all of the methods described above, the anti-IL-1 ⁇ binding antibody or binding fragment thereof comprises a light chain variable region of SEQ ID NO:1 and a heavy chain variable region of SEQ ID NO:2.
  • the anti-IL-1 ⁇ binding antibody or binding fragment thereof binds to an epitope incorporating Glu64 of IL-1 ⁇ .
  • the anti-IL-1 ⁇ binding antibody or binding fragment thereof binds to amino acids 1-34 of the N terminus of IL-1 ⁇ .
  • the anti-IL-1 ⁇ binding antibody or binding fragment thereof is humanized or human.
  • the anti-IL-1 ⁇ binding antibody or binding fragment thereof is administered in one or more doses of 3 mg/kg of antibody or fragment. In some embodiments, the anti-IL-1 ⁇ binding antibody or binding fragment thereof is administered in one or more doses of 1 mg/kg or less of antibody or fragment. In some embodiments, the anti-IL-1 ⁇ binding antibody or binding fragment thereof is administered in one or more doses of 0.3 mg/kg or less of antibody or fragment. In some embodiments, the anti-IL-1 ⁇ binding antibody or binding fragment thereof is administered in one or more doses of 0.1 mg/kg or less of antibody or fragment.
  • the anti-IL-1 ⁇ binding antibody or binding fragment thereof is administered in one or more doses of 0.03 mg/kg or less of antibody or fragment. In some embodiments, the one or more doses are at least 0.01 mg/kg of antibody or fragment. In some embodiments of any of the methods described above, the anti-IL-1 ⁇ binding antibody or binding fragment thereof is administered in one or more doses of 0.03 mg/kg to 1 mg/kg.
  • the anti-IL-1 ⁇ binding antibody or binding fragment thereof is administered as a fixed dose, independent of a dose per subject weight ratio. In some embodiments, the anti-IL-1 ⁇ binding antibody or binding fragment thereof is administered in one or more doses of 100 mg or less of antibody or fragment. In some embodiments, the anti-IL-1 ⁇ binding antibody or binding fragment thereof is administered in one or more doses of 25 mg or less of antibody or fragment In some embodiments, the anti-IL-1 ⁇ binding antibody or binding fragment thereof is administered in one or more doses of 10 mg or less of antibody or fragment. In some embodiments, the anti-IL-1 ⁇ binding antibody or binding fragment thereof is administered in one or more doses of at least 0.5 mg of antibody or fragment.
  • the anti-IL-1 ⁇ binding antibody or binding fragment thereof is administered in one or more doses of 1 mg to 100 mg of antibody or fragment. In some embodiments, said fixed dose of anti-IL-1 ⁇ binding antibody or binding fragment thereof is administered using a pre-filled syringe or delivery device.
  • the anti-IL-1 ⁇ binding antibody or binding fragment thereof is administered by subcutaneous, intravenous or intramuscular injection.
  • administering an initial dose of anti-IL-1 ⁇ binding antibody or binding fragment thereof is followed by the administration of one or more subsequent doses.
  • said initial dose and one or more subsequent doses are administered at an interval of about once every week to about once every 12 months.
  • said initial dose and one or more subsequent doses are administered at an interval of about once every two weeks to about once every 6 months.
  • said initial dose and one or more subsequent doses are administered at an interval of about once every month to about once every 6 months.
  • said initial dose and one or more subsequent doses are administered at an interval of about once every month to about once every 3 months.
  • said initial dose and one or more subsequent doses are administered at an interval of about once every 3 months to about once every 6 months.
  • dosing regimens comprising more than one dosing interval for administration of an IL-1 ⁇ binding antibody or binding fragment thereof.
  • the dosage regimen comprises at least two (e.g., two, three, four, five, six) different dosing intervals for administration of the IL-1 ⁇ antibody or fragment thereof.
  • the dosage regimen comprises two different dosing intervals for administration of the IL-1 ⁇ antibody or fragment thereof.
  • the dosing regimen comprises two different dosing intervals for administration of the IL-1 ⁇ binding antibody or binding fragment thereof, wherein a first dosing interval comprises administration of one or more doses of the IL-1 ⁇ antibody or fragment thereof and a second dosing interval comprises administration of one or more doses of the IL-1 ⁇ antibody or fragment thereof, and wherein the first dosing interval is shorter in time than the second dosing interval.
  • the first dosing interval may be days or weeks, and the second dosing interval may be months.
  • the first dosing interval is about 5 days to about 28 days, about 7 days to about 21 days, about 12 days to about 16 days, or about 14 days.
  • the second dosing interval is about 1 month to about 3 months, about 1 month to about 2 months, or about 1 month.
  • the first dosing interval is about 7 days and the second dosing interval is about 1 month.
  • administration of an initial dose of anti-IL-1 ⁇ binding antibody or binding fragment thereof is followed by administration of one or more subsequent doses, and wherein the dosing intervals between administration of the initial dose and a second dose, and the second dose and a third dose are about 7 days to about 21 days, and wherein the dosing intervals between administration of subsequent doses is about 1 month to about 3 months.
  • the dosing intervals between administration of the initial dose and a second dose, and the second dose and a third dose are about 12 to 16 days, and the dosing intervals between administration of subsequent doses is about 1 month to about 2 months.
  • the dosing intervals between administration of the initial dose and a second dose, and the second dose and a third dose are about 14 days, and the dosing intervals between administration of subsequent doses is about 1 month.
  • the IL-1 ⁇ binding antibody or binding fragment thereof (e.g., therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof) is first administered within 1 week of the cardiovascular event, within 96 hours of the cardiovascular event, within 72 hours of the cardiovascular event, within 48 hours of the cardiovascular event, within 24 hours of the cardiovascular event, or within 12 hours of the cardiovascular event.
  • administering administration of an initial dose of the anti-IL-1 ⁇ binding antibody or binding fragment thereof is followed by the administration of one or more subsequent doses, and wherein said one or more subsequent doses are in an amount that is approximately the same or less than the initial dose.
  • administering administration of an initial dose of the anti-IL-1 ⁇ binding antibody or binding fragment thereof is followed by the administration of one or more subsequent doses, and wherein at least one of the subsequent doses is in an amount that is more than the initial dose.
  • the anti-IL-1 ⁇ binding antibody or binding fragment thereof thereof has a lower IC 50 than an IL-1 ⁇ receptor antagonist in a human whole blood IL-1 ⁇ inhibition assay that measures IL-1 ⁇ induced production of IL-8.
  • the IL-1 ⁇ receptor antagonist is anakinra.
  • any and/or all of the methods described above may further comprise administering at least one other pharmaceutical composition comprising an active agent other than an anti-IL-1 ⁇ binding antibody or binding fragment thereof.
  • the active agent of said at least one other pharmaceutical composition is a cholesterol lowering agent.
  • the active agent of said at least one other pharmaceutical composition is a statin or an HMG-CoA reductase inhibitor (e.g., lovastatin, pravastatin, simvastatin, fluvastatin, atorvastatin, cerivastatin, mevastatin, pitavastatin, rosuvastatin or mixtures thereof or mixtures with Ezetimibe, niacin, Amlodipine Besylate).
  • the active agent of said at least one other pharmaceutical composition is a calcium channel blocker (e.g., amlodipine, diltiazem, nifedipine, nicardipine, verapamil) or a beta blocker (e.g., esmolol, metoprolol, nadolol, penbutolol).
  • a calcium channel blocker e.g., amlodipine, diltiazem, nifedipine, nicardipine, verapamil
  • beta blocker e.g., esmolol, metoprolol, nadolol, penbutolol
  • the active agent of said at least one other pharmaceutical composition is an antihypertensive (e.g., labetalol, metoprolol, hydralazine, nitroglycerin, nicardipine, sodium nitroprusside, clevidipine), a diuretic (e.g., a thiazide diuretic, chlorthalidone, furosemide, hydrochlorothiazide, indapamide, metolazone, amiloride hydrochloride, spironolactone, triamterene) or aspirin.
  • the active agent of said at least one other pharmaceutical composition is an angiotensin-converting enzyme (ACE) inhibitor (e.g.
  • ACE angiotensin-converting enzyme
  • the active agent of said at least one other pharmaceutical composition is a vasodilator.
  • the active agent of said at least one other pharmaceutical composition is an anticoagulant (e.g., acenocoumarol, phenprocoumon, warfarin heparin, low molecular weight heparin) or inhibitor of platelet aggregation (e.g., clopidogrel, ticlopidine, cilostazol, dipyridamole, eptifibatide, aspirin, abciximab, eptifibatide, tirofiban).
  • an anticoagulant e.g., acenocoumarol, phenprocoumon, warfarin heparin, low molecular weight heparin
  • inhibitor of platelet aggregation e.g., clopidogrel, ticlopidine, cilostazol, dipyridamole, eptifibatide, aspirin, abciximab, eptifibatide, tirofiban.
  • the active agent of said at least one other pharmaceutical composition is a thrombolytic (e.g., streptokinase, urokinase,reteplase, tenecteplase).
  • the active agent of said at least one other pharmaceutical composition is digitalis.
  • the active agent of said at least one other pharmaceutical composition is digoxin or nesiritide.
  • the active agent of said at least one other pharmaceutical composition is oxygen.
  • the active agent of said at least one other pharmaceutical composition is a thrombin inhibitor (e.g., hirudin, bivalirudin).
  • the active agent of said at least one other pharmaceutical composition is a nitrate (e.g., glyceryl trinitrate (GTN)/nitroglycerin, isosorbide dinitrate, isosorbide mononitrate).
  • the active agent of said at least one other pharmaceutical composition is an analgesic (e.g., morphine sulfate).
  • the active agent of said at least one other pharmaceutical composition is a renin inhibitor.
  • the active agent of said at least one other pharmaceutical composition is an endothelin A receptor inhibitor.
  • the active agent of said at least one other pharmaceutical composition is an aldosterone inhibitor.
  • the present disclosure also provides uses of an anti-IL-1 ⁇ binding antibody or binding fragment thereof which has a lower IC 50 than an IL-1 ⁇ receptor antagonist in a human whole blood IL-1 ⁇ inhibition assay that measures IL-1 ⁇ induced production of IL-8, in the manufacture of a composition for use in the reduction, prevention or treatment of a cardiac event or a cardiovascular disease.
  • IL-1 ⁇ binding antibodies and binding fragments thereof as well as suitable dose amounts and dosing regimens and/or other pharmaceutical compositions comprising an active agent other than an anti-IL-1 ⁇ antibody or fragment thereof, as provided herein, may be used in or with any of the aforementioned methods and/or pharmaceutical compositions, including for example:
  • compositions for use in reducing a cardiovascular event e.g., delaying time to event, reducing likelihood or risk of event, preventing an event, reducing severity of event, reducing time to recovery
  • a cardiovascular event e.g., delaying time to event, reducing likelihood or risk of event, preventing an event, reducing severity of event, reducing time to recovery
  • administering comprising administering to said subject a therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof, and wherein the cardiovascular event is myocardial infarction, stroke, cardiovascular death, congestive heart failure, cardiac arrest, acute coronary syndrome, angina, or a revascularization procedure;
  • compositions for use in reducing a cardiovascular event e.g., delaying time to event, reducing likelihood or risk of event, preventing an event, reducing severity of event, reducing time to recovery
  • a cardiovascular event e.g., delaying time to event, reducing likelihood or risk of event, preventing an event, reducing severity of event, reducing time to recovery
  • administering comprising administering to said subject a therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof, and wherein said cardiovascular event is myocardial infarction, stroke, cardiovascular death, congestive heart failure, cardiac arrest, acute coronary syndrome, angina or a revascularization procedure;
  • compositions for use in reducing mortality following a cardiovascular event in a subject comprising administering to said subject a therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof;
  • compositions for use in reducing a cardiovascular event in a subject with a history of at least one risk factor for cardiovascular disease comprising administering to said subject a therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof, and wherein said risk factor is not Type 2 diabetes, obesity, hyperglycemia, dyslipidemia, hyperlipidemia, chronic renal failure, high blood glucose, chronic kidney disease, hypertension, atherosclerosis or metabolic syndrome;
  • compositions for use in treating a cardiovascular event in a subject comprising administering to said subject a therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof and at least one other pharmaceutical composition comprising an active agent other than an IL-1 ⁇ antibody or fragment;
  • compositions for use in treating a cardiovascular event in a subject comprising administering to said subject a therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof and a revascularization procedure;
  • compositions for use in treating cardiovascular disease including, for example, acute cardiovascular disease or chronic cardiovascular disease, in a subject, comprising administering to said subject a therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof and a revascularization procedure;
  • compositions for use in reducing restenosis in a subject following a revascularization procedure comprising administering to said subject a therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof;
  • compositions for use in treating acute hypertension in a subject comprising administering to said subject a therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof and one or more antihypertensive agents;
  • compositions for use in reducing, preventing or treating a cardiovascular event or disease comprising administering to the subject an anti-IL-1 ⁇ binding antibody or binding fragment thereof in combination with a medical or surgical intervention;
  • compositions for use in inhibiting platelet activity in a subject comprising administering to said subject a therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof;
  • compositions for use in reducing a cardiovascular event in a subject with a history of at least one risk factor for cardiovascular disease comprising (a) identifying, diagnosing or selecting the subject with the history of at least one risk factor for cardiovascular disease and (b) administering to the subject a therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof, and wherein the cardiovascular event is myocardial infarction, stroke, cardiovascular death, congestive heart failure, cardiac arrest, acute coronary syndrome, angina, or a revascularization procedure;
  • compositions for use in reducing a cardiovascular event in a subject with a history of a previous cardiovascular event comprising (a) identifying, diagnosing or selecting the subject with the history of the previous cardiovascular event and (b) administering to the subject a therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof, and wherein the cardiovascular event is myocardial infarction, stroke, acute coronary syndrome, angina or a revascularization procedure;
  • compositions for use in reducing mortality following a cardiovascular event in a subject comprising (a) identifying, diagnosing or selecting the subject having the cardiovascular event and (b) administering to the subject a therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof;
  • compositions for use in reducing a cardiovascular event in a subject with a history of at least one risk factor for cardiovascular disease comprising (a) identifying, diagnosing or selecting the subject with the history of at least one risk factor for cardiovascular disease and (b) administering to the subject a therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof, and wherein the risk factor is not Type 2 diabetes, obesity, hyperglycemia, dyslipidemia, hyperlipidemia, chronic renal failure, high blood glucose, chronic kidney disease, hypertension, atherosclerosis or metabolic syndrome;
  • compositions for use in treating a cardiovascular event in a subject comprising (a) identifying, diagnosing or selecting the subject with the cardiovascular event and (b) administering to the subject a therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof and at least one other pharmaceutical composition comprising an active agent other than an IL-1 ⁇ antibody or fragment;
  • compositions for use in treating a cardiovascular event in a subject comprising (a) identifying, diagnosing or selecting the subject with the cardiovascular event and (b) administering to the subject a therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof and (e.g., in conjunction with) a revascularization procedure;
  • compositions for use in reducing restenosis in a subject following a revascularization procedure comprising (a) identifying, diagnosing or selecting the subject with the revascularization procedure and (b) administering to the subject a therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof;
  • compositions for use in treating acute hypertension in a subject comprising (a) identifying, diagnosing or selecting the subject with acute hypertension and (b) administering to the subject a therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof and one or more antihypertensive agents.
  • IL-1 ⁇ antibodies or binding fragments thereof with certain properties (such as Kd values or IC 50 values), such as for example, for the reduction, prevention or treatment of cardiovascular events and/or cardiovascular diseases, including acute cardiovascular disease or chronic cardiovascular disease
  • this also means to embody the use of such antibodies or fragments thereof in the manufacture of a medicament for use in these methods.
  • the disclosure also encompasses IL-1 ⁇ antibodies or binding fragments thereof having these properties as well as pharmaceutical compositions comprising these antibodies or fragments thereof for use in the methods provided herein, such as for example, for the reduction, prevention or treatment of cardiovascular events and/or cardiovascular diseases, including acute cardiovascular disease or chronic cardiovascular disease.
  • FIG. 1 is a graph showing serum concentrations following IV administration of 0.01, 0.03, 0.1, 0.3, or 1.0 mg/kg of an anti-IL-1 ⁇ antibody in human subjects.
  • FIG. 2 is a graph showing serum concentrations following SC administration of 0.03, 0.1 and 0.3 mg/kg of an anti-IL-1 ⁇ antibody in human subjects
  • FIG. 3 is a graph showing median percent change in CRP at day 28 following administration of 0.01, 0.03, 0.1, 0.3, or 1.0 mg/kg of an anti-IL-1 ⁇ antibody in human subjects.
  • FIG. 4 is graphs showing changes in echocardiographic values in a myocardial infarction animal model.
  • FIG. 5 is graphs showing measurements of akinetic segments (surrogate for infarct size), anterior wall (infarct) thickness, MPI or Tei index (marker of combined systolic and diastolic dysfunction and a surrogate marker for heart failure related mortality), and TAPSE (marker of right ventricular function and a surrogate marker for AMI related mortality in a myocardial infarction animal model.
  • FIG. 6 is graphs showing inhibition of the release of macrophage-induced pro-inflammatory cytokines from endothelial cells.
  • FIG. 7 is graphs showing inhibition of the release of macrophage-induced cytokines and degradative enzymes from smooth muscle cells.
  • FIG. 8 is graphs showing reduction in the formation of atherosclerotic lesions in the aortas of ApoE knockout mice.
  • FIG. 9 is photographs of en face analysis showing reduction in the formation of atherosclerotic lesions in the aortas of ApoE knockout mice.
  • the present disclosure relates to methods and related articles of manufacture for the treatment and/or prevention of cardiovascular disease, including, for example, acute cardiovascular disease or chronic cardiovascular disease.
  • the methods may be used for reducing, treating or preventing a cardiovascular event, such as myocardial infarction, stroke, cardiovascular death, congestive heart failure, cardiac arrest, acute coronary syndrome, angina, or a revascularization procedure in a subject, including in a subject with a history of a risk factor for cardiovascular disease.
  • the methods may also be used to reduce mortality following a cardiovascular event in a subject.
  • anti-IL-1 ⁇ binding antibodies or binding fragments offers potential advantages over previously available options, such as for example greater safety (e.g., reduced side effects), greater efficacy, targeting of the inflammatory component of disease, and/or less frequent dosing.
  • the interleukin-1 (IL-1) family of cytokines has been implicated in several disease states such as rheumatoid arthritis (RA), osteoarthritis, Crohn's disease, ulcerative colitis (UC), septic shock, chronic obstructive pulmonary disease (COPD), asthma, graft versus host disease, atherosclerosis, adult T-cell leukemia, multiple myeloma, multiple sclerosis, stroke, and Alzheimer's disease.
  • IL-1 family members include IL-1 ⁇ , IL-1 ⁇ , and IL-1Ra. Although related by their ability to bind to IL-1 receptors (IL-1R1, IL-1R2), each of these cytokines is expressed by a different gene and has a different primary amino acid sequence. Furthermore, the physiological activities of these cytokines can be distinguished from each other.
  • IL-1 mediated diseases such as for example some of the aforementioned diseases.
  • These compounds include recombinant IL-1Ra (Amgen Inc., Thousand Oaks, Calif.), IL-1 receptor “trap” peptide (Regeneron Inc., Tarrytown, N.Y.), as well as animal-derived IL-1 ⁇ antibodies and recombinant IL-1 ⁇ antibodies and fragments thereof.
  • Compounds that directly target the IL-1 ⁇ ligand are believed to provide a superior strategy, particularly when administering an IL-1 ⁇ antibody with high affinity.
  • IL-1 (e.g., IL-1 ⁇ ) binding antibodies may be provided as polyclonal antibodies, monoclonal antibodies (mAbs), recombinant antibodies, chimeric antibodies, CDR-grafted antibodies, fully human antibodies, single chain antibodies, and/or bispecific antibodies, as well as fragments, including variants and derivatives thereof, provided by known techniques, including, but not limited to enzymatic cleavage, peptide synthesis or recombinant techniques.
  • mAbs monoclonal antibodies
  • recombinant antibodies chimeric antibodies, CDR-grafted antibodies, fully human antibodies, single chain antibodies, and/or bispecific antibodies, as well as fragments, including variants and derivatives thereof, provided by known techniques, including, but not limited to enzymatic cleavage, peptide synthesis or recombinant techniques.
  • Antibodies generally comprise two heavy chain polypeptides and two light chain polypeptides, though single domain antibodies having one heavy chain and one light chain, and heavy chain antibodies devoid of light chains are also contemplated.
  • IL-1 ⁇ binding fragments encompass antibody fragments and antigen-binding polypeptides that will bind IL-1 ⁇ .
  • Each of the heavy chain and light chain sequences of an antibody, or antigen binding fragment thereof includes a variable region with three complementarity determining regions (CDRs) as well as non-CDR framework regions (FRs).
  • CDRs complementarity determining regions
  • FRs non-CDR framework regions
  • Heavy chain CDRs are referred to herein as CDR-H1, CDR-H2, and CDR-H3.
  • Light chain CDRs are referred to herein as CDR-L1, CDR-L2, and CDR-L3.
  • Variable regions and CDRs in an antibody sequence can be identified (i) according to general rules that have been developed in the art or (ii) by aligning the sequences against a database of known variable regions. Methods for identifying these regions are described in Kontermann and Dubel, eds., Antibody Engineering , Springer, New York, N.Y., 2001, and Dinarello et al., Current Protocols in Immunology , John Wiley and Sons Inc., Hoboken, N.J., 2000. Databases of antibody sequences are described in and can be accessed through “The Kabatman” database at www.bioinf.org.uk/abs (maintained by A.C.
  • CDR CDR
  • the “Kabatman” database web site also includes general rules of thumb for identifying CDRs.
  • CDR is as defined in Kabat et al., Sequences of Immunological Interest, 5 th ed., U.S. Department of Health and Human Services, 1991, unless otherwise indicated.
  • Polyclonal antibodies are preferably raised in animals by multiple subcutaneous (sc) or intraperitoneal (ip) immunizing injections of the relevant antigen and an adjuvant, using standard techniques known in the art.
  • An improved antibody response may be obtained by conjugating the relevant antigen to a protein that is immunogenic in the species to be immunized, e.g., keyhole limpet hemocyanin, serum albumin, bovine thyroglobulin, or soybean trypsin inhibitor using a bifunctional or derivatizing agent, for example, maleimidobenzoyl sulfosuccinimide ester (conjugation through cysteine residues), N-hydroxysuccinimide (through lysine residues), glutaraldehyde, succinic anhydride or other agents known in the art.
  • a protein that is immunogenic in the species to be immunized e.g., keyhole limpet hemocyanin, serum albumin, bovine thyroglobulin
  • Monoclonal antibody refers to an antibody obtained from a population of substantially homogeneous antibodies.
  • Monoclonal antibodies are generally highly specific, and may be directed against a single antigenic site, in contrast to conventional (polyclonal) antibody preparations that typically include different antibodies directed against different determinants (epitopes).
  • the monoclonal antibodies are advantageous in that they are synthesized by the homogeneous culture, uncontaminated by other immunoglobulins with different specificities and characteristics.
  • Monoclonal antibodies to be used in accordance with the present disclosure may be made by the hybridoma method first described by Kohler et al., ( Nature, 256:495-7, 1975), or may be made by recombinant DNA methods (see, e.g., U.S. Pat. No. 4,816,567).
  • the monoclonal antibodies may also be isolated from phage antibody libraries using the techniques described in, for example, Clackson et al., (Nature 352:624-628, 1991) and Marks et al., ( J. Mol. Biol. 222:581-597, 1991).
  • antibodies of the present disclosure may be used as smaller antigen binding fragments of the antibody well-known in the art and described herein.
  • the present disclosure encompasses IL-1 (e.g., IL-1 ⁇ ) binding antibodies that include two full length heavy chains and two full length light chains.
  • the IL-1 ⁇ binding antibodies can be constructs such as single chain antibodies or “mini” antibodies that retain binding activity to IL-1 ⁇ .
  • Such constructs can be prepared by methods known in the art such as, for example, the PCR mediated cloning and assembly of single chain antibodies for expression in E. coli (as described in Antibody Engineering, The practical approach series, J. McCafferty, H. R. Hoogenboom, and D. J.
  • variable portions of the heavy and light chains of an antibody molecule are PCR amplified from cDNA.
  • the resulting amplicons are then assembled, for example, in a second PCR step, through a linker DNA that encodes a flexible protein linker composed of the amino acids Gly and Ser.
  • This linker allows the variable heavy and light chain portions to fold in such a way that the antigen binding pocket is regenerated and antigen is bound with affinities often comparable to the parent full-length dimeric immunoglobulin molecule.
  • the IL-1 (e.g., IL-1 ⁇ ) binding antibodies and fragments encompass variants of the exemplary antibodies, fragments and sequences disclosed herein.
  • Variants include peptides and polypeptides comprising one or more amino acid sequence substitutions, deletions, and/or additions that have the same or substantially the same affinity and specificity of epitope binding as one or more of the exemplary antibodies, fragments and sequences disclosed herein.
  • variants include peptides and polypeptides comprising one or more amino acid sequence substitutions, deletions, and/or additions to the exemplary antibodies, fragments and sequences disclosed herein where such substitutions, deletions and/or additions do not cause substantial changes in affinity and specificity of epitope binding.
  • a variant of an antibody or fragment may result from one or more changes to an antibody or fragment, where the changed antibody or fragment has the same or substantially the same affinity and specificity of epitope binding as the starting sequence.
  • Variants may be naturally occurring, such as allelic or splice variants, or may be artificially constructed. Variants may be prepared from the corresponding nucleic acid molecules encoding said variants.
  • Variants of the present antibodies and IL-1 ⁇ binding fragments may have changes in light and/or heavy chain amino acid sequences that are naturally occurring or are introduced by in vitro engineering of native sequences using recombinant DNA techniques.
  • Naturally occurring variants include “somatic” variants which are generated in vivo in the corresponding germ line nucleotide sequences during the generation of an antibody response to a foreign antigen.
  • Variants of IL-1 (e.g., IL-1 ⁇ ) binding antibodies and binding fragments may also be prepared by mutagenesis techniques. For example, amino acid changes may be introduced at random throughout an antibody coding region and the resulting variants may be screened for binding affinity for IL-1 ⁇ or for another property. Alternatively, amino acid changes may be introduced in selected regions of an IL-1 ⁇ antibody, such as in the light and/or heavy chain CDRs, and/or in the framework regions, and the resulting antibodies may be screened for binding to IL-1 ⁇ or some other activity. Amino acid changes encompass one or more amino acid substitutions in a CDR, ranging from a single amino acid difference to the introduction of multiple permutations of amino acids within a given CDR, such as CDR3.
  • each residue within a CDR to IL-1 ⁇ binding may be assessed by substituting at least one residue within the CDR with alanine. Lewis et al. (1995), Mol. Immunol. 32: 1065-72. Residues which are not optimal for binding to IL-1 ⁇ may then be changed in order to determine a more optimum sequence. Also encompassed are variants generated by insertion of amino acids to increase the size of a CDR, such as CDR3. For example, most light chain CDR3 sequences are nine amino acids in length. Light chain sequences in an antibody which are shorter than nine residues may be optimized for binding to IL-1 ⁇ by insertion of appropriate amino acids to increase the length of the CDR.
  • Variants may also be prepared by “chain shuffling” of light or heavy chains. Marks et al. (1992), Biotechnology 10: 779-83.
  • a single light (or heavy) chain can be combined with a library having a repertoire of heavy (or light) chains and the resulting population is screened for a desired activity, such as binding to IL-1 ⁇ . This permits screening of a greater sample of different heavy (or light) chains in combination with a single light (or heavy) chain than is possible with libraries comprising repertoires of both heavy and light chains.
  • the IL-1 (e.g., IL-1 ⁇ ) binding antibodies and fragments of the present disclosure encompass derivatives of the exemplary antibodies, fragments and sequences disclosed herein.
  • Derivatives include polypeptides or peptides, or variants, fragments or derivatives thereof, which have been chemically modified. Examples include covalent attachment of one or more polymers, such as water soluble polymers, N-linked, or O-linked carbohydrates, sugars, phosphates, and/or other such molecules.
  • the derivatives are modified in a manner that is different from naturally occurring or starting peptide or polypeptides, either in the type or location of the molecules attached. Derivatives further include deletion of one or more chemical groups which are naturally present on the peptide or polypeptide.
  • the IL-1 ⁇ binding antibodies and fragments can be bispecific. Bispecific antibodies or fragments can be of several configurations. For example, bispecific antibodies may resemble single antibodies (or antibody fragments) but have two different antigen binding sites (variable regions). Bispecific antibodies can be produced by chemical techniques (Kranz et al. (1981), Proc. Natl. Acad. Sci. USA, 78: 5807), by “polydoma” techniques (U.S. Pat. No. 4,474,893) or by recombinant DNA techniques. Bispecific antibodies of the present disclosure can have binding specificities for at least two different epitopes, at least one of which is an epitope of IL-1 ⁇ .
  • the IL-1 ⁇ binding antibodies and fragments can also be heteroantibodies. Heteroantibodies are two or more antibodies, or antibody binding fragments (Fab) linked together, each antibody or fragment having a different specificity.
  • IL-1 e.g., IL-1 ⁇
  • DNA is cloned into a bacterial expression system.
  • a technique suitable for the practice of the present disclosure uses a bacteriophage lambda vector system having a leader sequence that causes the expressed Fab protein to migrate to the periplasmic space (between the bacterial cell membrane and the cell wall) or to be secreted.
  • a leader sequence that causes the expressed Fab protein to migrate to the periplasmic space (between the bacterial cell membrane and the cell wall) or to be secreted.
  • IL-1 ⁇ binding agents Fab fragments with specificity for an IL-1 ⁇ polypeptide
  • the present IL-1 (e.g., IL-1 ⁇ ) binding antibodies and fragments can be humanized or human engineered antibodies.
  • a humanized antibody, or antigen binding fragment thereof is a recombinant polypeptide that comprises a portion of an antigen binding site from a non-human antibody and a portion of the framework and/or constant regions of a human antibody.
  • a human engineered antibody or antibody fragment is a non-human (e.g., mouse) antibody that has been engineered by modifying (e.g., deleting, inserting, or substituting) amino acids at specific positions so as to reduce or eliminate any detectable immunogenicity of the modified antibody in a human.
  • Humanized antibodies include chimeric antibodies and CDR-grafted antibodies.
  • Chimeric antibodies are antibodies that include a non-human antibody variable region linked to a human constant region. Thus, in chimeric antibodies, the variable region is mostly non-human, and the constant region is human. Chimeric antibodies and methods for making them are described in Morrison, et al., Proc. Natl. Acad. Sci. USA, 81: 6841-6855 (1984), Boulianne, et al., Nature, 312: 643-646 (1984), and PCT Application Publication WO 86/01533.
  • Chimeric antibodies can also be produced by splicing the genes from a mouse antibody molecule of appropriate antigen-binding specificity together with genes from a human antibody molecule of appropriate biological activity, such as the ability to activate human complement and mediate ADCC.
  • HAMA human anti-mouse antibody responses
  • Chimeric antibodies can also be produced by splicing the genes from a mouse antibody molecule of appropriate antigen-binding specificity together with genes from a human antibody molecule of appropriate biological activity, such as the ability to activate human complement and mediate ADCC.
  • One example is the replacement of a Fc region with that of a different isotype.
  • CDR-grafted antibodies are antibodies that include the CDRs from a non-human “donor” antibody linked to the framework region from a human “recipient” antibody.
  • CDR-grafted antibodies include more human antibody sequences than chimeric antibodies because they include both constant region sequences and variable region (framework) sequences from human antibodies.
  • a CDR-grafted humanized antibody of the present disclosure can comprise a heavy chain that comprises a contiguous amino acid sequence (e.g., about 5 or more, 10 or more, or even 15 or more contiguous amino acid residues) from the framework region of a human antibody (e.g., FR-1, FR-2, or FR-3 of a human antibody) or, optionally, most or all of the entire framework region of a human antibody.
  • a contiguous amino acid sequence e.g., about 5 or more, 10 or more, or even 15 or more contiguous amino acid residues
  • CDR-grafted antibodies and methods for making them are described in, Jones et al., Nature, 321: 522-525 (1986), Riechmann et al., Nature, 332: 323-327 (1988), and Verhoeyen et al., Science, 239: 1534-1536 (1988)). Methods that can be used to produce humanized antibodies also are described in U.S. Pat. Nos. 4,816,567, 5,721,367, 5,837,243, and 6,180,377. CDR-grafted antibodies are considered less likely than chimeric antibodies to induce an immune reaction against non-human antibody portions.
  • framework sequences from the donor antibodies are required for the binding affinity and/or specificity of the donor antibody, presumably because these framework sequences affect the folding of the antigen-binding portion of the donor antibody. Therefore, when donor, non-human CDR sequences are grafted onto unaltered human framework sequences, the resulting CDR-grafted antibody can exhibit, in some cases, loss of binding avidity relative to the original non-human donor antibody. See, e.g., Riechmann et al., Nature, 332: 323-327 (1988), and Verhoeyen et al., Science, 239: 1534-1536 (1988).
  • Human engineered antibodies include for example “veneered” antibodies and antibodies prepared using H UMAN E NGINEERING TM technology (U.S. Pat. No. 5,869,619).
  • H UMAN E NGINEERING TM technology is commercially available, and involves altering an non-human antibody or antibody fragment, such as a mouse or chimeric antibody or antibody fragment, by making specific changes to the amino acid sequence of the antibody so as to produce a modified antibody with reduced immunogenicity in a human that nonetheless retains the desirable binding properties of the original non-human antibodies.
  • the technique involves classifying amino acid residues of a non-human (e.g., mouse) antibody as “low risk”, “moderate risk”, or “high risk” residues.
  • the classification is performed using a global risk/reward calculation that evaluates the predicted benefits of making particular substitution (e.g., for immunogenicity in humans) against the risk that the substitution will affect the resulting antibody's folding and/or antigen-binding properties.
  • a low risk position is one for which a substitution is predicted to be beneficial because it is predicted to reduce immunogenicity without significantly affecting antigen binding properties.
  • a moderate risk position is one for which a substitution is predicted to reduce immunogenicity, but is more likely to affect protein folding and/or antigen binding.
  • High risk positions contain residues most likely to be involved in proper folding or antigen binding.
  • the particular human amino acid residue to be substituted at a given low or moderate risk position of a non-human (e.g., mouse) antibody sequence can be selected by aligning an amino acid sequence from the non-human antibody's variable regions with the corresponding region of a specific or consensus human antibody sequence.
  • the amino acid residues at low or moderate risk positions in the non-human sequence can be substituted for the corresponding residues in the human antibody sequence according to the alignment.
  • “Veneered” antibodies are non-human or humanized (e.g., chimeric or CDR-grafted antibodies) antibodies that have been engineered to replace certain solvent-exposed amino acid residues so as to further reduce their immunogenicity or enhance their function.
  • veneering of a chimeric antibody can include, for instance, identifying solvent-exposed residues in the non-human framework region of a chimeric antibody and replacing at least one of them with the corresponding surface residues from a human framework region. Veneering can be accomplished by any suitable engineering technique, including the use of the above-described H UMAN E NGINEERING TM technology.
  • a recovery of binding avidity can be achieved by “de-humanizing” a CDR-grafted antibody.
  • De-humanizing can include restoring residues from the donor antibody's framework regions to the CDR grafted antibody, thereby restoring proper folding.
  • Similar “de-humanization” can be achieved by (i) including portions of the “donor” framework region in the “recipient” antibody or (ii) grafting portions of the “donor” antibody framework region into the recipient antibody (along with the grafted donor CDRs).
  • Exemplary humanized or human engineered antibodies include IgG, IgM, IgE, IgA, and IgD antibodies.
  • the present antibodies can be of any class (IgG, IgA, IgM, IgE, IgD, etc.) or isotype and can comprise a kappa or lambda light chain.
  • a human antibody can comprise an IgG heavy chain or defined fragment, such as at least one of isotypes, IgG1, IgG2, IgG3 or IgG4.
  • the present antibodies or fragments can comprise an IgG1 heavy chain and an IgG1 light chain.
  • the present antibodies and fragments can be human antibodies, such as antibodies which bind IL-1 ⁇ polypeptides and are encoded by nucleic acid sequences which are naturally occurring somatic variants of human germline immunoglobulin nucleic acid sequence, and fragments, synthetic variants, derivatives and fusions thereof.
  • Such antibodies may be produced by any method known in the art, such as through the use of transgenic mammals (such as transgenic mice) in which the native immunoglobulin repertoire has been replaced with human V-genes in the mammal chromosome. Such mammals appear to carry out VDJ recombination and somatic hypermutation of the human germline antibody genes in a normal fashion, thus producing high affinity antibodies with completely human sequences.
  • Human antibodies to target protein can also be produced using transgenic animals that have no endogenous immunoglobulin production and are engineered to contain human immunoglobulin loci.
  • WO 98/24893 discloses transgenic animals having a human Ig locus wherein the animals do not produce functional endogenous immunoglobulins due to the inactivation of endogenous heavy and light chain loci.
  • WO 91/00906 also discloses transgenic non-primate mammalian hosts capable of mounting an immune response to an immunogen, wherein the antibodies have primate constant and/or variable regions, and wherein the endogenous immunoglobulin encoding loci are substituted or inactivated.
  • 6,091,001 disclose the use of the Cre/Lox system to modify the immunoglobulin locus in a mammal, such as to replace all or a portion of the constant or variable region to form a modified antibody molecule.
  • WO 94/02602 discloses non-human mammalian hosts having inactivated endogenous Ig loci and functional human Ig loci.
  • U.S. Pat. No. 5,939,598 discloses methods of making transgenic mice in which the mice lack endogenous heavy chains, and express an exogenous immunoglobulin locus comprising one or more xenogeneic constant regions. See also, U.S. Pat. Nos. 6,114,598 6,657,103 and 6,833,268.
  • an immune response can be produced to a selected antigenic molecule, and antibody producing cells can be removed from the animal and used to produce hybridomas that secrete human monoclonal antibodies.
  • Immunization protocols, adjuvants, and the like are known in the art, and are used in immunization of, for example, a transgenic mouse as described in WO 96/33735.
  • This publication discloses monoclonal antibodies against a variety of antigenic molecules including IL-6, IL-8, TNFa, human CD4, L selectin, gp39, and tetanus toxin.
  • the monoclonal antibodies can be tested for the ability to inhibit or neutralize the biological activity or physiological effect of the corresponding protein.
  • WO 96/33735 discloses that monoclonal antibodies against IL-8, derived from immune cells of transgenic mice immunized with IL-8, blocked IL-8 induced functions of neutrophils. Human monoclonal antibodies with specificity for the antigen used to immunize transgenic animals are also disclosed in WO 96/34096 and U.S. patent application no. 20030194404; and U.S. patent application no. 20030031667.
  • Additional transgenic animals useful to make monoclonal antibodies include the Medarex HuMAb-MOUSE®, described in U.S. Pat. No. 5,770,429 and Fishwild, et al. ( Nat. Biotechnol. 14:845-851, 1996), which contains gene sequences from unrearranged human antibody genes that code for the heavy and light chains of human antibodies. Immunization of a HuMAb-MOUSE® enables the production of fully human monoclonal antibodies to the target protein.
  • TCMOUSETM TransChromo Mouse
  • the TCMOUSETM has a fully diverse repertoire of hIgs, including all the subclasses of IgGs (IgG1-G4). Immunization of the TC MOUSETM with various human antigens produces antibody responses comprising human antibodies.
  • Human antibodies can also be generated through the in vitro screening of antibody display libraries. See Hoogenboom et al. (1991), J. Mol. Biol. 227: 381; and Marks et al. (1991), J. Mol. Biol. 222: 581.
  • Various antibody-containing phage display libraries have been described and may be readily prepared. Libraries may contain a diversity of human antibody sequences, such as human Fab, Fv, and scFv fragments, that may be screened against an appropriate target.
  • Phage display libraries may comprise peptides or proteins other than antibodies which may be screened to identify selective binding agents of IL-1 ⁇ .
  • the antibodies produced by phage technology are produced as antigen binding fragments-usually Fv or Fab fragments-in bacteria and thus lack effector functions.
  • Effector functions can be introduced by one of two strategies: The fragments can be engineered either into complete antibodies for expression in mammalian cells, or into bispecific antibody fragments with a second binding site capable of triggering an effector function.
  • the present disclosure contemplates a method for producing target-specific antibody or antigen-binding portion thereof comprising the steps of synthesizing a library of human antibodies on phage, screening the library with target protein or a portion thereof, isolating phage that bind target, and obtaining the antibody from the phage.
  • one method for preparing the library of antibodies for use in phage display techniques comprises the steps of immunizing a non-human animal comprising human immunoglobulin loci with target antigen or an antigenic portion thereof to create an immune response, extracting antibody producing cells from the immunized animal; isolating RNA from the extracted cells, reverse transcribing the RNA to produce cDNA, amplifying the cDNA using a primer, and inserting the cDNA into a phage display vector such that antibodies are expressed on the phage.
  • Recombinant target-specific antibodies of the present disclosure may be obtained in this way.
  • Phage-display processes mimic immune selection through the display of antibody repertoires on the surface of filamentous bacteriophage, and subsequent selection of phage by their binding to an antigen of choice.
  • One such technique is described in WO 99/10494, which describes the isolation of high affinity and functional agonistic antibodies for MPL and msk receptors using such an approach.
  • Antibodies of the present disclosure can be isolated by screening of a recombinant combinatorial antibody library, preferably a scFv phage display library, prepared using human V L and V H cDNAs prepared from mRNA derived from human lymphocytes. Methodologies for preparing and screening such libraries are known in the art. See e.g., U.S. Pat. No. 5,969,108.
  • kits for generating phage display libraries e.g., the Pharmacia Recombinant Phage Antibody System, catalog no. 27-9400-01; and the Stratagene SurfZAPTM phage display kit, catalog no. 240612).
  • methods and reagents that can be used in generating and screening antibody display libraries (see, e.g., Ladner et al. U.S. Pat. No. 5,223,409; Kang et al. PCT Publication No. WO 92/18619; Dower et al. PCT Publication No. WO 91/17271; Winter et al. PCT Publication No. WO 92/20791; Markland et al. PCT Publication No.
  • a human V H and V L , library are screened to select for antibody fragments having the desired specificity.
  • the antibody libraries used in this method are preferably scFv libraries prepared and screened as described herein and in the art (McCafferty et al., PCT Publication No. WO 92/01047, McCafferty et al., ( Nature 348:552-554, 1990); and Griffiths et al., ( EMBO J. 12:725-734, 1993).
  • the scFv antibody libraries preferably are screened using target protein as the antigen.
  • the Fd fragment (V H -C H 1) and light chain (V L -C L ) of antibodies are separately cloned by PCR and recombined randomly in combinatorial phage display libraries, which can then be selected for binding to a particular antigen.
  • the Fab fragments are expressed on the phage surface, i.e., physically linked to the genes that encode them.
  • selection of Fab by antigen binding co-selects for the Fab encoding sequences which can be amplified subsequently.
  • panning Fab specific for the antigen are enriched and finally isolated.
  • Guided selection utilizes the power of the phage display technique for the humanization of mouse monoclonal antibody (See Jespers, L. S., et al., Bio/Technology 12, 899-903 (1994)).
  • the Fd fragment of the mouse monoclonal antibody can be displayed in combination with a human light chain library, and the resulting hybrid Fab library may then be selected with antigen.
  • the mouse Fd fragment thereby provides a template to guide the selection.
  • the selected human light chains are combined with a human Fd fragment library. Selection of the resulting library yields entirely human Fab.
  • Fv fragments are displayed on the surface of phage, by the association of one chain expressed as a phage protein fusion (e.g., with M13 gene III) with the complementary chain expressed as a soluble fragment.
  • the phage may be a filamentous phage such as one of the class I phages: fd, M13, f1, If1, lke, ZJ/Z, Ff and one of the class II phages Xf, Pf1 and Pf3.
  • the phage may be M13, or fd or a derivative thereof.
  • V L and V H segments of the preferred V L /V H pair(s) can be randomly mutated, preferably within the any of the CDR1, CDR2 or CDR3 region of V H and/or V L , in a process analogous to the in vivo somatic mutation process responsible for affinity maturation of antibodies during a natural immune response.
  • This in vitro affinity maturation can be accomplished by amplifying V L and V H regions using PCR primers complimentary to the V H CDR1, CDR2, and CDR3, or V L CDR1, CDR2, and CDR3, respectively, which primers have been “spiked” with a random mixture of the four nucleotide bases at certain positions such that the resultant PCR products encode V L and V H segments into which random mutations have been introduced into the V H and/or V L CDR3 regions. These randomly mutated V L and V H segments can be rescreened for binding to target antigen.
  • nucleic acid encoding the selected antibody can be recovered from the display package (e.g., from the phage genome) and subcloned into other expression vectors by standard recombinant DNA techniques. If desired, the nucleic acid can be further manipulated to create other antibody forms of the present disclosure, as described below.
  • the DNA encoding the antibody is cloned into a recombinant expression vector and introduced into a mammalian host cell, as described herein.
  • the phage display method may be carried out in a mutator strain of bacteria or host cell.
  • a mutator strain is a host cell which has a genetic defect which causes DNA replicated within it to be mutated with respect to its parent DNA.
  • Example mutator strains are NR9046mutD5 and NR9046 mut T1.
  • the phage display method may be carried out using a helper phage.
  • This is a phage which is used to infect cells containing a defective phage genome and which functions to complement the defect.
  • the defective phage genome can be a phagemid or a phage with some function encoding gene sequences removed.
  • helper phages are M13K07, M13K07 gene III no. 3; and phage displaying or encoding a binding molecule fused to a capsid protein.
  • Antibodies are also generated via phage display screening methods using the hierarchical dual combinatorial approach as disclosed in WO 92/01047 in which an individual colony containing either an H or L chain clone is used to infect a complete library of clones encoding the other chain (L or H) and the resulting two-chain specific binding member is selected in accordance with phage display techniques such as those described therein. This technique is also disclosed in Marks et al, ( Bio/Technology, 10:779-783, 1992).
  • Antibody libraries may be attached to yeast proteins, such as agglutinin, effectively mimicking the cell surface display of antibodies by B cells in the immune system.
  • antibodies may be isolated using ribosome mRNA display methods and microbial cell display methods. Selection of polypeptide using ribosome display is described in Hanes et al., ( Proc. Natl. Acad Sci USA, 94:4937-4942, 1997) and U.S. Pat. Nos. 5,643,768 and 5,658,754 issued to Kawasaki. Ribosome display is also useful for rapid large scale mutational analysis of antibodies. The selective mutagenesis approach also provides a method of producing antibodies with improved activities that can be selected using ribosomal display techniques.
  • the IL-1 (e.g., IL-1 ⁇ ) binding antibodies and fragments may comprise one or more portions that do not bind IL-1 ⁇ but instead are responsible for other functions, such as circulating half-life, direct cytotoxic effect, detectable labeling, or activation of the recipient's endogenous complement cascade or endogenous cellular cytotoxicity.
  • the antibodies or fragments may comprise all or a portion of the constant region and may be of any isotype, including IgA (e.g., IgA1 or IgA2), IgD, IgE, IgG (e.g. IgG1, IgG2, IgG3 or IgG4), or IgM.
  • antigen-binding compounds of the present disclosure may include an epitope tag, a salvage receptor epitope, a label moiety for diagnostic or purification purposes, or a cytotoxic moiety such as a radionuclide or toxin.
  • the constant region (when present) of the present antibodies and fragments may be of the ⁇ 1, ⁇ 2, ⁇ 3, ⁇ 4, ⁇ , ⁇ 2, or ⁇ or ⁇ type, preferably of the y type, more preferably of the y, type, whereas the constant part of a human light chain may be of the ⁇ or ⁇ type (which includes the ⁇ 1 , ⁇ 2 and ⁇ 3 subtypes) but is preferably of the ⁇ type.
  • Variants also include antibodies or fragments comprising a modified Fc region, wherein the modified Fc region comprises at least one amino acid modification relative to a wild-type Fc region.
  • the variant Fc region may be designed, relative to a comparable molecule comprising the wild-type Fc region, so as to bind Fc receptors with a greater or lesser affinity.
  • the present IL-1 ⁇ binding antibodies and fragments may comprise a modified Fc region.
  • Fc region refers to naturally-occurring or synthetic polypeptides homologous to the IgG C-terminal domain that is produced upon papain digestion of IgG.
  • IgG Fc has a molecular weight of approximately 50 kD.
  • an entire Fc region can be used, or only a half-life enhancing portion.
  • many modifications in amino acid sequence are acceptable, as native activity is not in all cases necessary or desired.
  • the Fc region can be mutated, if desired, to inhibit its ability to fix complement and bind the Fc receptor with high affinity.
  • substitution of Ala residues for Glu 318, Lys 320, and Lys 322 renders the protein unable to direct ADCC.
  • substitution of Glu for Leu 235 inhibits the ability of the protein to bind the Fc receptor with high affinity.
  • Various mutations for human IgG also are known (see, e.g., Morrison et al., 1994, The Immunologist 2: 119 124 and Brekke et al., 1994, The Immunologist 2: 125).
  • the present an antibodies or fragments are provided with a modified Fc region where a naturally-occurring Fc region is modified to increase the half-life of the antibody or fragment in a biological environment, for example, the serum half-life or a half-life measured by an in vitro assay.
  • a naturally-occurring Fc region is modified to increase the half-life of the antibody or fragment in a biological environment, for example, the serum half-life or a half-life measured by an in vitro assay.
  • molecules such as PEG or other water soluble polymers, including polysaccharide polymers
  • This may also be achieved, for example, by incorporation of a salvage receptor binding epitope into the antibody fragment (e.g., by mutation of the appropriate region in the antibody fragment or by incorporating the epitope into a peptide tag that is then fused to the antibody fragment at either end or in the middle, e.g., by DNA or peptide synthesis) (see, International Publication No. WO96/32478).
  • Salvage receptor binding epitope refers to an epitope of the Fc region of an IgG molecule (e.g., IgG 1 , IgG 2 , IgG 3 , or IgG 4 ) that is responsible for increasing the in vivo serum half-life of the IgG molecule.
  • a salvage receptor binding epitope can include a region wherein any one or more amino acid residues from one or two loops of a Fc domain are transferred to an analogous position of the antibody fragment. Even more preferably, three or more residues from one or two loops of the Fc domain are transferred. Still more preferred, the epitope is taken from the CH2 domain of the Fc region (e.g., of an IgG) and transferred to the CH 1 , CH 3 , or V H region, or more than one such region, of the antibody. Alternatively, the epitope is taken from the CH2 domain of the Fc region and transferred to the C L region or V L region, or both, of the antibody fragment. See also International applications WO 97/34631 and WO 96/32478 which describe Fc variants and their interaction with the salvage receptor.
  • Mutation of residues within Fc receptor binding sites can result in altered effector function, such as altered ADCC or CDC activity, or altered half-life.
  • Potential mutations include insertion, deletion or substitution of one or more residues, including substitution with alanine, a conservative substitution, a non-conservative substitution, or replacement with a corresponding amino acid residue at the same position from a different IgG subclass (e.g. replacing an IgG1 residue with a corresponding IgG2 residue at that position).
  • Antibody fragments are portions of an intact full length antibody, such as an antigen binding or variable region of the intact antibody.
  • antibody fragments include Fab, Fab′, F(ab′) 2 , and Fv fragments; diabodies; linear antibodies; single-chain antibody molecules (e.g., scFv); multispecific antibody fragments such as bispecific, trispecific, and multispecific antibodies (e.g., diabodies, triabodies, tetrabodies); minibodies; chelating recombinant antibodies; tribodies or bibodies; intrabodies; nanobodies; small modular immunopharmaceuticals (SMIP), adnectins, binding-domain immunoglobulin fusion proteins; camelized antibodies; V HH containing antibodies; and any other polypeptides formed from antibody fragments.
  • SMIP small modular immunopharmaceuticals
  • the present disclosure includes IL-1 ⁇ binding antibody fragments comprising any of the foregoing heavy or light chain sequences and which bind IL-1 ⁇ .
  • fragments as used herein refers to any 3 or more contiguous amino acids (e.g., 4 or more, 5 or more 6 or more, 8 or more, or even 10 or more contiguous amino acids) of the antibody and encompasses Fab, Fab′, F(ab′) 2 , and F(v) fragments, or the individual light or heavy chain variable regions or portion thereof.
  • IL-1 ⁇ binding fragments include, for example, Fab, Fab′, F(ab′) 2 , Fv and scFv.
  • fragments lack the Fc fragment of an intact antibody, clear more rapidly from the circulation, and can have less non-specific tissue binding than an intact antibody. See Wahl et al. (1983), J. Nucl. Med., 24: 316-25. These fragments can be produced from intact antibodies using well known methods, for example by proteolytic cleavage with enzymes such as papain (to produce Fab fragments) or pepsin (to produce F(ab′) 2 fragments).
  • IL-1 receptor type I IL-1 receptor type I
  • assays that determining in the presence of molecules (such as antibodies, antagonists, or other inhibitors) that bind to IL-1 ⁇ or IL-1R1.
  • molecules such as antibodies, antagonists, or other inhibitors
  • Evans et al. (1995), J. Biol. Chem. 270:11477-11483; Vigers et al., (2000), J. Biol. Chem. 275:36927-36933; Yanofsky et al., (1996), Proc. Natl. Acad. Sci. USA 93:7381-7386; Fredericks et al., (2004), Protein
  • IL-1 receptor type I including human IL-1 receptor type I, for such assays is readily available from a variety of commercial sources (see for example R&D Systems, SIGMA).
  • IL-1 receptor type I also can be expressed from an expression construct or vector introduced into an appropriate host cell using standard molecular biology and transfection techniques known in the art. The expressed IL-1 receptor type I may then be isolated and purified for use in binding assays, or alternatively used directly in a cell associated form.
  • the binding of IL-1 ⁇ to IL-1 receptor type I may be determined by immobilizing an IL-1 ⁇ binding antibody, contacting IL-1 ⁇ with the immobilized antibody and determining whether the IL-1 ⁇ was bound to the antibody, and contacting a soluble form of IL-1RI with the bound IL-1 ⁇ /antibody complex and determining whether the soluble IL-1RI was bound to the complex.
  • the protocol may also include contacting the soluble IL-1RI with the immobilized antibody before the contact with IL-1 ⁇ , to confirm that the soluble IL-1RI does not bind to the immobilized antibody.
  • This protocol can be performed using a Biacore® instrument for kinetic analysis of binding interactions.
  • Such a protocol can also be employed to determine whether an antibody or other molecule permits or blocks the binding of IL-1 ⁇ to IL-1 receptor type I.
  • the permitting or blocking of IL-1 ⁇ binding to IL-1 receptor type I may be determined by comparing the binding of IL-1 ⁇ to IL-1RI in the presence or absence of IL-1 ⁇ antibodies or IL-1 ⁇ binding fragments thereof. Blocking is identified in the assay readout as a designated reduction of IL-1 ⁇ binding to IL-1 receptor type I in the presence of anti-IL-1 ⁇ antibodies or IL-1 ⁇ binding fragments thereof, as compared to a control sample that contains the corresponding buffer or diluent but not an IL-1 ⁇ antibody or IL-1 ⁇ binding fragment thereof.
  • the assay readout may be qualitatively viewed as indicating the presence or absence of blocking, or may be quantitatively viewed as indicating a percent or fold reduction in binding due to the presence of the antibody or fragment.
  • an IL-1 ⁇ binding antibody or IL-1 ⁇ binding fragment substantially blocks IL-1 ⁇ binding to IL-1R1
  • the IL-1 ⁇ binding to IL-1RI is reduced by at least 10-fold, alternatively at least about 20-fold, alternatively at least about 50-fold, alternatively at least about 100-fold, alternatively at least about 1000-fold, alternatively at least about 10000-fold, or more, compared to binding of the same concentrations of IL-1 ⁇ and IL-1RI in the absence of the antibody or fragment.
  • the IL-1 ⁇ binding to IL-1RI is at least about 90%, alternatively at least about 95%, alternatively at least about 99%, alternatively at least about 99.9%, alternatively at least about 99.99%, alternatively at least about 99.999%, alternatively at least about 99.9999%, alternatively substantially identical to binding of the same concentrations of IL-1 ⁇ and IL-1RI in the absence of the antibody or fragment.
  • the present disclosure may in certain embodiments encompass IL-1 ⁇ binding antibodies or IL-1 ⁇ binding fragments that bind to the same epitope or substantially the same epitope as one or more of the exemplary antibodies described herein.
  • the IL-1 ⁇ binding antibodies or IL-1 ⁇ binding fragments compete with the binding of an antibody having variable region sequences of AB7, described in U.S. application Ser. No. 11/472,813 (sequences shown below).
  • the present disclosure encompasses IL-1 ⁇ binding antibodies and fragments that bind to an epitope contained in the amino acid sequence ESVDPKNYPKKKMEKRFVFNKIE (SEQ ID NO: 3).
  • an IL-1 ⁇ binding antibody or fragment binds to the same epitope or substantially the same epitope as one or more of the exemplary antibodies, such as for example the antibody designated AB7, using any of several known methods in the art.
  • the key amino acid residues (epitope) bound by an IL-1 ⁇ binding antibody or fragment may be determined using a peptide array, such as for example, a PepSpotTM peptide array (JPT Peptide Technologies, Berlin, Germany), wherein a scan of twelve amino-acid peptides, spanning the entire IL-1 ⁇ amino acid sequence, each peptide overlapping by 11 amino acid to the previous one, is synthesized directly on a membrane. The membrane carrying the peptides is then probed with the antibody for which epitope binding information is sought, for example at a concentration of 2 ⁇ g/ml, for 2 hr at room temperature.
  • a peptide array such as for example, a PepSpotTM peptide array (JPT Peptide Technologies, Berlin, Germany), wherein a scan of twelve amino-acid peptides, spanning the entire IL-1 ⁇ amino acid sequence, each peptide overlapping by 11 amino acid to the previous one, is synthesized directly on a membrane. The
  • Binding of antibody to membrane bound peptides may be detected using a secondary HRP-conjugated goat anti-human (or mouse, when appropriate) antibody, followed by enhanced chemiluminescence (ECL).
  • ECL enhanced chemiluminescence
  • the peptides spot(s) corresponding to particular amino acid residues or sequences of the mature IL-1 ⁇ protein, and which score positive for antibody binding, are indicative of the epitope bound by the particular antibody.
  • antibody competition experiments may be performed and such assays are well known in the art.
  • an antibody or fragment binds to an epitope contained in a peptide sequence comprising the amino acids ESVDPKNYPKKKMEKRFVFNKIE (SEQ ID NO: 3), which corresponds to residues 83-105 of the mature IL-1 ⁇ protein
  • an antibody of unknown specificity may be compared with any of the exemplary of antibodies (e.g., AB7) of the present disclosure.
  • Binding competition assays may be performed, for example, using a Biacore® instrument for kinetic analysis of binding interactions or by ELISA.
  • the antibody of unknown epitope specificity is evaluated for its ability to compete for binding against the known comparator antibody (e.g., AB7).
  • Competition for binding to a particular epitope is determined by a reduction in binding to the IL-1 ⁇ epitope of at least about 50%, or at least about 70%, or at least about 80%, or at least about 90%, or at least about 95%, or at least about 99% or about 100% for the known comparator antibody (e.g., AB7) and is indicative of binding to substantially the same epitope.
  • Antigen-binding fragments of an antibody include fragments that retain the ability to specifically bind to an antigen, generally by retaining the antigen-binding portion of the antibody. It is well established that the antigen-binding function of an antibody can be performed by fragments of a full-length antibody.
  • antigen-binding portions include (i) a Fab fragment, which is a monovalent fragment consisting of the VL, VH, CL and CH1 domains; (ii) a F(ab′) 2 fragment, which is a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment which is the VH and CH1 domains; (iv) a Fv fragment which is the VL and VH domains of a single arm of an antibody, (v) a dAb fragment (Ward et al., (1989) Nature 341:544-546), which is a VH domain; and (vi) an isolated complementarity determining region (CDR).
  • a Fab fragment which is a monovalent fragment consisting of the VL, VH, CL and CH1 domains
  • F(ab′) 2 fragment which is a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region
  • Single chain antibodies are also encompassed within the term antigen-binding portion of an antibody.
  • the IL-1 ⁇ binding antibodies and fragments of the present disclosure also encompass monovalent or multivalent, or monomeric or multimeric (e.g. tetrameric), CDR-derived binding domains with or without a scaffold (for example, protein or carbohydrate scaffolding).
  • the present IL-1 ⁇ binding antibodies or fragments may be part of a larger immunoadhesion molecules, formed by covalent or non-covalent association of the antibody or antibody portion with one or more other proteins or peptides.
  • immunoadhesion molecules include use of the streptavidin core region to make a tetrameric scFv molecule (Kipriyanov, S. M., et al. (1995) Human Antibodies and Hybridomas 6:93-101) and use of a cysteine residue, a marker peptide and a C-terminal polyhistidine tag to make bivalent and biotinylated scFv molecules (Kipriyanov, S. M., et al. (1994) Mol. Immunol. 31:1047-1058).
  • Antibodies and fragments comprising immunoadhesion molecules can be obtained using standard recombinant DNA techniques, as described herein.
  • Preferred antigen binding portions are complete domains or pairs of complete domains.
  • the IL-1 ⁇ binding antibodies and fragments of the present disclosure also encompass domain antibody (dAb) fragments (Ward et al., Nature 341:544-546, 1989) which consist of a V H domain.
  • dAb domain antibody
  • the IL-1 ⁇ binding antibodies and fragments of the present disclosure also encompass diabodies, which are bivalent antibodies in which V H and V L domains are expressed on a single polypeptide chain, but using a linker that is too short to allow for pairing between the two domains on the same chain, thereby forcing the domains to pair with complementary domains of another chain and creating two antigen binding sites (see e.g., EP 404,097; WO 93/11161; Holliger et al., Proc. Natl. Acad. Sci. USA 90:6444-6448, 1993, and Poljak et al., Structure 2:1121-1123, 1994).
  • Diabodies can be bispecific or monospecific.
  • the IL-1 ⁇ binding antibodies and fragments of the present disclosure also encompass single-chain antibody fragments (scFv) that bind to IL-1 ⁇ .
  • An scFv comprises an antibody heavy chain variable region (V H ) operably linked to an antibody light chain variable region (V L ) wherein the heavy chain variable region and the light chain variable region, together or individually, form a binding site that binds IL-1 ⁇ .
  • An scFv may comprise a V H region at the amino-terminal end and a V L region at the carboxy-terminal end.
  • scFv may comprise a V L region at the amino-terminal end and a V H region at the carboxy-terminal end.
  • V L and V H are coded for by separate genes, they can be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the V L and V H regions pair to form monovalent molecules (known as single chain Fv (scFv); see e.g., Bird et al. (1988) Science 242:423-426; and Huston et al. (1988) Proc. Natl. Acad. Sci. USA 85:5879-5883).
  • scFv single chain Fv
  • An scFv may optionally further comprise a polypeptide linker between the heavy chain variable region and the light chain variable region.
  • polypeptide linkers generally comprise between 1 and 50 amino acids, alternatively between 3 and 12 amino acids, alternatively 2 amino acids.
  • An example of a linker peptide for linking heavy and light chains in an scFv comprises the 5 amino acid sequence Gly-Gly-Gly-Gly-Ser (SEQ ID NO: 6).
  • Other examples comprise one or more tandem repeats of this sequence (for example, a polypeptide comprising two to four repeats of Gly-Gly-Gly-Gly-Ser (SEQ ID NO: 6) to create linkers.
  • the IL-1 ⁇ binding antibodies and fragments of the present disclosure also encompass heavy chain antibodies (HCAb). Exceptions to the H 2 L 2 structure of conventional antibodies occur in some isotypes of the immunoglobulins found in camelids (camels, dromedaries and llamas; Hamers-Casterman et al., 1993 Nature 363: 446; Nguyen et al., 1998 J. Mol. Biol. 275: 413), wobbegong sharks (Nuttall et al., Mol. Immunol. 38:313-26, 2001), nurse sharks (Greenberg et al., Nature 374:168-73, 1995; Roux et al., 1998 Proc. Nat. Acad. Sci.
  • HCAb heavy chain antibodies
  • IL-1 ⁇ binding antibodies and fragments may be heavy chain antibodies that specifically bind to IL-1 ⁇ .
  • heavy chain antibodies that are a class of IgG and devoid of light chains are produced by animals of the genus Camelidae which includes camels, dromedaries and llamas (Hamers-Casterman et al., Nature 363:446-448 (1993)).
  • HCAbs have a molecular weight of about 95 kDa instead of the about 160 kDa molecular weight of conventional IgG antibodies.
  • Their binding domains consist only of the heavy-chain variable domains, often referred to as V BH to distinguish them from conventional V H . Muyldermans et al., J. Mol. Recognit. 12:131-140 (1999).
  • variable domain of the heavy-chain antibodies is sometimes referred to as a nanobody (Cortez-Retamozo et al., Cancer Research 64:2853-57, 2004).
  • a nanobody library may be generated from an immunized dromedary as described in Conrath et al., ( Antimicrob Agents Chemother 45: 2807-12, 2001) or using recombinant methods.
  • V HH variable domain
  • llama IgG1 is a conventional (H 2 L 2 ) antibody isotype in which V H recombines with a constant region that contains hinge, CH1, CH2 and CH3 domains, whereas the llama IgG2 and IgG3 are heavy chain-only isotypes that lack CH1 domains and that contain no light chains.
  • HCAbs are devoid of light chains, they have an antigen-binding repertoire.
  • the genetic generation mechanism of HCAbs is reviewed in Nguyen et al. Adv. Immunol 79:261-296 (2001) and Nguyen et al., Immunogenetics 54:39-47 (2002).
  • Irving et al. J. Immunol. Methods 248:31-45 (2001); Roux et al., Proc. Natl. Acad. Sci. USA 95:11804 (1998).
  • V HH s comprise small intact antigen-binding fragments (for example, fragments that are about 15 kDa, 118-136 residues). Camelid V HH domains have been found to bind to antigen with high affinity (Desmyter et al., J. Biol. Chem. 276:26285-90, 2001), with V HH affinities typically in the nanomolar range and comparable with those of Fab and scFv fragments. V HH s are highly soluble and more stable than the corresponding derivatives of scFv and Fab fragments. V H fragments have been relatively difficult to produce in soluble form, but improvements in solubility and specific binding can be obtained when framework residues are altered to be more V HH -like.
  • V HH s carry amino acid substitutions that make them more hydrophilic and prevent prolonged interaction with BiP (immunoglobulin heavy-chain binding protein), which normally binds to the H-chain in the Endoplasmic Reticulum (ER) during folding and assembly, until it is displaced by the L-chain. Because of the V HH s′ increased hydrophilicity, secretion from the ER is improved.
  • BiP immunoglobulin heavy-chain binding protein
  • V HH s may be obtained by proteolytic cleavage of HCAb of an immunized camelid, by direct cloning of V HH genes from B-cells of an immunized camelid resulting in recombinant V HH s, or from naive or synthetic libraries.
  • V HH s with desired antigen specificity may also be obtained through phage display methodology. Using V HH s in phage display is much simpler and more efficient compared to Fabs or scFvs, since only one domain needs to be cloned and expressed to obtain a functional antigen-binding fragment. Muyldermans, Biotechnol.
  • Ribosome display methods may be used to identify and isolate scFv and/or V HH molecules having the desired binding activity and affinity. Irving et al., J. Immunol. Methods 248:31-45 (2001). Ribosome display and selection has the potential to generate and display large libraries (10 14 ).
  • V HH -like molecules generated through the process of camelisation, by modifying non-Camelidae V H s, such as human V HH s, to improve their solubility and prevent non-specific binding. This is achieved by replacing residues on the V L s side of V H s with V HH -like residues, thereby mimicking the more soluble V HH fragments.
  • Camelised V H fragments particularly those based on the human framework, are expected to exhibit a greatly reduced immune response when administered in vivo to a patient and, accordingly, are expected to have significant advantages for therapeutic applications.
  • expression systems are available for the production of IL-1 ⁇ fragments including Fab fragments, scFv, and V HH s.
  • expression systems of both prokaryotic and eukaryotic origin may be used for the large-scale production of antibody fragments and antibody fusion proteins.
  • Particularly advantageous are expression systems that permit the secretion of large amounts of antibody fragments into the culture medium.
  • bispecific Fab-scFv (“bibody”) and trispecific Fab-(scFv)(2) (“tribody”) are described in Schoonjans et al. ( J Immunol. 165:7050-57, 2000) and Willems et al. ( J Chromatogr B Analyt Technol Biomed Life Sci. 786:161-76, 2003).
  • a scFv molecule is fused to one or both of the VL-CL (L) and VH-CH 1 (Fd) chains, e.g., to produce a tribody two scFvs are fused to C-term of Fab while in a bibody one scFv is fused to C-term of Fab.
  • a “minibody” consisting of scFv fused to CH3 via a peptide linker (hingeless) or via an IgG hinge has been described in Olafsen, et al., Protein Eng Des Sel. 2004 April; 17(4):315-23.
  • Intrabodies are single chain antibodies which demonstrate intracellular expression and can manipulate intracellular protein function (Biocca, et al., EMBO J. 9:101-108, 1990; Colby et al., Proc Natl Acad Sci USA. 101:17616-21, 2004). Intrabodies, which comprise cell signal sequences which retain the antibody construct in intracellular regions, may be produced as described in Mhashilkar et al., ( EMBO J. 14:1542-51, 1995) and Wheeler et al. ( FASEB J. 17:1733-5, 2003).
  • Transbodies are cell-permeable antibodies in which a protein transduction domains (PTD) is fused with single chain variable fragment (scFv) antibodies Heng et al., ( Med Hypotheses. 64:1105-8, 2005).
  • the IL-1 ⁇ binding antibodies and fragments of the present disclosure also encompass antibodies that are SMIPs or binding domain immunoglobulin fusion proteins specific for target protein. These constructs are single-chain polypeptides comprising antigen binding domains fused to immunoglobulin domains necessary to carry out antibody effector functions. See e.g., WO03/041600, U.S. Patent publication 20030133939 and US Patent Publication 20030118592.
  • the IL-1 ⁇ binding antibodies and fragments of the present disclosure also encompass immunoadhesins.
  • One or more CDRs may be incorporated into a molecule either covalently or noncovalently to make it an immunoadhesin.
  • An immunoadhesin may incorporate the CDR(s) as part of a larger polypeptide chain, may covalently link the CDR(s) to another polypeptide chain, or may incorporate the CDR(s) noncovalently.
  • the CDRs disclosed herein permit the immunoadhesin to specifically bind to IL-1f3.
  • the IL-1 ⁇ binding antibodies and fragments of the present disclosure also encompass antibody mimics comprising one or more IL-1 ⁇ binding portions built on an organic or molecular scaffold (such as a protein or carbohydrate scaffold).
  • an organic or molecular scaffold such as a protein or carbohydrate scaffold.
  • Proteins having relatively defined three-dimensional structures commonly referred to as protein scaffolds, may be used as reagents for the design of antibody mimics.
  • These scaffolds typically contain one or more regions which are amenable to specific or random sequence variation, and such sequence randomization is often carried out to produce libraries of proteins from which desired products may be selected.
  • an antibody mimic can comprise a chimeric non-immunoglobulin binding polypeptide having an immunoglobulin-like domain containing scaffold having two or more solvent exposed loops containing a different CDR from a parent antibody inserted into each of the loops and exhibiting selective binding activity toward a ligand bound by the parent antibody.
  • Non-immunoglobulin protein scaffolds have been proposed for obtaining proteins with novel binding properties. (Tramontano et al., J. Mol. Recognit. 7:9, 1994; McConnell and Hoess, J. Mol. Biol. 250:460, 1995).
  • Other proteins have been tested as frameworks and have been used to display randomized residues on alpha helical surfaces (Nord et al., Nat.
  • the anti-IL-1 ⁇ binding antibodies or binding fragments thereof for use in the methods herein generally bind to IL-1 ⁇ with high affinity (e.g., as determined with BIACORE).
  • the antibody or fragment thereof binds to IL-1 ⁇ with an equilibrium binding dissociation constant (K D ) of about 10 nM or less, about 5 nM or less, about 1 nM or less, about 500 pM or less, about 250 pM or less, about 100 pM or less, about 50 pM or less, or about 25 pM or less.
  • the antibody or antibody fragment binds to human IL-1 ⁇ with a dissociation constant of about 100 pM or less, about 50 pM or less, about 10 pM or less, about 5 pM or less, about 3 pM or less, about 1 pM or less, about 0.75 pM or less, about 0.5 pM or less, about 0.3 pM or less, about 0.2 pM or less, or about 0.1 pM or less.
  • the antibody or antibody fragment binds to human IL-1 ⁇ with a dissociation constant of about 10 pM or less.
  • Antibodies or fragments of the present disclosure may, for example, bind to IL-1 ⁇ with an IC 50 of about 10 nM or less, about 5 nM or less, about 2 nM or less, about 1 nM or less, about 0.75 nM or less, about 0.5 nM or less, about 0.4 nM or less, about 0.3 nM or less, or even about 0.2 nM or less, as determined by enzyme linked immunosorbent assay (ELISA).
  • ELISA enzyme linked immunosorbent assay
  • the antibody or antibody fragment of the present disclosure does not cross-react with any target other than IL-1.
  • the present antibodies and fragments may bind to IL-1 ⁇ , but do not detectably bind to IL-1 ⁇ , or have at least about 100 times (e.g., at least about 150 times, at least about 200 times, or even at least about 250 times) greater selectivity in its binding of IL-1 ⁇ relative to its binding of IL-1 ⁇ .
  • Antibodies or fragments used according to the present disclosure may, in certain embodiments, inhibit IL-1 ⁇ induced expression of serum IL-6 in an animal by at least 50% (e.g., at least 60%, at least 70%, or even at least 80%) as compared to the level of serum IL-6 in an IL-1 ⁇ stimulated animal that has not been administered an antibody or fragment of the present disclosure.
  • Antibodies may bind IL-1 ⁇ but permit or substantially permit the binding of the bound IL-1 ⁇ ligand to IL-1 receptor type I (IL-1R1).
  • IL-1R1 IL-1 receptor type I
  • the antibodies designated AB5 and AB7 selectively bind to the IL-1 ⁇ ligand, but permit the binding of the bound IL-1 ⁇ ligand to IL-1R1.
  • the antibody designated AB7 binds to an IL-1 ⁇ epitope but still permits the bound IL-1 ⁇ to bind to IL-1R1.
  • the antibody may decrease the affinity of interaction of bound IL-1 ⁇ to bind to IL-1R1. Accordingly, the disclosure provides, in a related aspect, use of an IL-1 ⁇ binding antibody or IL-1 ⁇ binding antibody fragment that has at least one of the aforementioned characteristics. Any of the foregoing antibodies, antibody fragments, or polypeptides of the disclosure can be humanized or human engineered, as described herein.
  • IL-1 e.g., IL-1 ⁇
  • antibodies and fragments known in the art may be used according the methods provided herein, including for example antibodies described in or derived using methods described in the following patents and patent applications: U.S. Pat. No. 4,935,343; US 2003/0026806; US 2003/0124617 (e.g., antibody AAL160); WO 2006/081139 (e.g., antibody 9.5.2); WO 03/034984; WO 95/01997 (e.g., antibody SK48-E26 VTKY); U.S. Pat. No.
  • WO 03/010282 e.g., antibody Hu007
  • WO 03/073982 e.g., antibody N55S
  • U.S. Pat. No. 7,541,033 e.g., W17, U43, W13, W18, W20
  • U.S. Pat. No. 7,491,392 WO 2004/072116, WO 2004/067568, EP 0 267 611 B1, EP 0 364 778 B1, and U.S. application Ser. No. 11/472,813.
  • antibodies AB5 and AB7 (U.S. application Ser. No. 11/472,813, WO2007/002261) may be used in accordance with the present disclosure.
  • Variable region sequences of AB5 and AB7 are as follows:
  • HEAVY CHAIN (SEQ ID NO: 5) QVTLKESGPGILKPSQTLSLTCSFSGFSLS TSGMGVG WIRQPSGKGLE WLA HIWWDGDESYNPSLK TQLTISKDTSRNQVFLKITSVDTVDTATYF CAR NRYDPPWFVD WGQGTLVTVSS
  • IL-1 ⁇ antibodies or fragments thereof for use in any and/or all of the methods disclosed herein may bind to human IL-1 ⁇ with a dissociation constant of about 1 nM or less. In some embodiments, the antibody or fragment binds to human IL-1 ⁇ with a dissociation constant of about 500 pM or less. In some embodiments, the anti-IL-1 ⁇ binding antibody or binding fragment thereof binds to human IL-1 ⁇ with a dissociation constant of about 250 pM or less. In some embodiments, the anti-IL-1 ⁇ binding antibody or binding fragment thereof binds to human IL-1 ⁇ with a dissociation constant of about 100 pM or less.
  • the antibody or fragment binds to human IL-1 ⁇ with a dissociation constant of about 50 pM or less. In some embodiments, the antibody or fragment binds to human IL-1 ⁇ with a dissociation constant of about 10 pM or less. In some embodiments, the antibody or fragment binds to human IL-1 ⁇ with a dissociation constant of about 5 pM or less. In some embodiments, the antibody or fragment binds to human IL-1 ⁇ with a dissociation constant of about 1 pM or less. In some embodiments, the antibody or fragment binds to human IL-1 ⁇ with a dissociation constant of about 0.3 pM or less.
  • the anti-IL-1 ⁇ binding antibody or binding fragment thereof is a neutralizing antibody.
  • the anti-IL-1 ⁇ binding antibody or binding fragment thereof binds to an IL-1 ⁇ epitope such that the bound antibody or fragment substantially permits the binding of IL-1 ⁇ to IL-1 receptor I (IL-1R1).
  • IL-1R1 IL-1 receptor I
  • the anti-IL-1 ⁇ binding antibody or binding fragment thereof does not detectably bind to IL-1 ⁇ , IL-1R or IL-1Ra.
  • the anti-IL-1 ⁇ binding antibody or binding fragment thereof competes with the binding of an antibody having the light chain variable region of SEQ ID NO:1 and the heavy chain variable region of SEQ ID NO:2. In some embodiments of any of the methods described above, the anti-IL-1 ⁇ binding antibody or binding fragment thereof binds to an epitope that is the same or substantially the same as an epitope that is bound by an antibody having the light chain variable region of SEQ ID NO:1 and the heavy chain variable region of SEQ ID NO:2. In some embodiments of any of the methods described above, the anti-IL-1 ⁇ binding antibody or binding fragment thereof comprises a light chain variable region of SEQ ID NO:1 and a heavy chain variable region of SEQ ID NO:2.
  • the anti-IL-1 ⁇ binding antibody or binding fragment thereof binds to an epitope incorporating Glu64 of IL-1 ⁇ .
  • the anti-IL-1 ⁇ binding antibody or binding fragment thereof binds to amino acids 1-34 of the N terminus of IL-1 ⁇ .
  • the anti-IL-1 ⁇ binding antibody or binding fragment thereof is humanized or human.
  • the present disclosure also provides uses of an anti-IL-1 ⁇ binding antibody or binding fragment thereof which has a lower IC 50 than an IL-1 ⁇ receptor antagonist in a human whole blood IL-1 ⁇ inhibition assay that measures IL-1 ⁇ induced production of IL-8, in the manufacture of a composition for use in the reduction, prevention or treatment of a cardiac event or a cardiovascular disease.
  • the methods comprise administering a therapeutically effective amount of an anti-IL-1 ⁇ antibody or fragment thereof, wherein the antibody or fragment thereof has a lower IC 50 than an IL-1 ⁇ receptor antagonist in a human whole blood IL-1 ⁇ inhibition assay that measures IL-1 ⁇ induced production of IL-8.
  • the antibody or fragment has an IC 50 that is less than about 90%, 80%, 70%, 60%, 50% of the IC 50 of an IL-1 ⁇ receptor antagonist in a human whole blood IL-1 ⁇ inhibition assay that measures IL-1 ⁇ induced production of IL-8.
  • the antibody or fragment has an IC 50 that is less than about 40%, 30%, 20%, 10% of the IC 50 of an IL-1 ⁇ receptor antagonist in a human whole blood IL-1 ⁇ inhibition assay that measures IL-1 ⁇ induced production of IL-8. In a preferred embodiment, the antibody or fragment has an IC 50 that is less than about 8%, 5%, 4%, 3%, 2%, 1% of the IC 50 of an IL-1 ⁇ receptor antagonist in a human whole blood IL-1 ⁇ inhibition assay that measures IL-1 ⁇ induced production of IL-8.
  • the IL-1 ⁇ receptor antagonist is anakinra (i.e., Kineret®).
  • the method provided herein comprises administering a therapeutically effective amount of an anti-IL-1 ⁇ antibody or fragment thereof to the subject, wherein the antibody or fragment thereof provides in vivo inhibition of IL-1 ⁇ stimulated release of IL-6 in mice compared to a control antibody using an assay that is described by Economides et al., Nature Med., 9:47-52 (2003) which is incorporated by reference.
  • the antibody or fragment provides in vivo inhibition of IL-1 ⁇ stimulated release of IL-6 in mice of at least about 10%, 20%, 30%, 40%, 50% compared to the control antibody.
  • the antibody or fragment provides in vivo inhibition of IL-1 ⁇ stimulated release of IL-6 in mice of at least about 60%, 70%, 80%, 90%, 95% compared to the control antibody.
  • the control antibody is an isotype control antibody.
  • the disclosure provides a method comprising administering a therapeutically effective amount of an anti-IL-1 ⁇ antibody or fragment thereof to the human, wherein the antibody or fragment thereof inhibits Staphylococcus epidermidis induced cytokine production in human whole blood compared to a control where no antibody is used.
  • the antibody or fragment provides a greater level of inhibition of Staphylococcus epidermidis induced cytokine production in human whole blood by at least about 10%, 20%, 30%, 40%, 50% compared to the control.
  • the antibody or fragment provides a greater level of inhibition of Staphylococcus epidermidis induced cytokine production in human whole blood by at least about 60%, 70%, 80%, 90%, 95% compared to the control.
  • the inhibited cytokines are IL-1 ⁇ , IL-1a, IL-6, IL-8, IL-1Ra, TNF ⁇ or IFN ⁇ .
  • the antibodies and antibody fragments described herein can be prepared by any suitable method. Suitable methods for preparing such antibodies and antibody fragments are known in the art. Other methods for preparing the antibodies and antibody fragments are as described herein as part of the disclosure.
  • the antibody, antibody fragment, or polypeptide of the present disclosure, as described herein, can be isolated or purified to any degree.
  • an isolated compound is a compound that has been removed from its natural environment.
  • a purified compound is a compound that has been increased in purity, such that the compound exists in a form that is more pure than it exists (i) in its natural environment or (ii) when initially synthesized and/or amplified under laboratory conditions, wherein “purity” is a relative term and does not necessarily mean “absolute purity.”
  • IL-1 (e.g., IL-1 ⁇ ) binding antibodies and antibody fragments for use according to the present disclosure can be formulated in compositions, especially pharmaceutical compositions, for use in the methods herein.
  • Such compositions comprise a therapeutically or prophylactically effective amount of an IL-1 ⁇ binding antibody or antibody fragment of the disclosure in admixture with a suitable carrier, e.g., a pharmaceutically acceptable agent.
  • a suitable carrier e.g., a pharmaceutically acceptable agent
  • IL-1 ⁇ binding antibodies and antibody fragments of the disclosure are sufficiently purified for administration to an animal before formulation in a pharmaceutical composition.
  • Pharmaceutically acceptable agents include carriers, excipients, diluents, antioxidants, preservatives, coloring, flavoring and diluting agents, emulsifying agents, suspending agents, solvents, fillers, bulking agents, buffers, delivery vehicles, tonicity agents, cosolvents, wetting agents, complexing agents, buffering agents, antimicrobials, and surfactants.
  • Neutral buffered saline or saline mixed with albumin are exemplary appropriate carriers.
  • the pharmaceutical compositions can include antioxidants such as ascorbic acid; low molecular weight polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, arginine or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugar alcohols such as mannitol or sorbitol; salt-forming counterions such as sodium; and/or nonionic surfactants such as Tween, pluronics, or polyethylene glycol (PEG).
  • antioxidants such as ascorbic acid
  • low molecular weight polypeptides such as serum albumin, gelatin, or immunoglobulins
  • hydrophilic polymers such as polyvinyl
  • suitable tonicity enhancing agents include alkali metal halides (preferably sodium or potassium chloride), mannitol, sorbitol, and the like.
  • Suitable preservatives include benzalkonium chloride, thimerosal, phenethyl alcohol, methylparaben, propylparaben, chlorhexidine, sorbic acid and the like. Hydrogen peroxide also can be used as preservative.
  • Suitable cosolvents include glycerin, propylene glycol, and PEG.
  • Suitable complexing agents include caffeine, polyvinylpyrrolidone, beta-cyclodextrin or hydroxy-propyl-beta-cyclodextrin.
  • Suitable surfactants or wetting agents include sorbitan esters, polysorbates such as polysorbate 80, tromethamine, lecithin, cholesterol, tyloxapal, and the like.
  • the buffers can be conventional buffers such as acetate, borate, citrate, phosphate, bicarbonate, or Tris-HCl.
  • Acetate buffer may be about pH 4-5.5, and Tris buffer can be about pH 7-8.5. Additional pharmaceutical agents are set forth in Remington's Pharmaceutical Sciences, 18th Edition, A. R. Gennaro, ed., Mack Publishing Company, 1990.
  • the composition can be in liquid form or in a lyophilized or freeze-dried form and may include one or more lyoprotectants, excipients, surfactants, high molecular weight structural additives and/or bulking agents (see for example U.S. Pat. Nos. 6,685,940, 6,566,329, and 6,372,716).
  • a lyoprotectant is included, which is a non-reducing sugar such as sucrose, lactose or trehalose.
  • the amount of lyoprotectant generally included is such that, upon reconstitution, the resulting formulation will be isotonic, although hypertonic or slightly hypotonic formulations also may be suitable.
  • lyoprotectant concentrations for sugars e.g., sucrose, lactose, trehalose
  • a surfactant is included, such as for example, nonionic surfactants and ionic surfactants such as polysorbates (e.g. polysorbate 20, polysorbate 80); poloxamers (e.g. poloxamer 188); poly (ethylene glycol) phenyl ethers (e.g.
  • Triton sodium dodecyl sulfate (SDS); sodium laurel sulfate; sodium octyl glycoside; lauryl-, myristyl-, linoleyl-, or stearyl-sulfobetaine; lauryl-, myristyl-, linoleyl- or stearyl-sarcosine; linoleyl-, myristyl-, or cetyl-betaine; lauroamidopropyl-, cocamidopropyl-, linoleamidopropyl-, myristamidopropyl-, palmidopropyl-, or isostearamidopropyl-betaine (e.g.
  • lauroamidopropyl myristamidopropyl-, palmidopropyl-, or isostearamidopropyl-dimethylamine; sodium methyl cocoyl-, or disodium methyl ofeyl-taurate; and the MONAQUATTM series (Mona Industries, Inc., Paterson, N.J.), polyethyl glycol, polypropyl glycol, and copolymers of ethylene and propylene glycol (e.g. Pluronics, PF68 etc).
  • Exemplary amounts of surfactant that may be present in the pre-lyophilized formulation are from about 0.001-0.5%.
  • High molecular weight structural additives e.g.
  • fillers, binders may include for example, acacia, albumin, alginic acid, calcium phosphate (dibasic), cellulose, carboxymethylcellulose, carboxymethylcellulose sodium, hydroxyethylcellulose, hydroxypropylcellulose, hydroxypropylmethylcellulose, microcrystalline cellulose, dextran, dextrin, dextrates, sucrose, tylose, pregelatinized starch, calcium sulfate, amylose, glycine, bentonite, maltose, sorbitol, ethylcellulose, disodium hydrogen phosphate, disodium phosphate, disodium pyrosulfite, polyvinyl alcohol, gelatin, glucose, guar gum, liquid glucose, compressible sugar, magnesium aluminum silicate, maltodextrin, polyethylene oxide, polymethacrylates, povidone, sodium alginate, tragacanth microcrystalline cellulose, starch, and zein.
  • compositions can be suitable for parenteral administration.
  • Exemplary compositions are suitable for injection or infusion into an animal by any route available to the skilled worker, such as intraarticular, subcutaneous, intravenous, intramuscular, intraperitoneal, intracerebral (intraparenchymal), intracerebroventricular, intramuscular, intraocular, intraarterial, intralesional, intrarectal, transdermal, oral, and inhaled routes.
  • a parenteral formulation typically will be a sterile, pyrogen-free, isotonic aqueous solution, optionally containing pharmaceutically acceptable preservatives.
  • non-aqueous solvents examples include propylene glycol, polyethylene glycol, vegetable oils such as olive oil, and injectable organic esters such as ethyl oleate.
  • Aqueous carriers include water, alcoholic/aqueous solutions, emulsions or suspensions, including saline and buffered media.
  • Parenteral vehicles include sodium chloride solution, Ringers' dextrose, dextrose and sodium chloride, lactated Ringer's, or fixed oils.
  • Intravenous vehicles include fluid and nutrient replenishers, electrolyte replenishers, such as those based on Ringer's dextrose, and the like.
  • Preservatives and other additives may also be present, such as, for example, anti-microbials, anti-oxidants, chelating agents, inert gases and the like. See generally, Remington's Pharmaceutical Science, 16th Ed., Mack Eds., 1980, which is incorporated herein by reference.
  • compositions described herein can be formulated for controlled or sustained delivery in a manner that provides local concentration of the product (e.g., bolus, depot effect) sustained release and/or increased stability or half-life in a particular local environment.
  • the present disclosure contemplates that in certain embodiments such compositions may include a significantly larger amount of antibody or fragment in the initial deposit, while the effective amount of antibody or fragment actually released and available at any point in time for is in accordance with the disclosure herein an amount much lower than the initial deposit.
  • compositions can include the formulation of IL-1 ⁇ binding antibodies, antibody fragments, nucleic acids, or vectors of the disclosure with particulate preparations of polymeric compounds such as polylactic acid, polyglycolic acid, etc., as well as agents such as a biodegradable matrix, injectable microspheres, microcapsular particles, microcapsules, bioerodible particles beads, liposomes, and implantable delivery devices that provide for the controlled or sustained release of the active agent which then can be delivered as a depot injection.
  • agents such as a biodegradable matrix, injectable microspheres, microcapsular particles, microcapsules, bioerodible particles beads, liposomes, and implantable delivery devices that provide for the controlled or sustained release of the active agent which then can be delivered as a depot injection.
  • Techniques for formulating such sustained- or controlled-delivery means are known and a variety of polymers have been developed and used for the controlled release and delivery of drugs. Such polymers are typically biodegradable and biocompatible.
  • Polymer hydrogels including those formed by complexation of enantiomeric polymer or polypeptide segments, and hydrogels with temperature or pH sensitive properties, may be desirable for providing drug depot effect because of the mild and aqueous conditions involved in trapping bioactive protein agents (e.g., antibodies). See, for example, the description of controlled release porous polymeric microparticles for the delivery of pharmaceutical compositions in PCT Application Publication WO 93/15722.
  • bioactive protein agents e.g., antibodies
  • Suitable materials for this purpose include polylactides (see, e.g., U.S. Pat. No. 3,773,919), polymers of poly-( ⁇ -hydroxycarboxylic acids), such as poly-D-( ⁇ )-3-hydroxybutyric acid (EP 133,988A), copolymers of L-glutamic acid and gamma ethyl-L-glutamate (Sidman et al., Biopolymers, 22: 547-556 (1983)), poly (2-hydroxyethyl-methacrylate) (Langer et al., J. Biomed. Mater. Res., 15: 167-277 (1981), and Langer, Chem.
  • polylactides see, e.g., U.S. Pat. No. 3,773,919
  • polymers of poly-( ⁇ -hydroxycarboxylic acids) such as poly-D-( ⁇ )-3-hydroxybutyric acid (EP 133,988A)
  • biodegradable polymers include poly(lactones), poly(acetals), poly(orthoesters), and poly(orthocarbonates).
  • Sustained-release compositions also may include liposomes, which can be prepared by any of several methods known in the art (see, e.g., Eppstein et al., Proc. Natl. Acad. Sci. USA, 82: 3688-92 (1985)).
  • the carrier itself, or its degradation products, should be nontoxic in the target tissue and should not further aggravate the condition. This can be determined by routine screening in animal models of the target disorder or, if such models are unavailable, in normal animals.
  • Microencapsulation of recombinant proteins for sustained release has been performed successfully with human growth hormone (rhGH), interferon-(rhIFN—), interleukin-2, and MN rgp120.
  • rhGH human growth hormone
  • interferon-(rhIFN—) interferon-(rhIFN—)
  • interleukin-2 interleukin-2
  • MN rgp120 MN rgp120.
  • the sustained-release formulations of these proteins were developed using poly-lactic-coglycolic acid (PLGA) polymer due to its biocompatibility and wide range of biodegradable properties.
  • PLGA poly-lactic-coglycolic acid
  • the degradation products of PLGA, lactic and glycolic acids can be cleared quickly within the human body.
  • the degradability of this polymer can be depending on its molecular weight and composition. Lewis, “Controlled release of bioactive agents from lactide/glycolide polymer,” in: M. Chasin and R.
  • sustained release compositions include, for example, EP 58,481A, U.S. Pat. No. 3,887,699, EP 158,277A, Canadian Patent No. 1176565, U. Sidman et al., Biopolymers 22, 547 [1983], R. Langer et al., Chem. Tech. 12, 98 [1982], Sinha et al., J. Control. Release 90, 261 [2003], Zhu et al., Nat. Biotechnol. 18, 24 [2000], and Dai et al., Colloids Surf B Biointerfaces 41, 117 [2005].
  • Bioadhesive polymers are also contemplated for use in or with compositions of the present disclosure.
  • Bioadhesives are synthetic and naturally occurring materials able to adhere to biological substrates for extended time periods.
  • Carbopol and polycarbophil are both synthetic cross-linked derivatives of poly(acrylic acid).
  • Bioadhesive delivery systems based on naturally occurring substances include for example hyaluronic acid, also known as hyaluronan.
  • Hyaluronic acid is a naturally occurring mucopolysaccharide consisting of residues of D-glucuronic and N-acetyl-D-glucosamine.
  • Hyaluronic acid is found in the extracellular tissue matrix of vertebrates, including in connective tissues, as well as in synovial fluid and in the vitreous and aqueous humour of the eye. Esterified derivatives of hyaluronic acid have been used to produce microspheres for use in delivery that are biocompatible and biodegrable (see for example, Cortivo et al., Biomaterials (1991) 12:727-730; European Publication No. 517,565; International Publication No. WO 96/29998; Illum et al., J. Controlled Rel. (1994) 29:133-141).
  • Exemplary hyaluronic acid containing compositions of the present disclosure comprise a hyaluronic acid ester polymer in an amount of approximately 0.1% to about 40% (w/w) of an IL-1 ⁇ binding antibody or fragment to hyaluronic acid polymer.
  • Both biodegradable and non-biodegradable polymeric matrices can be used to deliver compositions in accordance with the present disclosure, and such polymeric matrices may comprise natural or synthetic polymers. Biodegradable matrices are preferred. The period of time over which release occurs is based on selection of the polymer. Typically, release over a period ranging from between a few hours and three to twelve months is most desirable.
  • Exemplary synthetic polymers which can be used to form the biodegradable delivery system include: polymers of lactic acid and glycolic acid, polyamides, polycarbonates, polyalkylenes, polyalkylene glycols, polyalkylene oxides, polyalkylene terepthalates, polyvinyl alcohols, polyvinyl ethers, polyvinyl esters, poly-vinyl halides, polyvinylpyrrolidone, polyglycolides, polysiloxanes, polyanhydrides, polyurethanes and co-polymers thereof, poly(butic acid), poly(valeric acid), alkyl cellulose, hydroxyalkyl celluloses, cellulose ethers, cellulose esters, nitro celluloses, polymers of acrylic and methacrylic esters, methyl cellulose, ethyl cellulose, hydroxypropyl cellulose, hydroxy-propyl methyl cellulose, hydroxybutyl methyl cellulose, cellulose acetate, cellulose propionate,
  • Exemplary natural polymers include alginate and other polysaccharides including dextran and cellulose, collagen, chemical derivatives thereof (substitutions, additions of chemical groups, for example, alkyl, alkylene, hydroxylations, oxidations, and other modifications routinely made by those skilled in the art), albumin and other hydrophilic proteins, zein and other prolamines and hydrophobic proteins, copolymers and mixtures thereof. In general, these materials degrade either by enzymatic hydrolysis or exposure to water in vivo, by surface or bulk erosion.
  • the polymer optionally is in the form of a hydrogel (see for example WO 04/009664, WO 05/087201, Sawhney, et al., Macromolecules, 1993, 26, 581-587,) that can absorb up to about 90% of its weight in water and further, optionally is cross-linked with multi-valent ions or other polymers.
  • a hydrogel see for example WO 04/009664, WO 05/087201, Sawhney, et al., Macromolecules, 1993, 26, 581-587,
  • Delivery systems also include non-polymer systems that are lipids including sterols such as cholesterol, cholesterol esters and fatty acids or neutral fats such as mono- di- and tri-glycerides; hydrogel release systems; silastic systems; peptide based systems; wax coatings; compressed tablets using conventional binders and excipients; partially fused implants; and the like.
  • Specific examples include, but are not limited to: (a) erosional systems in which the product is contained in a form within a matrix such as those described in U.S. Pat. Nos. 4,452,775, 4,675,189 and 5,736,152 and (b) diffusional systems in which a product permeates at a controlled rate from a polymer such as described in U.S. Pat. Nos.
  • Liposomes containing the product may be prepared by methods known methods, such as for example (DE 3,218,121; Epstein et al., Proc. Natl. Acad. Sci. USA, 82: 3688-3692 (1985); Hwang et al., Proc. Natl. Acad. Sci. USA, 77: 4030-4034 (1980); EP 52,322; EP 36,676; EP 88,046; EP 143,949; EP 142,641; Japanese patent application 83-118008; U.S. Pat. Nos. 4,485,045 and 4,544,545; and EP 102,324).
  • a pharmaceutical composition comprising an IL-1 ⁇ binding antibody or fragment can be formulated for inhalation, such as for example, as a dry powder.
  • Inhalation solutions also can be formulated in a liquefied propellant for aerosol delivery.
  • solutions may be nebulized.
  • Additional pharmaceutical composition for pulmonary administration include, those described, for example, in PCT Application Publication WO 94/20069, which discloses pulmonary delivery of chemically modified proteins.
  • the particle size should be suitable for delivery to the distal lung.
  • the particle size can be from 1 ⁇ m to 5 ⁇ m; however, larger particles may be used, for example, if each particle is fairly porous.
  • formulations containing IL-1 ⁇ binding antibodies or antibody fragments can be administered orally.
  • Formulations administered in this fashion can be formulated with or without those carriers customarily used in the compounding of solid dosage forms such as tablets and capsules.
  • a capsule can be designed to release the active portion of the formulation at the point in the gastrointestinal tract when bioavailability is maximized and pre-systemic degradation is minimized.
  • Additional agents can be included to facilitate absorption of a selective binding agent. Diluents, flavorings, low melting point waxes, vegetable oils, lubricants, suspending agents, tablet disintegrating agents, and binders also can be employed.
  • Another preparation can involve an effective quantity of an IL-1 ⁇ binding antibody or fragment in a mixture with non-toxic excipients which are suitable for the manufacture of tablets.
  • excipients include, but are not limited to, inert diluents, such as calcium carbonate, sodium carbonate or bicarbonate, lactose, or calcium phosphate; or binding agents, such as starch, gelatin, or acacia; or lubricating agents such as magnesium stearate, stearic acid, or talc.
  • Suitable and/or preferred pharmaceutical formulations can be determined in view of the present disclosure and general knowledge of formulation technology, depending upon the intended route of administration, delivery format, and desired dosage. Regardless of the manner of administration, an effective dose can be calculated according to patient body weight, body surface area, or organ size. Further refinement of the calculations for determining the appropriate dosage for treatment involving each of the formulations described herein are routinely made in the art and is within the ambit of tasks routinely performed in the art. Appropriate dosages can be ascertained through use of appropriate dose-response data.
  • an IL-1 ⁇ binding antibody, antibody fragment, nucleic acid, or vector of the disclosure is formulated with a second inhibitor of an IL-1 signaling pathway
  • Representative second inhibitors include, but are not limited to, antibodies, antibody fragments, peptides, polypeptides, compounds, nucleic acids, vectors and pharmaceutical compositions, such as, for example, those described in U.S. Pat. No.
  • compositions may comprise an IL-1 ⁇ binding antibody, antibody fragment, nucleic acid, or vector of the disclosure in combination with an IL-1 ⁇ binding antibody, fragment, or a nucleic acid or vector encoding such an antibody or fragment.
  • Anti-IL-1 ⁇ binding antibodies or binding fragments thereof in a therapeutically effective amount may be used as disclosed by the methods herein for the treatment and/or prevention of cardiovascular disease, including, for example, acute cardiovascular disease or chronic cardiovascular disease.
  • cardiovascular disease including, for example, acute cardiovascular disease or chronic cardiovascular disease.
  • Such methods, as well as pharmaceutical compositions for use in such methods may be used for reducing, treating or preventing a cardiovascular event, such as myocardial infarction, stroke, cardiovascular death, congestive heart failure, cardiac arrest, acute coronary syndrome, angina, or a revascularization procedure in a subject, including in a subject with a history of a risk factor for cardiovascular disease.
  • the methods and pharmaceutical compositions may also be used to reduce mortality following a cardiovascular event in a subject.
  • the present disclosure also contemplates the use of other IL-1 pathway inhibitors, as an alternative or in addition to the anti-IL-1 ⁇ antibodies or fragments.
  • prevention refers to preventing, suppressing or reducing, either temporarily or permanently, the onset of a clinical symptoms or manifestation of an event, disease or condition, such as, for example, a cardiovascular event or disease, (e.g., acute or chronic cardiovascular disease).
  • a cardiovascular event or disease e.g., acute or chronic cardiovascular disease.
  • Such preventing, suppressing or reducing need not be absolute to be useful.
  • reduce refers to delaying the time to an event or disease, decreasing the likelihood or risk of an event or disease, decreasing the incidence of an event or disease (e.g., in a treatment group), preventing the occurrence of an event or disease (e.g., prevention of a cardiovascular event or disease), decreasing the magnitude or severity of an event or disease (except in the case where the event is death), and/or decreasing the time to recovery from an event or disease (except in the case where the event is death), such as, for example, treating or treatment of a cardiovascular event or disease, (e.g., acute or chronic cardiovascular disease).
  • a cardiovascular event or disease e.g., acute or chronic cardiovascular disease
  • the phrase “mortality following a cardiovascular event” as used herein refers to mortality (i.e., death) that occurs after a cardiovascular event (e.g., after initiation of the cardiovascular event), and which may be, but need not be, directly or indirectly caused by or influenced by the cardiovascular event. Following also refers to the proximity in time (e.g., measurable) between the cardiovascular event and mortality, regardless of whether or not a direct or indirect causal link can be determined. The proximity in time between the cardiovascular event and mortality may vary and include an amount of time that is approaching being simultaneous.
  • treatment refers eliminating, reducing, suppressing or ameliorating, either temporarily or permanently, a clinical symptom, manifestation or progression of an event, disease or condition, such as, for example, a cardiovascular event or disease, (e.g., acute or chronic cardiovascular disease). Such treating need not be absolute to be useful.
  • in need of treatment refers to a judgment made by a caregiver that a patient requires or will benefit from treatment. This judgment is made based on a variety of factors that are in the realm of a caregiver's expertise, but that includes the knowledge that the patient is ill, or will be ill, as the result of a condition that is treatable by a method or compound of the disclosure.
  • in need of prevention refers to a judgment made by a caregiver that a patient requires or will benefit from prevention. This judgment is made based on a variety of factors that are in the realm of a caregiver's expertise, but that includes the knowledge that the patient will be ill or may become ill, as the result of a condition that is preventable by a method or compound of the disclosure.
  • terapéuticaally effective amount refers to an amount of a compound (e.g., antibody), either alone or as a part of a pharmaceutical composition, that is capable of having any detectable, positive effect on any symptom, aspect, or characteristics of a disease state or condition when administered to a subject (e.g., as one or more doses), including, for example, reducing a cardiovascular event or disease, or reducing mortality following a cardiovascular event or disease, (e.g., acute or chronic cardiovascular disease). Such effect need not be absolute to be beneficial.
  • the present disclosure provides methods of treating a subject with cardiovascular disease, including, for example, acute cardiovascular disease or chronic cardiovascular disease, comprising administering to said subject a therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof.
  • the present disclosure provides methods of reducing a cardiovascular event in a subject, comprising administering to said subject a therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof, wherein the subject is a subject with a history of a previous cardiovascular event or a history of at least one risk factor for cardiovascular disease, and wherein the cardiovascular event is myocardial infarction, stroke, cardiovascular death, congestive heart failure, cardiac arrest, acute coronary syndrome, angina, or a revascularization procedure.
  • the present disclosure also provides methods of reducing a cardiovascular event (e.g., delaying time to event, reducing likelihood or risk of event, preventing an event, reducing severity of event, reducing time to recovery) in a subject with a history of at least one risk factor for cardiovascular disease, comprising administering to said subject a therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof, and wherein the cardiovascular event is myocardial infarction, stroke, cardiovascular death, congestive heart failure, cardiac arrest, acute coronary syndrome, angina, or a revascularization procedure.
  • a cardiovascular event e.g., delaying time to event, reducing likelihood or risk of event, preventing an event, reducing severity of event, reducing time to recovery
  • the present disclosure also provides methods of reducing a cardiovascular event (e.g., delaying time to event, reducing likelihood or risk of event, preventing an event, reducing severity of event, reducing time to recovery) in a subject with a history of a previous cardiovascular event, comprising administering to said subject a therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof, and wherein said cardiovascular event is myocardial infarction, stroke, cardiovascular death, congestive heart failure, cardiac arrest, acute coronary syndrome, angina or a revascularization procedure.
  • the previous cardiovascular event is a first cardiovascular event.
  • the previous or first cardiovascular event is selected from the group consisting of myocardial infarction, stroke, congestive heart failure, acute coronary syndrome, angina and a revascularization procedure.
  • the previous or first cardiovascular event is myocardial infarction or acute coronary syndrome.
  • the myocardial infarction is myocardial infarction with ST elevation (e.g., ST-segment elevation myocardial infarction, STEMI).
  • the myocardial infarction is myocardial infarction without ST elevation (e.g., non-ST-segment elevation myocardial infarction, NSTEMI).
  • the presence or absence of ST elevation is determined by electrocardiogram (e.g., ECG, EKG).
  • the method of reducing a cardiovascular event is a method of reducing a second or subsequent cardiovascular event.
  • the cardiovascular event e.g., second or subsequent cardiovascular event
  • the cardiovascular event is selected from the group consisting of myocardial infarction, stroke, cardiovascular death, congestive heart failure, cardiac arrest, acute coronary syndrome, angina and a revascularization procedure.
  • the first cardiovascular event and second cardiovascular event are the same types of cardiovascular events. In some embodiments, the first cardiovascular event and second cardiovascular event are different types of cardiovascular events.
  • the revascularization procedure is a coronary, carotid or peripheral arterial revascularization procedure.
  • the coronary, carotid or peripheral arterial revascularization procedure is a percutaneous coronary intervention (PCI), a stent implant, coronary artery bypass graft (CABG), carotid endarterectomy, peripheral vascular disease bypass surgery, or peripheral angioplasty surgery.
  • PCI percutaneous coronary intervention
  • CABG coronary artery bypass graft
  • carotid endarterectomy carotid endarterectomy
  • peripheral vascular disease bypass surgery or peripheral angioplasty surgery.
  • the therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof is first administered within 1 week of the cardiovascular event, within 96 hours of the cardiovascular event, within 72 hours of the cardiovascular event, within 48 hours of the cardiovascular event, within 24 hours of the cardiovascular event, or within 12 hours of the cardiovascular event.
  • the subject also has a history of at least one risk factor for cardiovascular disease.
  • the risk factor is manifest coronary heart disease, coronary artery disease, thrombosis, transient ischaemic attack, left ventricular hypertrophy, arteriosclerosis, restenosis, tobacco smoking or peripheral vascular disease.
  • the peripheral vascular disease is clinically apparent (e.g., peripheral artery disease of Fontaine Class II or greater).
  • the risk factor is elevated triglycerides, systemic inflammation, high blood phosphorus levels, high parathyroid hormone levels, microalbuminuria, or high homocysteine levels.
  • the risk factor is obesity, hyperglycemia, chronic renal failure, high blood glucose, chronic kidney disease, or metabolic syndrome.
  • the risk factor is end stage renal disease.
  • the risk factor is hypertension, dyslipidemia, hyperlipidemia, elevated total cholesterol, elevated LDL cholesterol, or low HDL cholesterol or atherosclerosis.
  • the hypertension is manifested as a blood pressure of greater than or equal to 180/110 mm Hg.
  • the hypertension is mild-to-moderate, with systolic blood pressure (SBP) of 140 to 180 mm Hg and/or diastolic blood pressure (DBP) of 90 to 110 mm Hg.
  • the subject has elevated levels of C-reactive protein (CRP).
  • CRP C-reactive protein
  • the subject is older than 55 years. In some embodiments, the subject is older than 65 years. In some embodiments, the subject is non-hypertensive. In some embodiments, the subject has poorly controlled hypertension.
  • the subject has a “Type A” personality.
  • the subject has a sedentary lifestyle.
  • the subject has diabetes mellitus. In some embodiments, the diabetes mellitus is Type 2 diabetes.
  • the subject has a history of two or more said risk factors. In some embodiments, the subject has a history of three or more said risk factors.
  • administering said therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof is sufficient to achieve a decrease in CRP levels.
  • the present disclosure also provides methods of reducing mortality following a cardiovascular event in a subject, comprising administering to said subject a therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof.
  • the cardiovascular event is myocardial infarction, stroke, cardiac arrest, congestive heart failure, cardiovascular death, acute coronary syndrome (e.g., diagnosed), angina or a revascularization procedure.
  • the cardiovascular event is myocardial infarction or acute coronary syndrome.
  • the myocardial infarction is myocardial infarction with ST elevation (e.g., ST-segment elevation myocardial infarction, STEMI).
  • the myocardial infarction is myocardial infarction without ST elevation (e.g., non-ST-segment elevation myocardial infarction, NSTEMI).
  • ST elevation e.g., non-ST-segment elevation myocardial infarction, NSTEMI
  • the presence or absence of ST elevation is determined by electrocardiogram (e.g., ECG, EKG).
  • mortality is death from cardiovascular causes. In other embodiments, mortality is death from any cause.
  • the cardiovascular event is myocardial infarction, stroke, congestive heart failure, acute coronary syndrome, angina or a revascularization procedure.
  • the revascularization procedure is a coronary, carotid or peripheral arterial revascularization procedure.
  • the coronary, carotid or peripheral arterial revascularization procedure is a percutaneous coronary intervention (PCI), a stent implant, coronary artery bypass graft (CABG), carotid endarterectomy, peripheral vascular disease bypass surgery, or peripheral angioplasty surgery.
  • PCI percutaneous coronary intervention
  • CABG coronary artery bypass graft
  • CABG coronary artery bypass graft
  • carotid endarterectomy peripheral vascular disease bypass surgery
  • peripheral angioplasty surgery peripheral angioplasty surgery.
  • the therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof is first administered within 1 week of the cardiovascular event, within 96 hours of the cardiovascular event, within 72 hours of the cardiovascular event, within 48 hours of the cardiovascular event, within 24 hours of the cardiovascular event, or within 12 hours of the cardiovascular event.
  • the subject does not have Type 2 diabetes.
  • the subject has survived a previous cardiovascular event of myocardial infarction or stroke.
  • the occurrence of said cardiovascular event is a reoccurrence of a cardiovascular event of myocardial infarction or stroke.
  • the subject has a history of one or more risk factors for cardiovascular disease.
  • the risk factor is manifest coronary heart disease, coronary artery disease, thrombosis, transient ischaemic attack, left ventricular hypertrophy, arteriosclerosis, restenosis, tobacco smoking or peripheral vascular disease.
  • the peripheral vascular disease is clinically apparent (e.g., peripheral artery disease of Fontaine Class II or greater).
  • the risk factor is elevated triglycerides, systemic inflammation, high blood phosphorus levels, high parathyroid hormone levels, microalbuminuria, or high homocysteine levels.
  • the risk factor is obesity, hyperglycemia, chronic renal failure, high blood glucose, chronic kidney disease, or metabolic syndrome.
  • the risk factor is hypertension, dyslipidemia, hyperlipidemia, elevated total cholesterol, elevated LDL cholesterol, or low HDL cholesterol or atherosclerosis.
  • the hypertension is manifested as a blood pressure of greater than or equal to 180/110 mm Hg.
  • the hypertension is mild-to-moderate, with systolic blood pressure (SBP) of 140 to 180 mm Hg and/or diastolic blood pressure (DBP) of 90 to 110 mm Hg.
  • SBP systolic blood pressure
  • DBP diastolic blood pressure
  • the subject is non-hypertensive. In some embodiments, the subject has poorly controlled hypertension. In some embodiments, the subject has a “Type A” personality. In some embodiments, the subject has a sedentary lifestyle. In some embodiments, the subject has a history of two or more said risk factors. In some embodiments, the subject has a history of three or more said risk factors.
  • administering said therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof is sufficient to achieve a decrease in CRP levels.
  • the present disclosure also provides methods of reducing a cardiovascular event in a subject with a history of at least one risk factor for cardiovascular disease, comprising administering to said subject a therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof, and wherein said risk factor is not Type 2 diabetes, obesity, hyperglycemia, dyslipidemia, hyperlipidemia, chronic renal failure, high blood glucose, chronic kidney disease, hypertension, atherosclerosis or metabolic syndrome.
  • the cardiovascular event is myocardial infarction, stroke, cardiac arrest, congestive heart failure, cardiovascular death, acute coronary syndrome (e.g., diagnosed), angina or a revascularization procedure.
  • the revascularization procedure is a coronary, carotid or peripheral arterial revascularization procedure.
  • the coronary, carotid or peripheral arterial revascularization procedure is a percutaneous coronary intervention (PCI), a stent implant, coronary artery bypass graft (CABG), carotid endarterectomy, peripheral vascular disease bypass surgery, or peripheral angioplasty surgery.
  • PCI percutaneous coronary intervention
  • CABG coronary artery bypass graft
  • CABG coronary artery bypass graft
  • carotid endarterectomy peripheral vascular disease bypass surgery
  • peripheral angioplasty surgery peripheral angioplasty surgery.
  • the risk factor is manifest coronary heart disease, coronary artery disease, thrombosis, transient ischaemic attack, left ventricular hypertrophy, arteriosclerosis, restenosis, tobacco smoking or peripheral vascular disease.
  • the risk factor is elevated triglycerides, systemic inflammation, high blood phosphorus levels, high parathyroid hormone levels, microalbuminuria, or high homocysteine levels.
  • the subject has elevated levels of C-reactive protein (CRP). In some embodiments, the subject is older than 55 years. In some embodiments, the subject is older than 65 years. In some embodiments, the subject has a history of two or more said risk factors. In some embodiments, the subject has a history of three or more said risk factors.
  • CRP C-reactive protein
  • administering said therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof is sufficient to achieve a decrease in CRP levels.
  • the present disclosure also provides methods of treating a cardiovascular event in a subject, wherein the cardiovascular event is myocardial infarction, stroke, congestive heart failure, acute coronary syndrome or angina, comprising administering to said subject a therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof and at least one other pharmaceutical composition comprising an active agent other than an IL-1 ⁇ antibody or fragment.
  • the active agent of said at least one other pharmaceutical composition is a cholesterol lowering agent, a statin, an HMG-CoA reductase inhibitor, a calcium channel blocker, a beta blocker, an antihypertensive, a diuretic, aspirin, niacin, an angiotensin-converting enzyme (ACE) inhibitor, an angiotensin II receptor blocker, a vasodilator, an anticoagulant, a inhibitor of platelet aggregation, a thrombolytic or digitalis.
  • ACE angiotensin-converting enzyme
  • the present disclosure also provides methods of treating a cardiovascular event in a subject, wherein the cardiovascular event is myocardial infarction, stroke, congestive heart failure, acute coronary syndrome or angina, comprising administering to said subject a therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof and a revascularization procedure.
  • the revascularization procedure is a coronary, carotid or peripheral arterial revascularization procedure.
  • the present disclosure also provides methods of reducing restenosis in a subject following a revascularization procedure, comprising administering to said subject a therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof.
  • the revascularization procedure is a coronary, carotid or peripheral arterial revascularization procedure.
  • the present disclosure also provides methods of treating acute hypertension in a subject comprising administering to said subject a therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof and one or more antihypertensive agents.
  • the subject has a blood pressure of greater than or equal to 180/110 mm Hg.
  • the subject has mild-to-moderate hypertension, with systolic blood pressure (SBP) of 140 to 180 mm Hg and/or diastolic blood pressure (DBP) of 90 to 110 mm Hg.
  • SBP systolic blood pressure
  • DBP diastolic blood pressure
  • the antihypertensive agent is administered intravenously.
  • the antihypertensive agent is selected from the group consisting of alpha/beta-adrenergic blocking agents, angiotensin-converting enzyme inhibitors, angiotensin II receptor antagonists, antiadrenergic agents, beta-adrenergic blocking agents, calcium-channel blocking agents, diuretics, and vasodilators.
  • the antihypertensive agent is carvedilol, labetalol, benazepril, captopril, enalapril, fosinopril, lisinopril, moexipril, perindopril, quinapril, ramipril, trandolapril, candesartan, eprosartan, irbesartan, losartan, telmisartan, valsartan, clonidine, doxazosin, guanabenz, guanadrel, guanethidine, guanfacine, mecamylamine, methyldopa, prazosin, reserpine, terazosin, acebutolol, atenolol, betaxolol, bisoprolol, carteolol, metoprolol, nadolol, penbutolol, pind
  • the present disclosure also provides methods of reducing, preventing or treating a cardiovascular event or disease in a subject comprising administering to the subject an anti-IL-1 ⁇ binding antibody or binding fragment thereof in combination with (e.g., before, during or after) a medical or surgical intervention.
  • Such antibodies may be administered in therapeutically effective amounts.
  • Such interventions may be therapeutically effective.
  • a medical intervention is an active agent, such as a drug or a biologic, including, for example, any one or more of the active agents described herein.
  • a medical intervention is an out-patient medical treatment or procedure.
  • a medical intervention is an in-patient hospitalization.
  • a surgical intervention is a revascularization procedure, including, for example, any one or more of the revascularization procedures described herein.
  • a surgical intervention involves a heart valve repair or replacement, coronary bypass surgery, heart transplant or heart pump.
  • a surgical intervention involves a biventricular cardiac pacemaker, internal cardiac defibrillator (ICD) or myectomy.
  • a medical intervention is smoking cessation medication or smoking cessation counseling.
  • the present disclosure also provides methods of reducing a cardiovascular event in a subject with a history of at least one risk factor for cardiovascular disease, comprising (a) identifying, diagnosing or selecting the subject with the history of at least one risk factor for cardiovascular disease and (b) administering to the subject a therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof, and wherein the cardiovascular event is myocardial infarction, stroke, cardiovascular death, congestive heart failure, cardiac arrest, acute coronary syndrome, angina, or a revascularization procedure.
  • the present disclosure also provides methods of reducing a cardiovascular event in a subject with a history of a previous cardiovascular event, comprising (a) identifying, diagnosing or selecting the subject with the history of the previous cardiovascular event and (b) administering to the subject a therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof, and wherein the cardiovascular event is myocardial infarction, stroke, acute coronary syndrome, angina or a revascularization procedure.
  • the present disclosure also provides methods of reducing mortality following a cardiovascular event in a subject, comprising (a) identifying, diagnosing or selecting the subject having the cardiovascular event and (b) administering to the subject a therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof.
  • the present disclosure also provides methods of reducing a cardiovascular event in a subject with a history of at least one risk factor for cardiovascular disease, comprising (a) identifying, diagnosing or selecting the subject with the history of at least one risk factor for cardiovascular disease and (b) administering to the subject a therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof, and wherein the risk factor is not Type 2 diabetes, obesity, hyperglycemia, dyslipidemia, hyperlipidemia, chronic renal failure, high blood glucose, chronic kidney disease, hypertension, atherosclerosis or metabolic syndrome.
  • the present disclosure also provides methods of treating a cardiovascular event in a subject, wherein the cardiovascular event is myocardial infarction, stroke, congestive heart failure, acute coronary syndrome or angina, comprising (a) identifying, diagnosing or selecting the subject with the cardiovascular event and (b) administering to the subject a therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof and at least one other pharmaceutical composition comprising an active agent other than an IL-1 ⁇ antibody or fragment.
  • the present disclosure also provides methods for treating a cardiovascular event in a subject, wherein the cardiovascular event is myocardial infarction, stroke, congestive heart failure, acute coronary syndrome or angina, comprising (a) identifying, diagnosing or selecting the subject with the cardiovascular event and (b) administering to the subject a therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof and a revascularization procedure.
  • the present disclosure also provides methods of reducing restenosis in a subject following a revascularization procedure, comprising (a) identifying, diagnosing or selecting the subject with the revascularization procedure and (b) administering to the subject a therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof.
  • the present disclosure also provides methods of treating acute hypertension in a subject comprising (a) identifying, diagnosing or selecting the subject with acute hypertension and (b) administering to the subject a therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof and one or more antihypertensive agents.
  • the hypertension is manifested as a blood pressure of greater than or equal to 180/110 mm Hg.
  • the hypertension is mild-to-moderate, with systolic blood pressure (SBP) of 140 to 180 mm Hg and/or diastolic blood pressure (DBP) of 90 to 110 mm Hg.
  • SBP systolic blood pressure
  • DBP diastolic blood pressure
  • the present disclosure also provides methods of reducing in a subject with a history of recent myocardial infarction (MI), recent stroke, or established peripheral arterial disease, the rate of a combined endpoint of new ischemic stroke (fatal or not), new MI (fatal or not), and other vascular death, comprising administering to said subject a therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof.
  • the subject has acute coronary syndrome without ST segment elevation (e.g., unstable angina or non-Q-wave myocardial infarction).
  • the anti-IL-1 ⁇ binding antibody or binding fragment thereof is administered initially within 12, 24, 48 or 72 hours of onset of the most recent episode of chest pain or symptoms consistent with ischemia.
  • the subject has either ECG changes compatible with new ischemia (e.g., without ST segment elevation) or elevated cardiac enzymes or troponin I or T to at least twice the upper limit of normal.
  • the present disclosure also provides methods of reducing atherothrombotic events in a subject with a history of recent myocardial infarction (MI), recent stroke, or established peripheral arterial disease, comprising administering to said subject a therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof.
  • the subject has acute coronary syndrome without ST segment elevation (e.g., unstable angina or non-Q-wave myocardial infarction).
  • the anti-IL-1 ⁇ binding antibody or binding fragment thereof is administered initially within 72 hrs, or preferably 48 hours, or more preferably 24, 12, 6 or 3 hours of onset of the most recent episode of chest pain or symptoms consistent with ischemia.
  • the subject has either ECG changes compatible with new ischemia (e.g., without ST segment elevation) or elevated cardiac enzymes or troponin I or T to at least twice the upper limit of normal.
  • the present disclosure also provides methods of reducing in subjects with ST-segment elevation acute myocardial infarction, the rate of death from any cause and the rate of a combined endpoint of death, re-infarction or stroke, comprising administering to said subject a therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof.
  • the anti-IL-1 ⁇ binding antibody or binding fragment thereof is administered initially within 72 hrs, or preferably 48 hours, or more preferably 24, 12, 6 or 3 hours of the subject presenting with symptoms of myocardial infarction.
  • the subject is a patient with cardiovascular disease, including, for example, acute cardiovascular disease or chronic cardiovascular disease.
  • administering said therapeutically effective amount of an anti-IL-1 ⁇ binding antibody or binding fragment thereof is sufficient to achieve a decrease in CRP levels.
  • the present disclosure also provides uses of an anti-IL-1 ⁇ binding antibody or binding fragment thereof which has a lower IC 50 than an IL-1 ⁇ receptor antagonist in a human whole blood IL-1 ⁇ inhibition assay that measures IL-1 ⁇ induced production of IL-8, in the manufacture of a composition for use in the reduction, prevention or treatment of a cardiac event or a cardiovascular disease.
  • a reduction of a cardiovascular event may be evaluated in subjects over a period of 2 or more years, 3 or more years, 4 or more years, or 5 or more years following the cardiovascular event and/or initial administration of the IL-1 ⁇ binding antibody or binding fragment thereof.
  • a therapeutically effective amount of anti-IL-1 ⁇ binding antibody or binding fragment thereof may also be sufficient to achieve a decrease in C-reactive protein (CRP) levels.
  • CRP C-reactive protein
  • the reduction in CRP levels is readily measured using standard assays (e.g., high-sensitivity CRP, ultra-sensitive CRP).
  • the decrease in C-reactive protein levels may, for example, be a decrease of ⁇ 0.2, ⁇ 0.4, ⁇ 0.6, ⁇ 0.8, ⁇ 1.0, ⁇ 1.4, ⁇ 1.8, ⁇ 2.2, ⁇ 2.6, ⁇ 3.0 mg/L from pre-treatment levels.
  • the decrease in C-reactive protein levels may, for example, be a decrease of >20%, >30%, >40%, >50%, >60%, >70%, >80%, >90%, >95% from pre-treatment levels.
  • subjects treated as disclosed herein may experience a measurable improvement in lipid profile (e.g., decrease in serum lipids, change in ratio of HDL and LDL).
  • a measurable improvement in lipid profile e.g., decrease in serum lipids, change in ratio of HDL and LDL.
  • Such measurements of serum lipids and/or lipid profile may include, for example a decrease in cholesterol, a decrease in low-density lipoprotein cholesterol (LDL), a decrease in very-low-density lipoprotein cholesterol (VLDL), a decrease in triglycerides, a decrease in free fatty acids, a decrease in apolipoprotein B (Apo B), an increase in high-density lipoprotein cholesterol (HDL), maintaining the level of high-density lipoprotein cholesterol (HDL) compared to pre-treatment level, and/or an increase in apolipoprotein A (Apo A).
  • LDL low-density lipoprotein cholesterol
  • VLDL very-
  • a decrease in the level of cholesterol may be a decrease of at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, or more from the pre-treatment level.
  • a decrease in the level of low-density lipoprotein cholesterol may be a decrease of at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, or more from the pre-treatment level.
  • a decrease in the triglyceride level in the blood of the subject may be a decrease of at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, or more from the pre-treatment level.
  • a decrease in the level of free fatty acids may be a decrease of at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, or more from the pre-treatment level.
  • An increase in the level of high-density lipoprotein cholesterol may be an increase of at least 1%, 2%, 3%, 4%, 5%, 6%, 8%, 10%, 12%, 14%, 16%, or more from the pre-treatment level.
  • the aforementioned diagnoses and measurements may be made using standard medical practices known in the art and/or any of a variety of standard assays known in the art, such as for example assays published in Chemecky C C, Berger B J, eds. (2004). Laboratory Tests and Diagnostic Procedures, 4th ed. Philadelphia: Saunders; Fischbach F T, Dunning M B III, eds. (2004). Manual of Laboratory and Diagnostic Tests, 7th ed. Philadelphia: Lippincott Williams and Wilkins; Genest J, et al. (2003). Recommendations for the management of dyslipidemia and the prevention of cardiovascular disease: Summary of the 2003 update. Canadian Medical Association Journal, 169(9): 921-924.
  • Anti-IL-1 ⁇ binding antibodies or binding fragments thereof for use in any and/or all of the aforementioned methods may be administered in one or more doses (e.g., initial dose and one or more subsequent doses).
  • the anti-IL-1 ⁇ binding antibody or binding fragment thereof is administered in one or more doses of 10 mg/kg or less, 5 mg/kg or less, 3 mg/kg or less, or 2 mg/kg or less of antibody or fragment.
  • the anti-IL-1 ⁇ binding antibody or binding fragment thereof is administered in one or more doses of 1 mg/kg or less, one or more doses of 0.5 mg/kg or less, one or more doses of 0.3 mg/kg or less, one or more doses of 0.1 mg/kg or less, or one or more doses of 0.03 mg/kg or less of antibody or fragment.
  • the one or more doses are at least 0.01 mg/kg of anti-IL-1 ⁇ binding antibody or binding fragment thereof.
  • the anti-IL-1 ⁇ binding antibody or binding fragment thereof is administered in one or more doses of about 0.01 mg/kg to 1 mg/kg, about 0.03 mg/kg to 1 mg/kg, about 0.01 mg/kg to 0.3 mg/kg, or about 0.1 mg/kg to 0.3 mg/kg. In some embodiments, the anti-IL-1 ⁇ binding antibody or binding fragment thereof is administered in one or more doses of about 0.001 mg/kg to 0.3 mg/kg, about 0.001 mg/kg to 0.1 mg/kg, about 0.001 mg/kg to 0.03 mg/kg or about 0.001 mg/kg to 0.01 mg/kg.
  • the initial dose and one or more subsequent doses of anti-IL-1 ⁇ binding antibody or binding fragment thereof are each from about 0.01 mg/kg to about 10 mg/kg of antibody, from about 0.05 to about 5 mg/kg of antibody, from about 0.05 mg/kg to about 3 mg/kg of antibody, from about 0.1 mg/kg to about 3 mg/kg of antibody, from about 0.1 mg/kg to about 1 mg/kg of antibody, from about 0.1 mg/kg to about 0.5 mg/kg of antibody, from about 0.3 mg/kg to about 5 mg/kg of antibody, from about 0.3 mg/kg to about 3 mg/kg of antibody, from about 0.3 mg/kg to about 1 mg/kg of antibody, from about 0.5 mg/kg to about 5 mg/kg of antibody, from about 0.5 mg/kg to about 3 mg/kg of antibody, from about 0.5 mg/kg to about 1 mg/kg of antibody, from about 0.5 mg/kg to about 5 mg/kg of antibody, from about 0.5 mg/kg to about 3 mg/kg of antibody, from about 0.5 mg/kg to
  • two or more, three or more, four or more, five or more, six or more, seven or more, eight or more, nine or more, ten or more or eleven or more subsequent doses of the antibody are administered.
  • the aforementioned dosage amounts refer to mg (antibody or fragment)/kg (weight of the individual to be treated).
  • Anti-IL-1 ⁇ binding antibodies or binding fragment thereof for use in any and/or all of the aforementioned methods may be administered as a fixed dose, independent of a dose per subject weight ratio.
  • the anti-IL-1 ⁇ binding antibody or binding fragment thereof is administered in one or more fixed doses of 1000 mg or less, 500 mg or less, or 250 mg or less of antibody or fragment.
  • the anti-IL-1 ⁇ binding antibody or binding fragment thereof is administered in one or more fixed doses of 100 mg or less, 25 mg or less, or 10 mg or less of antibody or fragment.
  • the anti-IL-1 ⁇ binding antibody or binding fragment thereof is administered in one or more doses of at least 0.5 mg of antibody or fragment.
  • the anti-IL-1 ⁇ binding antibody or binding fragment thereof is administered in one or more doses of at least 1 mg of antibody or fragment. In some embodiments, the anti-IL-1 ⁇ binding antibody or binding fragment thereof is administered in one or more doses of at least 10 mg of antibody or fragment. In some embodiments, the anti-IL-1 ⁇ binding antibody or binding fragment thereof is administered in one or more doses of 1 mg to 100 mg of antibody or fragment.
  • the fixed dose of anti-IL-1 ⁇ binding antibody or binding fragment thereof is from about 1 mg to about 10 mg, about 1 mg to about 25 mg, about 10 mg to about 25 mg, about 10 mg to about 50 mg, about 10 mg to about 100 mg, about 25 mg to about 50 mg, about 25 mg to about 100 mg, about 50 mg to about 100 mg, about 50 mg to about 150 mg, about 100 mg to about 150 mg, about 100 mg to about 200 mg, about 150 mg to about 200 mg, about 150 mg to about 250 mg, about 200 mg to about 250 mg, about 200 mg to about 300 mg, about 250 mg to about 300 mg, about 250 mg to about 500 mg, about 300 mg to about 400 mg, about 400 mg to about 500 mg, about 400 mg to about 600 mg, about 500 mg to about 750 mg, about 600 mg to about 750 mg, about 700 mg to about 800 mg, or about 750 mg to about 1000 mg.
  • the fixed dose anti-IL-1 ⁇ binding antibody or binding fragment thereof is from about 1 mg to about 10 mg, about 1 mg to about 25 mg, about 10 mg to about 25 mg, about 10 mg to about 100 mg, about 25 mg to about 50 mg, about 50 mg to about 100 mg, about 100 mg to about 150 mg, about 150 mg to about 200 mg, or about 200 mg to about 250 mg.
  • the fixed dose of anti-IL-1 ⁇ binding antibody or binding fragment thereof is administered using a pre-filled syringe or delivery device.
  • the anti-IL-1 ⁇ binding antibody or binding fragment thereof is administered by subcutaneous, intravenous or intramuscular injection.
  • administering is followed by the administration of one or more subsequent doses.
  • the initial dose and one or more subsequent doses are administered at an interval of about once every week to about once every 12 months.
  • the initial dose and one or more subsequent doses are administered at an interval of about once every two weeks to about once every 6 months.
  • the initial dose and one or more subsequent doses are administered at an interval of about once every month to about once every 6 months.
  • the initial dose and one or more subsequent doses are administered at an interval of about once every month to about once every 3 months.
  • the initial dose and one or more subsequent doses are administered at an interval of about once every 3 months to about once every 6 months.
  • the disclosure also provides dosing regimens for use in any and/or all of the aforementioned methods, wherein the dosing regimens comprise more than one dosing interval for administration of an IL-1 ⁇ binding antibody or binding fragment thereof.
  • the dosage regimen comprises at least two (e.g., two, three, four, five, six) different dosing intervals for administration of the IL-1 ⁇ antibody or fragment thereof.
  • the dosage regimen comprises two different dosing intervals for administration of the IL-1 ⁇ antibody or fragment thereof.
  • the dosing regimen comprises two different dosing intervals for administration of the IL-1 ⁇ binding antibody or binding fragment thereof, wherein a first dosing interval comprises administration of one or more doses of the IL-1 ⁇ antibody or fragment thereof and a second dosing interval comprises administration of one or more doses of the IL-1 ⁇ antibody or fragment thereof, and wherein the first dosing interval is shorter in time than the second dosing interval.
  • the first dosing interval may be days or weeks, and the second dosing interval may be months.
  • the first dosing interval is about 5 days to about 28 days, about 7 days to about 21 days, about 12 days to about 16 days, or about 14 days.
  • the second dosing interval is about 1 month to about 3 months, about 1 month to about 2 months, or about 1 month.
  • the first dosing interval is about 7 days and the second dosing interval is about 1 month.
  • administration of an initial dose of anti-IL-1 ⁇ binding antibody or binding fragment thereof is followed by administration of one or more subsequent doses, and wherein the dosing intervals between administration of the initial dose and a second dose, and the second dose and a third dose are about 7 days to about 21 days, and wherein the dosing intervals between administration of subsequent doses is about 1 month to about 3 months.
  • the dosing intervals between administration of the initial dose and a second dose, and the second dose and a third dose are about 12 to 16 days, and the dosing intervals between administration of subsequent doses is about 1 month to about 2 months.
  • the dosing intervals between administration of the initial dose and a second dose, and the second dose and a third dose are about 14 days, and the dosing intervals between administration of subsequent doses is about 1 month.
  • the anti-IL-1 ⁇ binding antibody or binding fragment thereof is administered to a subject such that the interval between doses is a time sufficient to maintain a plasma concentration of said antibody or antibody fragment in the subject at a level of at least about 0.1 ug/mL.
  • the anti-IL-1 ⁇ binding antibody or binding fragment thereof is administered to a subject such that the interval between doses is a time sufficient to maintain a plasma concentration of said antibody or antibody fragment in the subject at a level of at least about 0.3 ug/mL. In some embodiments, the anti-IL-1 ⁇ binding antibody or binding fragment thereof is administered to a subject such that the interval between doses is a time sufficient to maintain a plasma concentration of said antibody or antibody fragment in the subject at a level of at least about 1 ug/mL. In some embodiments, these plasma concentration values refer to values obtained for an individual that is treated with the antibody of fragment in accordance with the disclosure herein.
  • administering is followed by the administration of one or more subsequent doses, and wherein said one or more subsequent doses are in an amount that is approximately the same or less than the initial dose.
  • administering is followed by the administration of one or more subsequent doses, and wherein at least one of the subsequent doses is in an amount that is more than the initial dose.
  • the anti-IL-1 ⁇ binding antibody or binding fragment thereof has a lower IC 50 than an IL-1 ⁇ receptor antagonist in a human whole blood IL-1 ⁇ inhibition assay that measures IL-1 ⁇ induced production of IL-8.
  • the IL-1 ⁇ receptor antagonist is anakinra.
  • an anti-IL-1 ⁇ binding antibody or binding fragment is administered, wherein administration of an initial dose of the antibody or antibody fragment is followed by the administration of one or more subsequent doses, and wherein the plasma concentration of said antibody or antibody fragment in the human is permitted to decrease below a level of about 0.1 ug/mL for a period of time greater than about 1 week and less than about 6 months between administrations during a course of treatment with said initial dose and one or more subsequent doses.
  • the plasma concentration of said antibody or antibody fragment is permitted to decrease below a level of about 0.07 ug/mL, about 0.05 ug/mL, about 0.03 ug/mL or about 0.01 ug/mL for a period of time greater than about 1 week and less than about 5 months, about 4 months, about 3 months, about 2 months, about 1 month, about 3 weeks, or about 2 weeks between administrations.
  • the plasma concentration values refer to values obtained for an individual that is treated with the antibody of fragment in accordance with the disclosure herein.
  • compositions comprising one or more other active agents may be administered in conjunction with (e.g., separately from) the IL-1 ⁇ binding antibodies or fragments, and such administrations may be performed at the same point or different points in time, such as for example the same or different days.
  • Administration of the other active agents may be according to standard medical practices known in the art (e.g., current standard of care), or the administration may be modified (e.g., longer intervals, smaller dosages, delayed initiation) when used in conjunction with administration of IL-1 ⁇ binding antibodies or fragments, such as disclosed herein.
  • the active agents set forth below are exemplary and not intended to be limiting. combinations can also include more than one additional agent, e.g., two or three additional agents.
  • Anti-IL-1 ⁇ antibodies or fragments thereof administered to a subject in as disclosed herein may be administered in combination with treatment with at least one additional active agent, such as for example any of the active agents provided herein.
  • treatment with the at least one active agent is maintained.
  • treatment with the at least one active agent is reduced or discontinued (e.g., when the subject is stable), while treatment with the anti-IL-1 ⁇ antibody or fragment is maintained at a constant dosing regimen.
  • treatment with the at least one active agent is reduced or discontinued (e.g., when the subject is stable), and treatment with the anti-IL-1 ⁇ antibody or fragment is reduced (e.g., lower dose, less frequent dosing, shorter treatment regimen).
  • treatment with the at least one active agent is reduced or discontinued (e.g., when the subject is stable), and treatment with the anti-IL-1 ⁇ antibody or fragment is increased (e.g., higher dose, more frequent dosing, longer treatment regimen).
  • treatment with the at least one active agent is maintained and treatment with the anti-IL-1 ⁇ antibody or fragment is reduced or discontinued (e.g., lower dose, less frequent dosing, shorter treatment regimen).
  • treatment with the at least one active agent and treatment with the anti-IL-1 ⁇ antibody or fragment are reduced or discontinued (e.g., lower dose, less frequent dosing, shorter treatment regimen).
  • any of the methods described above may further comprise administering at least one other pharmaceutical composition comprising an active agent other than an anti-IL-1 ⁇ binding antibody or binding fragment thereof.
  • the active agent of said at least one other pharmaceutical composition is a cholesterol lowering agent.
  • the active agent of said at least one other pharmaceutical composition is a statin or an HMG-CoA reductase inhibitor (e.g., lovastatin, pravastatin, simvastatin, fluvastatin, atorvastatin, cerivastatin, mevastatin, pitavastatin, rosuvastatin or mixtures thereof or mixtures with Ezetimibe, niacin, Amlodipine Besylate).
  • the active agent of said at least one other pharmaceutical composition is a calcium channel blocker (e.g., amlodipine, diltiazem, nifedipine, nicardipine, verapamil) or a beta blocker (e.g., esmolol, metoprolol, nadolol, penbutolol).
  • a calcium channel blocker e.g., amlodipine, diltiazem, nifedipine, nicardipine, verapamil
  • beta blocker e.g., esmolol, metoprolol, nadolol, penbutolol
  • the active agent of said at least one other pharmaceutical composition is an antihypertensive (e.g., labetalol, metoprolol, hydralazine, nitroglycerin, nicardipine, sodium nitroprusside, clevidipine), a diuretic (e.g., a thiazide diuretic, chlorthalidone, furosemide, hydrochlorothiazide, indapamide, metolazone, amiloride hydrochloride, spironolactone, triamterene) or aspirin.
  • the active agent of said at least one other pharmaceutical composition is an angiotensin-converting enzyme (ACE) inhibitor (e.g.
  • ACE angiotensin-converting enzyme
  • the active agent of said at least one other pharmaceutical composition is a vasodilator.
  • the active agent of said at least one other pharmaceutical composition is an anticoagulant (e.g., acenocoumarol, phenprocoumon, warfarin heparin, low molecular weight heparin) or inhibitor of platelet aggregation (e.g., clopidogrel, ticlopidine, cilostazol, dipyridamole, eptifibatide, aspirin, abciximab, eptifibatide, tirofiban).
  • an anticoagulant e.g., acenocoumarol, phenprocoumon, warfarin heparin, low molecular weight heparin
  • inhibitor of platelet aggregation e.g., clopidogrel, ticlopidine, cilostazol, dipyridamole, eptifibatide, aspirin, abciximab, eptifibatide, tirofiban.
  • the active agent of said at least one other pharmaceutical composition is a thrombolytic (e.g., streptokinase, urokinase,reteplase, tenecteplase).
  • the active agent of said at least one other pharmaceutical composition is digitalis.
  • the active agent of said at least one other pharmaceutical composition is digoxin or nesiritide.
  • the active agent of said at least one other pharmaceutical composition is oxygen.
  • the active agent of said at least one other pharmaceutical composition is a thrombin inhibitor (e.g., hirudin, bivalirudin).
  • the active agent of said at least one other pharmaceutical composition is a nitrate (e.g., glyceryl trinitrate (GTN)/nitroglycerin, isosorbide dinitrate, isosorbide mononitrate).
  • the active agent of said at least one other pharmaceutical composition is an analgesic (e.g., morphine sulfate).
  • the active agent of said at least one other pharmaceutical composition is a renin inhibitor.
  • the active agent of said at least one other pharmaceutical composition is an endothelin A receptor inhibitor.
  • the active agent of said at least one other pharmaceutical composition is an aldosterone inhibitor.
  • the use of the IL-1 ⁇ antibodies or binding fragments is contemplated in the manufacture of a medicament for treating or preventing a disease or condition as disclosed herein (e.g., for the reduction, prevention or treatment of cardiovascular events and/or cardiovascular diseases).
  • the medicament can be coordinated with treatment using a second active agent.
  • an article of manufacture comprising a container, a composition within the container comprising an anti-IL-1 ⁇ antibody or fragment thereof, and a package insert containing instructions to administer the antibody or fragment to a subject (e.g., human) as disclosed herein (e.g., for the reduction, prevention or treatment of cardiovascular events and/or cardiovascular diseases).
  • a subject e.g., human
  • the container further comprises a pharmaceutically suitable carrier, excipient or diluent.
  • the composition within the container further comprises a second active agent.
  • kits are also contemplated by the disclosure.
  • a kit comprises a therapeutically or prophylactically effective amount of an anti-IL-1 ⁇ antibody or fragment thereof, packaged in a container, such as a vial or bottle, and further comprising a label attached to or packaged with the container, the label describing the contents of the container and providing indications and/or instructions regarding use of the contents of the container as disclosed herein (e.g., for the reduction, prevention or treatment of cardiovascular events and/or cardiovascular diseases).
  • the container further comprises a pharmaceutically suitable carrier, excipient or diluent.
  • the container further contains a second active agent.
  • the article of manufacture, kit or medicament is for the treatment or prevention of a disease or condition in a subject (e.g., human) as disclosed herein (e.g., for the reduction, prevention or treatment of cardiovascular events and/or cardiovascular diseases).
  • the instructions of a package insert of an article of manufacture or label of a kit comprise instructions for administration of the antibody or fragment according to any of the aforementioned dose amounts and/or dosing regiments.
  • the container of kit or article of manufacture is a pre-filled syringe.
  • IL-1 ⁇ binding antibodies or binding fragments thereof may be administered to a subject for the aforementioned uses.
  • an IL-1 ⁇ antibody designated AB7 (described above) was administered to human subjects to evaluate safety, pharmacokinetics, and in vivo biological activity.
  • a double-blind, placebo controlled clinical study was performed in human subjects with Type 2 diabetes. Groups of subjects were given the antibody by either the intravenous (IV) or subcutaneous (SC) route, and either as a single doses or as multiple doses over a period of time.
  • treatment groups and numbers of subjects are shown in the following table for single and multiple (3 times, biweekly) doses by the SC route of administration.
  • study groups also may be included to evaluate, for example, the administration of additional numbers of subsequent doses at the same or longer intervals (e.g., monthly interval), alternative dose amounts, and/or increased group sizes.
  • Samples are obtained for pharmacokinetic analysis at days 0, 1, 2, 3, 4, 7, 9 ⁇ 1, 11 ⁇ 1, 14 ⁇ 1, 21 ⁇ 2, 28 ⁇ 2, 42 ⁇ 3, and 56 ⁇ 3.
  • Interim analysis of pharmacokinetic data following IV administration of a single dose of antibody at the 0.01, 0.03, 0.1, 0.3, or 1.0 mg/kg dose levels showed serum concentration-time profiles with a terminal half-life of 22 days, clearance of 2.54 mL/day/kg and volume of distribution of the central compartment of 41.3 mL/kg, very similar to serum volume ( FIG. 1 ).
  • samples were analyzed for the single dose SC administration groups.
  • administration of the antibody at 0.03, 0.1 and 0.3 mg/kg dose levels yielded profiles with a terminal half-life of 22.7 days, clearance of 2.4 mL/day/kg and volume distribution of the central compartment of 40.7 mL/kg.
  • C-reactive protein also was measured in serum at the same time points as the PK samples.
  • the median percent reductions in usCRP were 33, 46, 47, 36, and 26 for the 0.01, 0.03, 0.1, 0.3, and 1.0 mg/kg dose groups, respectively, compared to 4 percent for placebo.
  • a rodent model of acute myocardial infarction may be used (see for example, Wang et al., 2006, Tex. Heart Inst. J. 33:290-293; Salloum et al., 2009, Cardiovasc. Drugs Ther. 23:129-135). Improvements in measurements of heart function, such as for example in the MI model, are related to the chance of a subsequent cardiovascular event (e.g., congestive heart failure). Outbred mice (e.g., Institute of Cancer Research mice) and/or rats (e.g., Wistar rats) are used in the rodent MI model. Prior to surgery, the animals are evaluated by transthoracic echocardiography (TTE), for example, using a Vevo770 imaging system (VisualSonics, Toronto, Canada) or Acuson C256, to obtain measurements for the following parameters:
  • TTE transthoracic echocardiography
  • the treatment antibody or placebo e.g., control antibody
  • Systolic B P also may be measured in conscious awake awake, for example, using a noninvasive computerized tail-cuff system (BP-2000, Visitech Systems), which has been found to correlate closely with direct intraarterial measurement of BP. Animals are sacrificed, blood collected for serum, and the infarct area (size) determined. After removal, the heart is subjected to staining with Evans blue dye or 0.5% nitroblue tetrazolium (NBT), rinsed with saline and photographed to determine infarct size.
  • BP-2000 noninvasive computerized tail-cuff system
  • tissue is then fixed in 4% paraformaldehyde, embedded in paraffin and sectioned for staining with hematoxylin and eosin for histologic evaluation of tissue damage.
  • tissue is fixed and sectioned to quantitate the level of cardiomyocyte cell death (e.g., TUNEL to determine apoptosis).
  • studies to evaluate the effect of an IL-1 ⁇ antibody or fragment on heart function and/or adverse cardiac remodeling may be performed in adult male out-bred ICR mice (e.g., Harlan Laboratories (Indianapolis, Ind.)).
  • CD-1 mice underwent experimental myocardial infarction as previously described (Abbate et al., 2008, Circulation 117:2670-2683). Mice were anesthetized with pentobarbital (70 mg/kg, IP), intubated orotracheally, and ventilated on a positive-pressure ventilator.
  • mice underwent transthoracic echocardiography before surgery and at 7, 14 and 28 days after coronary ligation.
  • Doppler echocardiography was performed with the Vevo770 imaging system (VisualSonics Inc, Toronto, Ontario, Canada) and a 30-MHz probe.
  • the heart was first imaged in the 2-dimensional mode in the parasternal and apical views and measurements were performed according to the to the American Society of Echocardiography recommendations (Gardin et al., 2002, J Am Soc Echocardiography 15:275-290).
  • LVEDD left ventricular
  • LVESD left ventricular
  • AWDT anterior wall diastolic thickness
  • AWST anterior wall systolic thickness
  • PWDT posterior wall diastolic thickness
  • PWST posterior wall systolic thickness
  • An apical view was used to measure the ejection time (ET), the time interval between the end of the transmitral A wave and the following E wave (AE).
  • MPI [AE ⁇ ET]/ET).
  • the tricuspidal annular plane systolic excursion was also measured as a marker of right ventricular function.
  • the investigator performing and reading the echocardiogram was blinded to the treatment allocation.
  • the SPSS 11.0 (Chicago, Ill.) was used for the statistical analysis, using ANOVA for multiple comparisons with post-hoc T-test to explore between group differences. For comparisons of interval changes between multiple groups, random effects ANOVA for repeated-measures was used to determine the main effect of time, group, and time-by-group interaction. Statistical differences were considered significant if the P value was ⁇ 0.05.
  • the TAPSE a marker of right ventricular function and a surrogate marker for AMI related mortality
  • blockade of IL-1 ⁇ using the antibody ameliorates cardiac enlargement and dysfunction following AMI in the mouse, independent of infarct size.
  • Pretreatment with an additional dose of the XMA052 MG1K antibody 48 hours prior to surgery offered no advantage over treatment after surgery in this animal model (data not shown).
  • Rodent models of stoke may be used to evaluate the effect of an IL-1 ⁇ antibody or binding fragment thereof.
  • adult male Fischer rats are used (see for example, Morales et al., 2008, Circulation 118:1450-1459).
  • C57BL/6 mice are used (see for example, Royl et al., 2009, Brain Res. 1265:148-157).
  • Permanent focal cerebral ischemia is induced by occlusion of the middle cerebral artery (MCAO), such as by cauterization or monofilament occlusion. Rats/mice in which the MCA was exposed but not occluded serve as sham-operated controls.
  • MCAO middle cerebral artery
  • Control animal groups and MCAO groups then receive the treatment antibody or placebo (e.g., control antibody) administered intraperitoneally or intravenously at one or more pre-determined times following the procedure. For example, in one group the antibody is administered immediately following the procedure and in another group, the antibody is administered 24 hours later.
  • treatment antibody or placebo e.g., control antibody
  • Animals are evaluated for survival and body weight changes, as well as functional recovery (e.g., sensorimotor, behavioral testing, such as pole test, wire hanging test and/or neurological deficit score) and measurement of brain lesion size using MRI during the in-life stage (e.g., T2-weighted MRI), followed by histological examination (e.g., HE staining and GFAP staining of coronal brain cryostat sections) post-sacrifice (e.g., at 4 weeks). Additionally, a computer-assisted hemisphere volumetry may be performed, based on T2-weighted MRI and HE-stained coronal brain cryostat sections. Additional test groups may be evaluated to determine the effect on acute reperfusion after MCAO by measuring hemispheric cerebral blood flow with MRI (e.g., FAIR MRI).
  • MRI e.g., FAIR MRI
  • an animal model of limb ischemia may be used (see for example, Park et al., Endocrinology 149:483-491, 2008).
  • limb ischemia is induced in C57BL/6 male mice by the ligation of one femoral artery in anesthetized animals. Mice in which the artery is exposed but not ligated serve as sham-operated controls.
  • Control animal groups and artery ligation groups then receive the treatment antibody or placebo (e.g., control antibody) administered intraperitoneally or intravenously at one or more pre-determined times following the procedure. For example, in one group the antibody is administered immediately following the procedure and in another group, the antibody is administered 24 hours later.
  • treatment antibody or placebo e.g., control antibody
  • LDPI laser Doppler perfusion image
  • ischemic lower legs are embedded in OCT compound and frozen for cryostat sectioning.
  • Tissue sections are stained with rat anti-mouse platelet EC adhesion molecule-1 (PECAM-1) (PharMingen), mouse anti- ⁇ smooth muscle actin (SMA) (Sigma), and rat anti-mouse CD45 (PharMingen), rabbit anti-cGKI (Calbiochem).
  • PECAM-1 endothelial marker
  • SMA smooth muscle actin
  • rat anti-mouse CD45 rabbit anti-cGKI
  • THP-1 cells were pre-activated to a macrophage-like phenotype with 200 nM PMA for 12 hours, washed once and added to pre-plated human umbilical vein endothelial cells (HUVEC) or human coronary artery smooth muscle cells (CASMC) at a ratio of (10:1; 10 6 THP-1 and 10 5 HUVEC or CASMC) in the presence or absence of XOMA 052, as indicated.
  • HUVEC human umbilical vein endothelial cells
  • CASMC human coronary artery smooth muscle cells
  • XOMA 052 inhibits the release of IL-1 ⁇ -induced pro-inflammatory molecules, such as IL-6, IL-8, MCP-1 and PAI-1 from endothelial cells (p ⁇ 0.05, FIG. 6 , left panel).
  • XOMA 052 inhibits the release of IL-6 and IL-8 from smooth muscle cells, as well as IL-1 ⁇ -driven MMP-3 and MMP-9 (p ⁇ 0.05, FIG. 7 , left panel). Importantly, it was also observed that XOMA 052 potently reduces the induction of these factors in the context of macrophage/EC or macrophage/SMC co-culture systems (p ⁇ 0.05, FIGS. 6 & 7 , right panel).
  • the ApoE knockout mouse is a well validated model of atherosclerosis that follows a similar pattern of progression to that of human.
  • Male ApoE ⁇ / ⁇ mice on a C57BL/6 background were fed an atherogenic diet for 16 weeks beginning at 6 weeks and treated with an IL-1 ⁇ antibody, XMA052 MG1K (i.p., twice weekly as indicated), control mouse IgG (i.p., twice weekly, 1.0 mg/kg; Jackson ImmunoResearch), or quinapril (subQ, 10 mg/kg, daily) for the duration of the study.
  • En face analysis was carried out using Sudan IV staining as described previously (Calkin et al., 2007, Atherosclerosis 195:17-22) and as follows.
  • Aortas were divided into arch, thoracic and abdominal aorta then cut longitudinally. After pinning en face onto wax, aortas were photographed and analyzed. Total and segmental plaque area was quantified as percentage area visualized red as stained by Sudan IV. Aortas were subsequently embedded in paraffin and sections cut for cross-sectional analysis.XMA052 MG1K inhibited the formation of atherosclerotic lesions in ApoE knockout mice by 22-37% across the three doses tested (p ⁇ 0.05, FIG. 8 , 9 ).
  • plaque progression and in vivo coronary artery function is assessed using noninvasive high-resolution ultrasound techniques (see for example, Gronros et al., Am J Physiol Heart Circ Physiol. 295:H2046-53, 2008).
  • Eight-week-old male ApoE mice are fed a high-fat diet with or without antibody treatment for approximately 16 weeks.
  • total cholesterol levels are measured, as well as the degree of retardation of lesion progression in the brachiocephalic artery, as visualized in vivo using an ultrasound biomicroscope. Histological analysis is also used to determine the reduction of brachiocephalic atherosclerosis.
  • Coronary artery function also may be measured by volumetric flow, such as for example by simultaneous recording of Doppler velocity signals and left coronary artery morphology before and during adenosine infusion.
  • the aortic sinus and/or brachiocephalic artery is sectioned and assessed for lesion cross-sectional area and content (Zhou et al., 2008, Eur. J. Pharmacol. 590:297-302; Calkin et al., 2007, Atherosclerosis 195:17-22; Kieri et al., 2003, Arterioscler. Thromb. Vasc. Biol. 23:656-660).
  • Serial 3 ⁇ m paraffin sections are dewaxed and rehydrated. Endogenous peroxidase activity is inhibited by incubation with 3% hydrogen peroxide.
  • sections are incubated overnight at 4° C. with antibodies against ⁇ -smooth muscle actin, inflammatory markers, such as IL-6, IL-8, MCP-1, ICAM-1 and VCAM-1, degradative enzymes, such as AMP-3, MMP-9 and cathepsin S or thrombotic factors, such as tissue factor or PAI-1. Sections are then incubated with the appropriate secondary antibodies. Positive areas are counted and expressed as a percentage of the whole plaque area. A negative control, in which the primary antibody is replaced with either mouse or rat IgG at the same dilution, is included.
  • Sections are also evaluated for lipid content by staining with the lipophilic dye Oil Red 0 and macrophage infiltration is quantified by immunohistochemistry by staining with antibodies against CD68 (Kieri et al., 2003, Arterioscler. Thromb. Vasc. Biol. 23:656-660). Blinded analysis of positive immunostained sections is performed with an image-analysis program (Image Pro Plus, Media Cybernetics).
  • markers of inflammation and matrix degradation are interrogated by quantitative gene expression analysis (Calkin et al., 2007, Atherosclerosis 195:17-22).
  • RNA is extracted from whole aorta by homogenization using Trizol and DNAse treated.
  • Quantitative real time RT-PCR is carried out using the Taqman system on an ABI Prism 7700 Sequence Detector.
  • Gene expression of the aforementioned genes are normalized to 18S mRNA and reported as ratios compared to the level of expression in untreated control mice. For statistical purposes, non-parametric data are handled as their log derivative. Differences in expression are compared using Student's t-tests (two groups) or one-way ANOVA (three or more groups).
  • IL-1 ⁇ antibody The influence of IL-1 ⁇ antibody on the aforementioned markers of inflammation, degradation and thrombosis are also assessed in the serum of antibody-treated ApoE knockout mice by ELISA or using the Mesoscale Discovery (MSD) platform. Serum obtained by cardiac puncture at the time of sacrifice is analyzed for serum lipids as described (Warnick, 1986, Methods Enzymol. 129:101-23). All lipid assays are performed in triplicate determinations. An external control sample with known analyte concentration is run for each assay to assure accuracy. Free plasma glycerol concentrations is also determined and used to correct the triglyceride values.
  • MSD Mesoscale Discovery
  • sections of 5 ⁇ m thickness are selected and quantified. Sections are serially cut every 50 ⁇ m from the cardiac base cross-section until the ascending aorta appears. Approximately six serial 5- ⁇ m sections per mouse are used for morphometric and immunohistochemical analysis. Collagen and foam cells in plaques are stained with a modified Movat pentachrome stain. Stained sections are inspected for buried fibrous caps within the plaque, which are also counted. Morphometry is performed with a computerized image-analysis program (Image Pro Plus, Media Cybernetics). Plaque composition, including extracellular lipids, foam cells and collagen is determined as a percentage of plaque area.
  • the plaque area is measured directly and subtracted from the area enclosed by the internal elastic lamina to derive the patent lumen area corrected by dividing internal elastic lamina surrounding area.
  • the effect of IL-1 ⁇ antibody on plaque stability is evaluated by calculating the vulnerability index ((foam cells+extracellular lipids)/(collagens+smooth muscle cells)) and the average number of buried fibrous caps.
  • Systolic and diastolic blood pressure are measured using a tail-cuff system and mean blood pressure calculated (Chamberlain et al., 2009, PLoS ONE 4(4): e5073). To ensure stress levels of mice are kept to a minimum, a single handler is used throughout the experiment and mice are subjected to one week of training (blood pressure and pulse readings are taken, but the data discarded) prior to starting analysis. Measurements are taken at the same time, daily to avoid normal daily variance in blood pressure. In addition, the blood pressure is taken on the same part of the tail every day. During analysis, 10 measurements are taken each day, and mean blood pressure and standard deviation calculated for each ‘data day’ and week (total of 50 readings per mouse per week, 10 per day).
  • blood pressure is determined under control (chow fed) and treated (diet-fed) conditions, for different mouse genotypes, and global non-linear regression determines whether the difference between each blood pressure curve is convincing.
  • the test does not compare individual time points, but instead treats the data globally to produce a single p value per comparison.
  • the antibody is administered 24 or 48 hours preceding cuff placement.
  • the antibody is administered at the time of cuff placement.
  • mice are perfused through the left cardiac ventricle with isotonic saline and 4% paraformaldehyde in 0.01 M phosphate buffer (pH 7.4) under physiological pressure.
  • Carotid arteries are collected and processed for histological analysis.
  • Cross-cryosections (6 ⁇ m) are prepared from the intracuff region of each carotid artery and stained with hematoxylin and eosin (H&E), and picrosirius red for collagen. The corresponding sections on separate slides are used for immunohistochemical staining with antibodies against neutrophils.
  • the proportions of intraplaque hemorrhage and disruption in the neointima accompanying the intramural thrombus are compared between the antibody and control groups. Histological classification of the plaque disruption at the intracuff region of the carotid artery is done by dividing the lesions into three groups, based on the analyses of 30 sections at 60 ⁇ m intervals in each sample tissue. When there are no cracks and no mural or occlusive thrombus at the intracuff region, classification is “no disruption”. When intraplaque hemorrhage, or mural or occlusive thrombus with cracks or erosion in the plaques are detected, classified is “hemorrhage” or “disruption”, respectively.
  • Neutrophil infiltration in the neointima and collagen content is also determined. Collagen content is evaluated by the picrosirius red-stained positive area which appears bright when viewed with polarized light. Neutrophil infiltration in the intima is assessed by the neutrophils positive area which was stained by anti-neutrophil antibody (1:50; Serotec, MCA771GA).
  • an IL-1 ⁇ antibody or binding fragment thereof is evaluated in an at risk population, measuring reduction of (e.g., preventing) a primary outcome that includes a composite of death from cardiovascular causes, myocardial infarction, or stroke, as well as each outcome separately.
  • Measurements of reduction of (e.g., preventing) a secondary outcome may include death from any cause, the need for a revascularization procedure, heart failure, angina (e.g., hospitalization for angina, unstable angina), congestive heart failure, and acute coronary syndrome.
  • IL-1 ⁇ antibody treatment dose groups e.g., 0.3 mg/kg, 0.1 mg/kg
  • Antibody and placebo treatments are administered in conjunction with standard of care.
  • Men and women of at least 55 years in age are included in the study if they have a history of coronary artery disease (e.g., manifest coronary artery disease), peripheral vascular disease, Type 2 diabetes, elevated total cholesterol, hypertension, low HDL cholesterol levels, tobacco smoking, atherosclerosis and/or microalbuminuria.
  • Subjects are excluded if they are known to have experienced a recent (e.g., within 6 months of enrollment) cardiovascular event. Group sizes include sufficient numbers of subjects to detect a reduction in the relative risk of a cardiovascular event during the period of the study. All subjects provide written informed consent.
  • Subjects are administered the IL-1 ⁇ antibody or placebo at monthly intervals and outcomes monitored throughout the study period (e.g., 3 year study period). Outcomes are determined by standard clinical diagnoses accepted by the medical field. Results indicative of an effect from the IL-1 ⁇ antibody include a reduction in the relative risk of a cardiovascular event outcome (e.g., 20 percent reduction in relative risk).
  • an IL-1 ⁇ antibody or binding fragment thereof is evaluated in subjects in the period after the occurrence of a first documented cardiovascular event of myocardial infarction or acute coronary syndrome.
  • the study measures reduction of (e.g., preventing) a primary cardiovascular event outcome that includes a composite of death from cardiovascular causes, myocardial infarction, or stroke, as well as each outcome separately.
  • Measurements for reduction of (e.g., preventing) a secondary outcome may include death from any cause, the need for a revascularization procedure, heart failure, angina (e.g., hospitalization for angina, unstable angina), congestive heart failure, and acute coronary syndrome.
  • angina e.g., hospitalization for angina, unstable angina
  • congestive heart failure e.g., congestive heart failure
  • acute coronary syndrome e.g., acute coronary syndrome.
  • subjects are randomly enrolled into one of two dose groups (e.g., 0.3 mg/kg, 0.1 mg/kg) for an IL-1 ⁇ antibody, or a matching placebo group.
  • Men and women are enrolled in the study following a recent occurrence of a first cardiovascular event (e.g., within 96 hours), as described above.
  • Group sizes include sufficient numbers of subjects to detect a reduction in the relative risk of a subsequent cardiovascular event during the period of the study. All subjects provide written informed consent.
  • Subjects are administered the IL-1 ⁇ antibody or placebo at monthly intervals and outcomes monitored throughout the study period (e.g., 3 year study period). Outcomes are determined by standard clinical diagnoses accepted by the medical field. Results indicative of an effect from the IL-1 ⁇ antibody include a reduction in the relative risk of a second cardiovascular event outcome (e.g., 20 percent reduction in relative risk).

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Veterinary Medicine (AREA)
  • Cardiology (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Immunology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Heart & Thoracic Surgery (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Genetics & Genomics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Hospice & Palliative Care (AREA)
  • Vascular Medicine (AREA)
  • Urology & Nephrology (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Epidemiology (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Peptides Or Proteins (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Medicines Containing Plant Substances (AREA)
  • Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
US12/790,738 2009-05-29 2010-05-28 Cardiovascular related uses of il-1beta antibodies and binding fragments thereof Abandoned US20100316651A1 (en)

Priority Applications (3)

Application Number Priority Date Filing Date Title
US12/790,738 US20100316651A1 (en) 2009-05-29 2010-05-28 Cardiovascular related uses of il-1beta antibodies and binding fragments thereof
US15/647,203 US10611832B2 (en) 2009-05-29 2017-07-11 Cardiovascular related uses of IL-1β antibodies and binding fragments thereof
US16/799,707 US20210009679A1 (en) 2009-05-29 2020-02-24 Cardiovascular related uses of il-1beta antibodies and binding fragments thereof

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US18267909P 2009-05-29 2009-05-29
US25257109P 2009-10-16 2009-10-16
US31300110P 2010-03-11 2010-03-11
US12/790,738 US20100316651A1 (en) 2009-05-29 2010-05-28 Cardiovascular related uses of il-1beta antibodies and binding fragments thereof

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US15/647,203 Continuation US10611832B2 (en) 2009-05-29 2017-07-11 Cardiovascular related uses of IL-1β antibodies and binding fragments thereof

Publications (1)

Publication Number Publication Date
US20100316651A1 true US20100316651A1 (en) 2010-12-16

Family

ID=43223130

Family Applications (3)

Application Number Title Priority Date Filing Date
US12/790,738 Abandoned US20100316651A1 (en) 2009-05-29 2010-05-28 Cardiovascular related uses of il-1beta antibodies and binding fragments thereof
US15/647,203 Active US10611832B2 (en) 2009-05-29 2017-07-11 Cardiovascular related uses of IL-1β antibodies and binding fragments thereof
US16/799,707 Abandoned US20210009679A1 (en) 2009-05-29 2020-02-24 Cardiovascular related uses of il-1beta antibodies and binding fragments thereof

Family Applications After (2)

Application Number Title Priority Date Filing Date
US15/647,203 Active US10611832B2 (en) 2009-05-29 2017-07-11 Cardiovascular related uses of IL-1β antibodies and binding fragments thereof
US16/799,707 Abandoned US20210009679A1 (en) 2009-05-29 2020-02-24 Cardiovascular related uses of il-1beta antibodies and binding fragments thereof

Country Status (15)

Country Link
US (3) US20100316651A1 (enExample)
EP (1) EP2435073A4 (enExample)
JP (2) JP5763625B2 (enExample)
KR (1) KR20120061041A (enExample)
CN (2) CN102573893A (enExample)
AU (1) AU2010253924B2 (enExample)
BR (1) BRPI1011228A2 (enExample)
CA (1) CA2763161A1 (enExample)
EA (1) EA201101643A1 (enExample)
HK (1) HK1245111A1 (enExample)
IL (1) IL216660A0 (enExample)
MX (1) MX2011012666A (enExample)
NZ (1) NZ597024A (enExample)
SG (3) SG176265A1 (enExample)
WO (1) WO2010138939A1 (enExample)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20140356356A1 (en) * 2011-09-30 2014-12-04 Novartis Ag Use of IL-1 beta Binding Antibodies
US11603400B2 (en) * 2012-12-19 2023-03-14 Dnae Group Holdings Limited Methods for raising antibodies

Families Citing this family (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA2832066C (en) * 2011-04-01 2023-04-18 The Medicines Company Short-acting dihydropyridines (clevidipine) for use in reducing stroke damage
PL2623604T3 (pl) * 2012-02-02 2015-07-31 Baylor College Medicine Biologiczny system dostarczania i ekspresji oparty na adenowirusie do zastosowania w leczeniu choroby zwyrodnieniowej stawów
CN103588878A (zh) * 2012-08-15 2014-02-19 江苏泰康生物医药有限公司 一种人源化抗人白细胞介素1 β单克隆抗体及其制备与应用
AU2013327501B2 (en) * 2012-10-04 2018-08-09 Xbiotech Inc. Treating vascular disease and complications thereof
AU2013344796B2 (en) * 2012-11-16 2016-11-10 Novartis Ag Use of IL-1 beta binding antibodies for treating peripheral arterial disease
CN103059136A (zh) * 2012-12-24 2013-04-24 浙江大学 抗中华鳖IL-1β多克隆抗体的制备及在检测中的应用
KR102337954B1 (ko) * 2018-08-16 2021-12-10 차의과학대학교 산학협력단 뇌졸중 치료용 조성물 및 이를 스크리닝하는 방법
AU2020267329B2 (en) * 2019-05-03 2026-03-26 University Of Zurich Treatment of brain ischemia-reperfusion injury
US20220275079A1 (en) * 2020-11-20 2022-09-01 The General Hospital Corporation Clonal Hematopoiesis and Risk of Chronic Liver Disease
GB202400340D0 (en) 2024-01-10 2024-02-21 Wotherspoon Hugh Robert IL-1B binding antibody

Citations (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20030009145A1 (en) * 2001-03-23 2003-01-09 Struijker-Boudier Harry A.J. Delivery of drugs from sustained release devices implanted in myocardial tissue or in the pericardial space
US20040106954A1 (en) * 2002-11-15 2004-06-03 Whitehurst Todd K. Treatment of congestive heart failure
US20060047538A1 (en) * 2004-08-25 2006-03-02 Joseph Condurso System and method for dynamically adjusting patient therapy
JP2007002261A (ja) * 2006-09-01 2007-01-11 Japan Polypropylene Corp ビニル基および極性基含有プロピレン系共重合体及びそれを用いる重合体の製造方法。
US20070065439A1 (en) * 2005-01-26 2007-03-22 Larry Green Antibodies against interleukin-1 beta
US20070196379A1 (en) * 1999-04-23 2007-08-23 Mark Marchionni Methods for treating congestive heart failure
US20080044414A1 (en) * 2005-06-21 2008-02-21 Linda Masat IL-1beta binding antibodies and fragments thereof
US20080292640A1 (en) * 2006-12-20 2008-11-27 Solinger Alan M Methods for the treatment of il-1beta related diseases

Family Cites Families (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7820383B2 (en) * 1997-03-10 2010-10-26 Interleukin Genetics, Inc. Method for diagnosing myocardial infarction
AR016551A1 (es) * 1997-07-30 2001-07-25 Smithkline Beecham Corp Derivados de 2-oxindol, composiciones farmaceuticas que los comprenden y el uso de los mismos para la manufactura de medicamentos
WO2004100987A2 (en) 2003-05-06 2004-11-25 Regeneron Pharmaceuticals, Inc. Methods of using il-1 antagonists to treat neointimal hyperplasia
US20060171948A1 (en) * 2005-02-02 2006-08-03 Weinstein Steven P Methods of using IL-1 antagonists to reduce C-reactive protein
WO2006084145A2 (en) * 2005-02-02 2006-08-10 Regeneron Pharmaceuticals, Inc. Methods of using il-1 antagonists to reduce c-reactive protein
ES2707152T3 (es) 2005-04-15 2019-04-02 Macrogenics Inc Diacuerpos covalentes y usos de los mismos
EP1940880A2 (en) 2005-10-14 2008-07-09 Novo Nordisk A/S Treating diabetes using inhibitors of il-1

Patent Citations (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20070196379A1 (en) * 1999-04-23 2007-08-23 Mark Marchionni Methods for treating congestive heart failure
US20030009145A1 (en) * 2001-03-23 2003-01-09 Struijker-Boudier Harry A.J. Delivery of drugs from sustained release devices implanted in myocardial tissue or in the pericardial space
US20040106954A1 (en) * 2002-11-15 2004-06-03 Whitehurst Todd K. Treatment of congestive heart failure
US20060047538A1 (en) * 2004-08-25 2006-03-02 Joseph Condurso System and method for dynamically adjusting patient therapy
US20070065439A1 (en) * 2005-01-26 2007-03-22 Larry Green Antibodies against interleukin-1 beta
US20080044414A1 (en) * 2005-06-21 2008-02-21 Linda Masat IL-1beta binding antibodies and fragments thereof
US7988968B2 (en) * 2005-06-21 2011-08-02 Xoma Technology Ltd. Method of treating an IL-1 related coronary condition
JP2007002261A (ja) * 2006-09-01 2007-01-11 Japan Polypropylene Corp ビニル基および極性基含有プロピレン系共重合体及びそれを用いる重合体の製造方法。
US20080292640A1 (en) * 2006-12-20 2008-11-27 Solinger Alan M Methods for the treatment of il-1beta related diseases

Non-Patent Citations (5)

* Cited by examiner, † Cited by third party
Title
Calabro et al, Journal of the American College of Cardiology, 2005, Vol. 46, No. 6, pages 1112-1113. *
D'Ettorre et al, European Cytokine Network, Vol. 8, No. 2, page 161-171. *
Grundy et al. J Am Coll Cardiol 34: 1348-1359, 1999. *
Jaap W. Deckers, International Journal of Cardiology, Vol.167, 2013, pages 2387-2390. *
Simon et al, Journal of Thrombosis and Thrombolysis, 2000, Vol.9, pages 217-222. *

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20140356356A1 (en) * 2011-09-30 2014-12-04 Novartis Ag Use of IL-1 beta Binding Antibodies
US9683038B2 (en) * 2011-09-30 2017-06-20 Novartis Ag Methods of reducing the risk of experiencing a cardiovascular (CV) event or a cerebrovascular event in a patient that has suffered a qualifying CV event
US20170275358A1 (en) * 2011-09-30 2017-09-28 Novartis Ag Use of IL-1ß Binding Antibodies
US10975145B2 (en) * 2011-09-30 2021-04-13 Novartis Ag Methods of reducing the risk of experiencing a cardiovascular (CV) event or a cerebrovascular event in a patient that has suffered a qualifying CV event
US11603400B2 (en) * 2012-12-19 2023-03-14 Dnae Group Holdings Limited Methods for raising antibodies

Also Published As

Publication number Publication date
IL216660A0 (en) 2012-02-29
CA2763161A1 (en) 2010-12-02
BRPI1011228A2 (pt) 2019-09-24
JP5763625B2 (ja) 2015-08-12
NZ597024A (en) 2014-01-31
MX2011012666A (es) 2011-12-16
JP2012528796A (ja) 2012-11-15
US20210009679A1 (en) 2021-01-14
EP2435073A1 (en) 2012-04-04
HK1245111A1 (zh) 2018-08-24
AU2010253924A1 (en) 2012-01-19
KR20120061041A (ko) 2012-06-12
US20180155420A1 (en) 2018-06-07
AU2010253924B2 (en) 2015-01-22
SG2014014534A (en) 2014-07-30
CN107243077A (zh) 2017-10-13
US10611832B2 (en) 2020-04-07
WO2010138939A1 (en) 2010-12-02
EA201101643A1 (ru) 2012-12-28
EP2435073A4 (en) 2013-03-27
SG10201500180RA (en) 2015-03-30
SG176265A1 (en) 2012-01-30
JP2015120704A (ja) 2015-07-02
CN102573893A (zh) 2012-07-11

Similar Documents

Publication Publication Date Title
US10611832B2 (en) Cardiovascular related uses of IL-1β antibodies and binding fragments thereof
US20210032326A1 (en) Methods for the treatment of gout
EP2293816B1 (en) Methods for the treatment of rheumatoid arthritis
US8551487B2 (en) Methods for the treatment of IL-1β related conditions
CA2873914A1 (en) Il-1.beta. binding antibodies and fragments thereof
AU2013203560A1 (en) Cardiovascular related uses of IL-1beta antibodies and binding fragments thereof
AU2015203141A1 (en) Methods for the treatment of gout

Legal Events

Date Code Title Description
AS Assignment

Owner name: XOMA TECHNOLOGY LTD., CALIFORNIA

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:SCANNON, PATRICK J.;SOLINGER, ALAN M.;FELDSTEIN, JEFFREY D.;SIGNING DATES FROM 20100629 TO 20100707;REEL/FRAME:024660/0167

AS Assignment

Owner name: XOMA (US) LLC, CALIFORNIA

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:XOMA TECHNOLOGY LTD.;REEL/FRAME:032023/0011

Effective date: 20130822

STCB Information on status: application discontinuation

Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION

AS Assignment

Owner name: SILICON VALLEY BANK, CALIFORNIA

Free format text: SECURITY INTEREST;ASSIGNOR:XOMA TECHNOLOGY LTD.;REEL/FRAME:046115/0459

Effective date: 20180507

Owner name: SILICON VALLEY BANK, CALIFORNIA

Free format text: SECURITY INTEREST;ASSIGNOR:XOMA (US) LLC;REEL/FRAME:046115/0408

Effective date: 20180507

AS Assignment

Owner name: XOMA (US) LLC, CALIFORNIA

Free format text: PARTIAL RELEASE OF SECURITY INTEREST;ASSIGNOR:SILICON VALLEY BANK;REEL/FRAME:070706/0614

Effective date: 20250224

AS Assignment

Owner name: XOMA TECHNOLOGY LTD., CALIFORNIA

Free format text: RELEASE OF SECURITY INTEREST;ASSIGNOR:SILICON VALLEY BANK;REEL/FRAME:073790/0484

Effective date: 20251219