US20030191056A1 - Use of transthyretin peptide/protein fusions to increase the serum half-life of pharmacologically active peptides/proteins - Google Patents

Use of transthyretin peptide/protein fusions to increase the serum half-life of pharmacologically active peptides/proteins Download PDF

Info

Publication number
US20030191056A1
US20030191056A1 US10/117,109 US11710902A US2003191056A1 US 20030191056 A1 US20030191056 A1 US 20030191056A1 US 11710902 A US11710902 A US 11710902A US 2003191056 A1 US2003191056 A1 US 2003191056A1
Authority
US
United States
Prior art keywords
ttr
biologically active
active agent
peg
tmp
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Abandoned
Application number
US10/117,109
Inventor
Kenneth Walker
Fei Xiong
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Amgen Inc
Original Assignee
Amgen Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Amgen Inc filed Critical Amgen Inc
Priority to US10/117,109 priority Critical patent/US20030191056A1/en
Assigned to AMGEN INC. reassignment AMGEN INC. ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: WALKER, KENNETH, XIONG, FEI
Priority to EP03721538A priority patent/EP1496926B1/en
Priority to PCT/US2003/010443 priority patent/WO2003086444A1/en
Priority to JP2003583462A priority patent/JP4738743B2/en
Priority to MXPA04009680A priority patent/MXPA04009680A/en
Priority to EP10178081A priority patent/EP2298331A3/en
Priority to AU2003224844A priority patent/AU2003224844B2/en
Priority to ES03721538T priority patent/ES2400341T3/en
Priority to US10/407,078 priority patent/US20030195154A1/en
Priority to PL03372849A priority patent/PL372849A1/en
Priority to CA002480883A priority patent/CA2480883A1/en
Publication of US20030191056A1 publication Critical patent/US20030191056A1/en
Priority to US12/380,451 priority patent/US8633153B2/en
Priority to JP2010264759A priority patent/JP2011136981A/en
Priority to US14/157,325 priority patent/US20140234945A1/en
Abandoned legal-status Critical Current

Links

Images

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/04Peptides having up to 20 amino acids in a fully defined sequence; Derivatives thereof
    • A61K38/043Kallidins; Bradykinins; Related peptides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/04Peptides having up to 20 amino acids in a fully defined sequence; Derivatives thereof
    • A61K38/10Peptides having 12 to 20 amino acids
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/19Cytokines; Lymphokines; Interferons
    • A61K38/20Interleukins [IL]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/22Hormones
    • A61K38/29Parathyroid hormone, i.e. parathormone; Parathyroid hormone-related peptides
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/56Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule
    • A61K47/58Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained by reactions only involving carbon-to-carbon unsaturated bonds, e.g. poly[meth]acrylate, polyacrylamide, polystyrene, polyvinylpyrrolidone, polyvinylalcohol or polystyrene sulfonic acid resin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/56Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule
    • A61K47/59Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes
    • A61K47/60Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes the organic macromolecular compound being a polyoxyalkylene oligomer, polymer or dendrimer, e.g. PEG, PPG, PEO or polyglycerol
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/56Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule
    • A61K47/61Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule the organic macromolecular compound being a polysaccharide or a derivative thereof
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/62Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
    • A61K47/64Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
    • A61K47/643Albumins, e.g. HSA, BSA, ovalbumin or a Keyhole Limpet Hemocyanin [KHL]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/08Drugs for disorders of the metabolism for glucose homeostasis
    • A61P3/10Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P5/00Drugs for disorders of the endocrine system
    • A61P5/18Drugs for disorders of the endocrine system of the parathyroid hormones
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P7/00Drugs for disorders of the blood or the extracellular fluid
    • A61P7/04Antihaemorrhagics; Procoagulants; Haemostatic agents; Antifibrinolytic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • A61P9/12Antihypertensives
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/31Fusion polypeptide fusions, other than Fc, for prolonged plasma life, e.g. albumin

Definitions

  • Proteins, peptides and other drug molecules for therapeutic use are currently available in suitable forms in adequate quantities largely as a result of the advances in recombinant DNA technologies.
  • the availability of such peptides and proteins has engendered advances in protein formulation and chemical modification.
  • Chemical modification of biologically active peptides, proteins, oligonucleotides and other drugs for purposes of extending the serum half-life of such bioactive agents has been extensively studied. The ability to extend the serum half-life of such agents allows for the therapeutic potential of the agent to be realized without the need for high dosages and frequent administration.
  • Chemical modification used to extend the half-lives of proteins in vivo includes the chemical conjugation of a water soluble polymer, such as polyethylene glycol (PEG), to the protein of interest.
  • PEG polyethylene glycol
  • a variety of approaches have been used to attach the polyethylene glycol molecules to the protein (PEGylation).
  • Royer U.S. Pat. No. 4,002,531 states that reductive alkylation was used for attachment of polyethylene glycol molecules to an enzyme.
  • Davis et al. U.S. Pat. No. 4,179,337) disclose PEG:protein conjugates involving, for example, enzymes and insulin. Shaw (U.S. Pat. No.
  • Hakimi et al. disclose substantially non-immunogenic water soluble PEG:protein conjugates, involving for example, the proteins IL-2, interferon alpha, and IL-1ra.
  • the methods of Hakimi et al. involve the utilization of unique linkers to connect the various free amino groups in the protein to PEG.
  • Kinstler et al. (U.S. Pat. Nos. 5,824,784 and 5,985,265) teach methods allowing for selectively N-terminally chemically modified proteins and analogs thereof, including G-CSF and consensus interferon.
  • Transthyretin (formerly called prealbumin) is a 56 kDa tetrameric serum protein that plays important physiological roles as a transporter of thyroxine and retinol-binding protein; Hamilton and Benson, Cell. Mol. Life Sci., 58:1491-1521 (2001), and references cited therein.
  • TTR Transthyretin
  • Blaney et al. in U.S. Pat. No. 5,714,142, describe the exploitation of TTR by endowing the drug to be administered with functionality that allows it to bind specifically to the protein. Specifically, Blaney et al.
  • TTR or a TTR variant
  • a TTR or TTR variant which has been chemically modified via conjugation to a water soluble polymer e.g., can be used as a fusion partner with a biologically active agent to increase the serum half-life of the biologically active agent.
  • the present invention provides a means for increasing the serum half-life of a selected biologically active agent.
  • the present invention thus relates to substantially homogenous preparations of TTR (or a TTR variant)-biologically active agent fusions and PEG-TTR (PEG-TTR variant)-biologically active agent fusions.
  • TTR or a TTR variant
  • PEG-TTR PEG-TTR variant
  • the TTR-biologically active agent fusion and/or PEG-TTR-biologically active agent fusion has substantially increased serum half-life.
  • the present invention further relates to TTR-biologically active agent fusions and PEG-TTR-biologically active agent fusions, in a pharmaceutically acceptable carrier, to provide a pharmacologically active compound.
  • the present invention further relates to the preparation of TTR variants.
  • TTR proteins are modified such that cysteine residue(s) are engineered into the TTR protein sequence.
  • the TTR variants are recoverable in high yield and are then chemically modified via conjugation of a water soluble polymer at the cysteine residue to provide a chemically modified TTR variant which can then be fused to a selected biologically active agent.
  • the present invention further relates to processes for preparing pharmacologically active compounds.
  • the principal embodiment of the method for making the substantially homogenous preparation of a PEG-TTR-peptide fusion comprises: (a) engineering a cysteine residue into a specific amino acid position within the amino acid sequence of said TTR to provide a variant of said TTR; (b) conjugating a polyethylene glycol to said TTR variant at said cysteine residue to provide a PEG-TTR; (c) fusing said PEG-TTR to a peptide of interest to provide a PEG-TTR-peptide fusion; and (d) isolating said PEG-TTR-peptide fusion.
  • the present invention also relates to methods of treatment of individuals using the pharmacologically active compounds as above.
  • FIG. 1 is an SDS gel that depicts the purification of an E. coli expressed, recombinant human transthyretin (TTR) variant (C10A/G83C) with a Bradykinin peptide fused to the C-terminus of TTR.
  • Lane 1 contains Novex Mark 12 molecular weight standards, and lanes 2-7 contain the following respectively: cell lysate, post-heating supernatant, pool from Q-sepharose chromatography step, pool from phenyl sepharose chromatography step, pool from hydroxyapatite chromatography step, and pool from source Q chromatography step.
  • FIG. 2 demonstrates by size exclusion chromatography that fusion of peptides to the amino-terminus or carboxy-terminus of a TTR variant, TTR(C10A/G83C), does not alter its oligomeric structure.
  • Solid line is TTR(C10A/G83C)
  • dashed line is PTH fused to the amino-terminus of TTR(C10A/G83C)
  • the dotted line is Bradykinin fused to the carboxy-terminus of TTR(C10A/G83C).
  • FIG. 3 demonstrates by size exclusion chromatography that fusion of proteins to the amino-terminus or carboxy-terminus of a TTR variant, TTR(C10A), does not alter its oligomeric structure.
  • Solid line is TTR(C10A)
  • dashed line is IL-1-ra fused to the carboxy-terminus of TTR(C10A)
  • the dotted line is IL-1-ra fused to the amino-terminus of TTR(C10A).
  • FIG. 4 shows the binding observed using BIAcore of various TPO-mimetic peptide (TMP) constructs to human MPL receptor: ⁇ Fc-TMP, ⁇ TMP(m)-TTR, ⁇ TMP(m)-TTR-PEG5K, ⁇ TMP(m)-TTR-PEG20K.
  • TMP TPO-mimetic peptide
  • FIG. 5 shows that injection of TMP(m)-TTR-PEG5K induces platelet formation in mice.
  • the following symbols correspond to the following constructs: ⁇ Carrier, ⁇ FC-TMP, ⁇ TTR-TMP, ⁇ TMP(m)-TTR, and ⁇ TMP(m)-TTR-PEG5K.
  • FIG. 6 demonstrates by size exclusion chromatography that native TTR and TTR(C10A) maintain a similar oligomeric configuration (an apparent tetramer). Solid line is native TTR and the dashed line is TTR(C10A).
  • FIG. 7 demonstrates by size exclusion chromatography that conjugation of PEG to TTR increases its molecular size in a predictable uniform manner. Solid lines indicate no PEG conjugated, dashed lines indicate 5K PEG fused, and dotted lines indicate 20K PEG fused. The following constructs were used: A) TMP-TTR(C10A/A37C), B) TMP-TTR(C10A/D38C), C) TMP-TTR(C10A/A81C), and D) TMP-TTR(C10A/G83C).
  • FIG. 8 is an SDS gel that depicts the extent of pegylation of various TMP-TTR constructs involving TTR variants having a non-native cysteine engineered in at one of four different locations.
  • Lane 1 contains Novex Mark 12 molecular weight standards;
  • lane 2 is unpegylated TMP-TTR(C10A/A37C);
  • lanes 3-6 are 5K pegylated versions of TMP-TTR(C10A/A37C), TMP-TTR(C10A/D38C), TMP-TTR(C10A/A81C), and TMP-TTR(C10A/G83C) respectively;
  • lanes 7-10 are 20K pegylated versions of TMP-TTR(C10A/A37C), TMP-TTR(C10A/D38C), TMP-TTR(C10A/A81C), and TMP-TTR(C10A/G83C), respectively.
  • FIG. 9 compares the competitive binding of Fc-TMP and TMP-TTR to human MPL by BIAcore analysis.
  • FIG. 10 shows that injection of TMP-TTR with PEG conjugated to engineered cysteines induces platelet formation in mice.
  • TTR(C10A), ⁇ Fc-TMP 5K pegylated versions of TMP-TTR(C10A/A37C) ( ⁇ ), TMP-TTR(C10A/D38C) ( ⁇ ), TMP-TTR(C10A/A81C) ( ⁇ ), TMP-TTR(C10A/G83C) ( ).
  • biologically active agent refers to any chemical material or compound useful for prophylactic, therapeutic or diagnostic application.
  • pharmaceutically active compound refers to a compound suitable for administration to a mammalian, preferably a human individual, which induces a desired local or systemic effect.
  • peptide As used to describe biologically active agents herein are used interchangeably to refer to a naturally occurring, recombinantly produced or chemically synthesized polymer of amino acids. The terms are intended to include peptide molecules containing as few as 2 amino acids, chemically modified polypeptides, consensus molecules, analogs, derivatives or combinations thereof.
  • peptides may be used in conjunction with the present invention.
  • peptides that mimic the activity of EPO, TPO, growth hormone, G-CSF, GM-CSF, IL-1ra, leptin, CTLA4, TRAIL, TGF- ⁇ , and TGF- ⁇ .
  • the terms “-mimetic peptide” and “-agonist peptide” refer to a peptide having biological activity comparable to a protein (e.g., EPO, TPO, G-CSF) that interacts with a protein of interest. These terms further include peptides that indirectly mimic the activity of a protein of interest, such as by potentiating the effects of the natural ligand of the protein of interest.
  • EPO-mimetic peptide comprises any peptides that can be identified or derived as having EPO-mimetic subject matter; see, for example, Wrighton et al., Science, 273:458-63 (1996); and Naranda et al., Proc. Natl. Acad. Sci. USA 96:7569-74 (1999).
  • Wrighton et al. Science, 273:458-63 (1996); and Naranda et al., Proc. Natl. Acad. Sci. USA 96:7569-74 (1999).
  • TPO-mimetic peptide comprises peptides that can be identified or derived as having TPO-mimetic subject matter; see, for example, Cwirla et al., Science, 276:1696-9 (1997); U.S. Pat. Nos. 5,869,451 and 5,932,946; and PCT WO 00/24782 (Liu et al, and references cited therein), hereby incorporated by reference in its entirety. Those of ordinary skill in the art appreciate that each of these references enables one to select different peptides than actually disclosed therein by following the disclosed procedures with different peptide libraries.
  • G-CSF-mimetic peptide comprises any peptides that can be identified as having G-CSF-mimetic subject matter; see, for example, Paukovits et al., Hoppe - Seylers Z. Physiol. Chem. 365:303-11 (1984). Those of ordinary skill in the art appreciate that each of these references enables one to select different peptides than actually disclosed therein by following the disclosed procedures with different peptide libraries.
  • CTLA4-mimetic peptide comprises any peptides that can be identified or derived as described in Fukumoto et al., Nature Biotech. 16:267-70 (1998). Those of ordinary skill in the art appreciate that each of these references enables one to select different peptides than actually disclosed therein by following the disclosed procedures with different peptide libraries.
  • Peptide antagonists are also of interest, particularly those antagonistic to the activity of TNF, leptin, any of the interleukins, and proteins involved in complement activation (e.g., C3b).
  • the term “-anatgonist peptide” or “inhibitor peptide” refers to a peptide that blocks or in some way interferes with the biological activity of the associated protein of interest, or has biological activity comparable to a known antagonist or inhibitor of the associated protein of interest.
  • the term “TNF-antagonist peptide” comprises peptides that can be identified or derived as having TNF-antagonistic subject matter; see, foe example, Takasaki et al., Nature Biotech., 15:1266-70 (1997).
  • IL-1 antagonist and “IL-1ra-mimetic peptide” comprises peptides that inhibit or down-regulate activation of the IL-1 receptor by IL-1.
  • IL-1 receptor activation results from formation of a complex among IL-1, IL-1 receptor, and IL-1 receptor accessory protein.
  • IL-1 antagonist or IL-1ra-mimetic peptides bind to IL-1, IL-1 receptor, or IL-1 receptor accessory protein and obstruct complex formation among any two or three components of the complex.
  • Exemplary IL-1 antagonist or IL-1ra-mimetic peptides can be identified or derived as described in U.S. Pat. Nos. 5,608,035, 5,786,331, 5,880,096. Those of ordinary skill in the art appreciate that each of these references enables one to select different peptides than actually disclosed therein by following the disclosed procedures with different peptide libraries.
  • VEGF-antagonist peptide comprises peptides that can be identified or derived as having VEGF-antagonistic subject matter; see, for example, Fairbrother, Biochem., 37:17754-64 (1998). Those of ordinary skill in the art appreciate that each of these references enables one to select different peptides than actually disclosed therein by following the disclosed procedures with different peptide libraries.
  • MMP inhibitor peptide comprises peptides that can be identified or derived as having MMP inhibitory subject matter; see, for example, Koivunen, Nature Biotech., 17:768-74 (1999). Those of ordinary skill in the art appreciate that each of these references enables one to select different peptides than actually disclosed therein by following the disclosed procedures with different peptide libraries.
  • Targeting peptides are also of interest, including tumor-homing peptides, membrane-transporting peptides, and the like.
  • Exemplary peptides may be randomly generated by various techniques known in the art.
  • solid phase synthesis techniques are well known in the art, and include those described in Merrifield, Chem. Polypeptides, pp. 335-61 (Katsoyannis and Panayotis eds.)(1973); Merrifield, J. Am. Chem. Soc., 85:2149 (1963); Davis et al., Biochem. Intl., 10:394-414 (1985); Stewart and Young, Solid Phase Peptide Synthesis (1969); U.S. Pat. No.
  • Solid phase synthesis is the preferred technique of making individual peptides since it is the most cost-effective method of making small peptides.
  • Phage display is another useful method in generating peptides for use in the present invention. It has been stated that affinity selection from libraries of random peptides can be used to identify peptide ligands for any site of any gene product; Dedman et al., J. Biol. Chem., 268:23025-30 (1993). Phage display is particularly well suited for identifying peptides that bind to such proteins of interest as cell surface receptors or any proteins having linear epitopes; Wilson et al., Can. J. Microbiol., 44:313-29 (1998); Kay et al., Drug Disc. Today, 3:370-8 (1998). Such proteins are extensively reviewed in Herz et al., J. Receptor & Signal Transduction Res., 17(5):671-776 (1997), which is hereby incorporated by reference.
  • the peptides may also be made in transformed host cells using recombinant DNA techniques. To do so, a recombinant DNA molecule coding for the peptide is prepared. Methods of preparing such DNA and/or RNA molecules are well known in the art. For instance, sequences coding for the peptides could be excised from DNA using suitable restriction enzymes. The relevant sequences can be created using the polymerase chain reaction (PCR) with the inclusion of useful restriction sites for subsequent cloning. Alternatively, the DNA/RNA molecule could be synthesized using chemical synthesis techniques, such as the phosphoramidite method. Also, a combination of these techniques could be used.
  • Additional biologically active agents contemplated for use include recombinant or naturally occurring proteins, whether human or animal, hormones, cytokines, hematopoietic factors, growth factors, antiobesity factors, trophic factors, anti-inflammatory factors, and enzymes.
  • proteins would include but are not limited to interferons (see, U.S. Pat. Nos. 5,372,808, 5,541,293 4,897,471, and 4,695,623 hereby incorporated by reference including drawings), interleukins (see, U.S. Pat. No. 5,075,222, hereby incorporated by reference including drawings), erythropoietins (see, U.S. Pat. Nos.
  • IL-1ra interleukin-1 receptor antagonist
  • OB protein leptin
  • biologically active agents can also include but are not limited to insulin, gastrin, prolactin, adrenocorticotropic hormone (ACTH), thyroid stimulating hormone (TSH), luteinizing hormone (LH), follicle stimulating hormone (FSH), human chorionic gonadotropin (HCG), motilin, interferons (alpha, beta, gamma), interleukins (IL-1 to IL-12), tumor necrosis factor (TNF), tumor necrosis factor-binding protein (TNF-bp), brain derived neurotrophic factor (BDNF), glial derived neurotrophic factor (GDNF), neurotrophic factor 3 (NT3), fibroblast growth factors (FGF), neurotrophic growth factor (NGF), bone growth factors such as osteoprotegerin (OPG), insulin-like growth factors (IGFs), macrophage colony stimulating factor (M-CSF), granulocyte macrophage colony stimulating factor (GM-CSF), megakaryocyte derived growth factor (MGDF
  • Transthyretin contemplated for use in the present invention will have the DNA and amino acid sequences of TTR as reported in Mita et al., Biochem. Biophys. Res. Commun., 124(2):558-564 (1984). These sequences have been deposited in Genbank as accession number K02091.
  • the 127 amino acid TTR sequence used herein does not include the signal sequence (amino acids 1-20) of the K02091 sequence and is depicted below as SEQ ID NO:1.
  • TTR variant refers to a molecule or sequence that is a modified form a native TTR.
  • a native TTR comprises sites that may be removed because they provide structural features or biological activity that are not required for the fusion molecules of the present invention.
  • TR variant comprises a molecule or sequence that lacks one or more native TTR sites or residues or that has had one or more native TTR sites or residues replaced with a different amino acid or that has had one or more residues added to the sequence.
  • TTR variant wherein the Alanine residue at amino acid sequence position 37 has been replaced with a Cysteine residue
  • TTR variant A37C
  • TTR variant A37C/G83C
  • a preferred TTR or TTR variant may be chemically modified using water soluble polymers such as polyethylene glycol (PEG).
  • PEG polyethylene glycol
  • the PEG group may be of any convenient molecular weight and may be straight chain or branched.
  • the average molecular weight of the PEG will preferably range from about 2 kDa to about 100 kDa, more preferably from about 5 kDa to about 50 kDa, most preferably about 20 kDa.
  • the PEG groups will generally be attached to the compounds of the invention via acylation, reductive alkylation, Michael addition, thiol alkylation or other chemoselective conjugation/ligation methods through a reactive group on the peg moiety (e.g., an aldehyde, amino, ester, thiol, -haloacetyl, maleimido or hydrazino group) to a reactive group on the target compound (e.g., an aldehyde, amino, ester, thiol, -haloacetyl, maleimido or hydrazino group).
  • a reactive group on the peg moiety e.g., an aldehyde, amino, ester, thiol, -haloacetyl, maleimido or hydrazino group
  • a reactive group on the target compound e.g., an aldehyde, amino, ester, thiol, -haloacetyl
  • water soluble polymers used include copolymers of ethylene glycol/propylene glycol, carboxymethylcellulose, polyvinyl alcohol, polyvinyl pyrrolidone, poly-1,3-dioxolane, poly-1,3,6-trioxane, ethylene/maleic anhydride copolymer, polyaminoacids (either homopolymers or random copolymers), and dextran.
  • a DNA molecule encoding the peptide of interest, protein of interest, TTR or TTR variant can be prepared using well known recombinant DNA technology methods such as those set forth in Sambrook et al. ( Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. [1989]) and/or Ausubel et al., eds, Current Protocols in Molecular Biology, Green Publishers Inc. and Wiley and Sons, NY (1994).
  • a gene or cDNA encoding the protein of interest or fragment thereof may be obtained for example by screening a genomic or cDNA library with a suitable probe.
  • Suitable probes include, for example, oligonucleotides, cDNA fragments, or genomic DNA fragments, that are expected to have some homology to the gene encoding the protein of interest, such that the probe will hybridize with the gene encoding the protein of interest under selected hybridization conditions.
  • An alternate means of screening a DNA library is by polymerase chain reaction “PCR” amplification of the gene encoding the protein of interest. PCR is typically accomplished using oligonucleotide “primers” which have a sequence that is believed to have sufficient homology to the gene to be amplified such that at least a sufficient portion of the primer will hybridize with the gene.
  • a gene encoding the peptide of interest or protein of interest may be prepared by chemical synthesis using methods well known to the skilled artisan such as those described by Engels et al., Angew. Chem. Intl. Ed., 28:716-734 (1989). These methods include, inter alia, the phosphotriester, phosphoramidite, and H-phosphonate methods for nucleic acid synthesis. A preferred method for such chemical synthesis is polymer-supported synthesis using standard phosphoramidite chemistry.
  • the DNA encoding the protein of interest will be several hundred nucleotides in length. Nucleic acids larger than about 100 nucleotides can be synthesized as several fragments using these methods.
  • the fragments can then be ligated together to form a gene coding for the full length protein of interest.
  • the DNA fragment encoding the amino terminus of the polypeptide will have an ATG, which encodes a methionine residue.
  • This methionine may or may not be present on the mature form of the protein of interest.
  • the methionine can be removed inside the cell or during the process of secretion.
  • Preferred TTR polypeptides may include TTR with the nucleic acid sequence altered to optimize expression in E. coli and to introduce convenient restriction sites. A general discussion of codon optimization for expression in E. coli is described in Kane, Curr. Opin. Biotechnol., 6:494-500 (1995).
  • the genes encoding the protein of interest and the TTR polypeptide may be modified using standard methods to create restriction endonuclease sites at the 5′ and/or 3′ ends. Creation of the restriction sites permits the genes to be properly inserted into amplification and/or expression vectors. Addition of restriction sites is typically accomplished using PCR, where one primer of each PCR reaction typically contains, inter alia, the nucleotide sequence of the desired restriction site.
  • the gene or cDNA encoding the peptide of interest, or protein of interest can be inserted into an appropriate expression vector for expression in a host cell.
  • the vector is selected to be functional in the particular host cell employed (i.e., the vector is compatible with the host cell machinery such that amplification and/or expression of the gene encoding the protein of interest can occur).
  • the vectors used in any of the host cells will contain a promoter (also referred to as a “5′ flanking sequence”) and other regulatory elements as well such as an enhancer(s), an origin of replication element, a transcriptional termination element, a ribosome binding site element, a polylinker region for inserting the nucleic acid encoding the polypeptide to be expressed, and a selectable marker element.
  • a promoter also referred to as a “5′ flanking sequence”
  • other regulatory elements such as an enhancer(s), an origin of replication element, a transcriptional termination element, a ribosome binding site element, a polylinker region for inserting the nucleic acid encoding the polypeptide to be expressed, and a selectable marker element.
  • the vector may contain a “tag” DNA sequence, i.e., an oligonucleotide sequence located at either the 5′ or 3′ end of the fusion DNA construct.
  • the tag DNA encodes a molecule such as hexaHis, c-myc, FLAG (Invitrogen, San Diego, Calif.) or another small immunogenic sequence. When placed in the proper reading frame, this tag will be expressed along with the fusion protein, and can serve as an affinity tag for purification of the fusion protein from the host cell. Optionally, the tag can subsequently be removed from the purified fusion protein by various means such as using a selected peptidase for example.
  • the promoter may be homologous (i.e., from the same species and/or strain as the host cell), heterologous (i.e., from a species other than the host cell species or strain), hybrid (i.e., a combination of promoters from more than one source), synthetic, or it may be the native protein of interest promoter. Further, the promoter may be a constitutive or an inducible promoter. As such, the source of the promoter may be any unicellular prokaryotic or eukaryotic organism, any vertebrate or invertebrate organism, or any plant, provided that the promoter is functional in, and can be activated by, the host cell machinery.
  • the promoters useful in the vectors of this invention may be obtained by any of several methods well known in the art. Typically, promoters useful herein will have been previously identified by mapping and/or by restriction endonuclease digestion and can thus be isolated from the proper tissue source using the appropriate restriction endonucleases. In some cases, the full nucleotide sequence of the promoter may be known. Here, the promoter may be synthesized using the methods described above for nucleic acid synthesis or cloning.
  • the complete promoter may be obtained using PCR and/or by screening a genomic library with suitable oligonucleotide and/or 5′ flanking sequence fragments from the same or another species.
  • Suitable promoters for practicing this invention are inducible promoters such as the lux promoter, the lac promoter, the arabinose promoter, the trp promoter, the tac promoter, the tna promoter, synthetic lambda promoters (from bacteriophage lambda), and the T5 or T7 promoters.
  • Preferred promoters include the lux, and lac promoters.
  • the origin of replication element is typically a part of prokaryotic expression vectors whether purchased commercially or constructed by the user. In some cases, amplification of the vector to a certain copy number can be important for optimal expression of the protein or polypeptide of interest. In other cases, a constant copy number is preferred. In any case, a vector with an origin of replication that fulfills the requirements can be readily selected by the skilled artisan. If the vector of choice does not contain an origin of replication site, one may be chemically synthesized based on a known sequence, and ligated into the vector.
  • the transcription termination element is typically located 3′ of the end of the fusion protein DNA construct, and serves to terminate transcription of the RNA message coding for the fusion polypeptide.
  • the transcription termination element in prokaryotic cells is a G-C rich fragment followed by a poly T sequence. While the element is easily cloned from a library or even purchased commercially as part of a vector, it can also be readily synthesized using methods for nucleic acid synthesis such as those described above.
  • Expression vectors typically contain a gene coding for a selectable marker. This gene encodes a protein necessary for the survival and growth of a host cell grown in a selective culture medium. Typical selection marker genes encode proteins that (a) confer resistance to antibiotics or other toxins, e.g., ampicillin, tetracycline, chloramphenicol, or kanamycin for prokaryotic host cells, (b) complement auxotrophic deficiencies of the cell; or (c) supply critical nutrients not available from complex media.
  • Preferred selectable markers are the kanamycin resistance gene, the ampicillin resistance gene, the chloramphenicol resistance gene, and the tetracycline resistance gene.
  • the ribosome binding element commonly called the Shine-Dalgarno sequence in prokaryotes, is necessary for the initiation of translation of mRNA.
  • the element is typically located 3′ to the promoter and 5′ to the coding sequence of the fusion protein DNA construct.
  • the Shine-Dalgarno sequence is varied but is typically a polypurine (i.e., having a high A-G content). Many Shine-Dalgarno sequences have been identified, each of which can be readily synthesized using methods set forth above and used in a prokaryotic vector.
  • Each element may be individually ligated into the vector by cutting the vector with the appropriate restriction endonuclease(s) such that the ends of the element to be ligated in and the ends of the vector are compatible for ligation. In some cases, it may be necessary to “blunt” the ends to be ligated together in order to obtain a satisfactory ligation. Blunting can be accomplished by first filling in “sticky ends” using an enzyme such as Klenow DNA polymerase or T4 DNA polymerase in the presence of all four nucleotides. This procedure is well known in the art and is described for example in Sambrook et al., supra.
  • two or more of the elements to be inserted into the vector may first be ligated together (if they are to be positioned adjacent to each other) and then ligated into the vector.
  • Another method for constructing the vector is to conduct all ligations of the various elements simultaneously in one reaction mixture.
  • many nonsense or nonfunctional vectors may be generated due to improper ligation or insertion of the elements, however the functional vector may be identified by expression of the selectable marker.
  • Proper sequence of the ligation product can be confirmed by digestion with restriction endonucleases or by DNA sequencing.
  • the completed vector may be inserted into a suitable host cell for fusion protein expression.
  • Host cells suitable for the present invention are bacterial cells.
  • E. coli e.g., HB101, JM109, DH5 ⁇ , DH10, and MC1061
  • the choice of bacterial strain is typically made so that the strain and the expression vector to be used are compatible.
  • Various strains of B. subtilis, Pseudomonas spp., other Bacillus spp., Streptomyces spp., and the like may also be employed in practicing this invention in conjunction with appropriate expression vectors.
  • Insertion (also referred to as “transformation” or “transfection”) of the vector into the selected host cell may be accomplished using such methods as calcium phosphate precipitation or electroporation.
  • the method selected will in part be a function of the type of host cell to be used.
  • the host cells containing the vector may be cultured using one or more standard media well known to the skilled artisan.
  • the selected medium will typically contain all nutrients necessary for the growth and survival of the host cells.
  • Suitable media for culturing E. coli cells are, for example, Luria broth (“LB”), YT broth, SOB, SOC, and/or Terrific Broth (“TB”).
  • DNA construct encoding the fusion protein which comprises the TTR gene, the gene encoding the peptide or protein of interest, and, optionally, a DNA molecule encoding a linker peptide which is located between the two genes.
  • the TTR gene and gene encoding the protein of interest can be ligated together in either orientation (e.g., TTR gene at the 5′ or 3′ end of the construct).
  • a linker DNA molecule is to be included, it can first be ligated to one of the fusion partner genes, and that construct can then be ligated to the other fusion partner gene. Ligations are typically accomplished using DNA ligase enzyme in accordance with the manufacturer's instructions.
  • a separate procedure provides for first ligating one fusion partner gene into the selected vector, after which the other fusion partner gene can be ligated into the vector in a position that is either 3′ or 5′ to the first fusion partner gene.
  • the linker DNA molecule may be ligated to either fusion partner gene either before or after that gene has been ligated into the vector.
  • the TTR-TMPs of the present invention can be used to treat conditions generally known as those that involve an existing megakaryocyte/platelet deficiency or an expected megakaryocyte/platelet deficiency (e.g., because of planned surgery or platelet donation). Such conditions will usually be the result of a deficiency (temporary or permanent) of active Mpl ligand in vivo.
  • the generic term for platelet deficiency is thrombocytopenia, and hence the methods and compositions of the present invention are generally available for treating thrombocytopenia in patients in need thereof.
  • Thrombocytopenia may be present for various reasons, including chemotherapy and other therapy with a variety of drugs, radiation therapy, surgery, accidental blood loss, and other specific disease conditions.
  • Exemplary specific disease conditions that involve thrombocytopenia and may be treated in accordance with this invention are: aplastic anemia, idiopathic thrombocytopenia, metastatic tumors which result in thrombocytopenia, systemic lupus erythematosus, splenomegaly, Fanconi's syndrome, vitamin B12 deficiency, folic acid deficiency, May-Hegglin anomaly, Wiskott-Aldrich syndrome, and paroxysmal nocturnal hemoglobinuria.
  • certain treatments for AIDS result in thrombocytopenia (e.g., AZT).
  • Certain wound healing disorders might also benefit from an increase in platelet numbers.
  • a compound of the present invention could be administered several days to several hours prior to the need for platelets.
  • a compound of this invention could be administered along with blood or purified platelets.
  • the TMP compounds of this invention may also be useful in stimulating certain cell types other than megakaryocytes if such cells are found to express Mpl receptor. Conditions associated with such cells that express the Mpl receptor, which are responsive to stimulation by the Mpl ligand, are also within the scope of this invention.
  • the TMP compounds of this invention may be used in any situation in which production of platelets or platelet precursor cells is desired, or in which stimulation of the c-Mpl receptor is desired.
  • the compounds of this invention may be used to treat any condition in a mammal wherein there is a need of platelets, megakaryocytes, and the like. Such conditions are described in detail in the following exemplary sources: WO95/26746; WO95/21919; WO95/18858; WO95/21920 and are incorporated herein.
  • the TMP compounds of this invention may also be useful in maintaining the viability or storage life of platelets and/or megakaryocytes and related cells. Accordingly, it could be useful to include an effective amount of one or more such compounds in a composition containing such cells.
  • compositions and compounds of the present invention may also be employed, alone or in combination with other cytokines, soluble Mpl receptor, hematopoietic factors, interleukins, growth factors or antibodies in the treatment of disease states characterized by other symptoms as well as platelet deficiencies. It is anticipated that the inventive compound will prove useful in treating some forms of thrombocytopenia in combination with general stimulators of hematopoiesis, such as IL-3 or GM-CSF.
  • megakaryocytic stimulatory factors i.e., meg-CSF, stem cell factor (SCF), leukemia inhibitory factor (LIF), oncostatin M (OSM), or other molecules with megakaryocyte stimulating activity may also be employed with Mpl ligand.
  • SCF stem cell factor
  • LIF leukemia inhibitory factor
  • OSM oncostatin M
  • Additional exemplary cytokines or hematopoietic factors for such co-administration include IL-1 alpha, IL-1 beta, IL-2, IL-3, IL-4, IL-5, IL-6, IL-11, colony stimulating factor-1 (CSF-1), SCF, GM-CSF, granulocyte colony stimulating factor (G-CSF), EPO, interferon-alpha (IFN-alpha), consensus interferon, IFN-beta, or IFN-gamma. It may further be useful to administer, either simultaneously or sequentially, an effective amount of a soluble mammalian Mpl receptor, which appears to have an effect of causing megakaryocytes to fragment into platelets once the megakaryocytes have reached mature form.
  • administering to enhance the number of mature megakaryocytes
  • administration of the soluble Mpl receptor to inactivate the ligand and allow the mature megakaryocytes to produce platelets
  • the dosage recited above would be adjusted to compensate for such additional components in the therapeutic composition. Progress of the treated patient can be monitored by conventional methods.
  • the present invention also provides pharmaceutical compositions of the inventive compounds.
  • Such pharmaceutical compositions may be for administration for injection, or for oral, nasal, transdermal or other forms of administration, including, e.g., by intravenous, intradermal, intramuscular, intramammary, intraperitoneal, intrathecal, intraocular, retrobulbar, intrapulmonary (e.g., aerosolized drugs) or subcutaneous injection (including depot administration for long term release); by sublingual, anal, vaginal, or by surgical implantation, e.g., embedded under the splenic capsule, brain, or in the cornea.
  • the treatment may consist of a single dose or a plurality of doses over a period of time.
  • compositions comprising effective amounts of a compound of the invention together with pharmaceutically acceptable diluents, preservatives, solubilizers, emulsifiers, adjuvants and/or carriers.
  • Such compositions include diluents of various buffer content (e.g., Tris-HCl, acetate, phosphate), pH and ionic strength; additives such as detergents and solubilizing agents (e.g., Tween 80, Polysorbate 80), anti-oxidants (e.g., ascorbic acid, sodium metabisulfite), preservatives (e.g., Thimersol, benzyl alcohol) and bulking substances (e.g., lactose, mannitol); incorporation of the material into particulate preparations of polymeric compounds such as polylactic acid, polyglycolic acid, etc.
  • buffer content e.g., Tris-HCl, acetate, phosphate
  • additives such as detergents and solubilizing agents (
  • compositions optionally may include still other pharmaceutically acceptable liquid, semisolid, or solid diluents that serve as pharmaceutical vehicles, excipients, or media, including but are not limited to, polyoxyethylene sorbitan monolaurate, magnesium stearate, methyl- and propylhydroxybenzoate, starches, sucrose, dextrose, gum acacia, calcium phosphate, mineral oil, cocoa butter, and oil of theobroma.
  • Such compositions may influence the physical state, stability, rate of in vivo release, and rate of in vivo clearance of the present proteins and derivatives.
  • compositions may be prepared in liquid form, or may be in dried powder, such as lyophilized form.
  • Implantable sustained release formulations are also contemplated, as are transdermal formulations.
  • Controlled release formulation may be desirable.
  • the drug could be incorporated into an inert matrix which permits release by either diffusion or leaching mechanisms e.g., gums.
  • Slowly degenerating matrices may also be incorporated into the formulation, e.g., alginates, polysaccharides.
  • Another form of a controlled release of this therapeutic is by a method based on the Oros therapeutic system (Alza Corp.), i.e., the drug is enclosed in a semipermeable membrane which allows water to enter and push drug out through a single small opening due to osmotic effects. Some enteric coatings also have a delayed release effect.
  • pulmonary delivery of the present protein is delivered to the lungs of a mammal while inhaling and traverses across the lung epithelial lining to the blood stream.
  • Contemplated for use in the practice of this invention are a wide range of mechanical devices designed for pulmonary delivery of therapeutic products, including but not limited to nebulizers, metered dose inhalers, and powder inhalers, all of which are familiar to those skilled in the art.
  • Some specific examples of commercially available devices suitable for the practice of this invention are the Ultravent nebulizer, manufactured by Mallinckrodt, Inc., St. Louis, Miss.; the Acorn II nebulizer, manufactured by Marquest Medical Products, Englewood, Colo.; the Ventolin metered dose inhaler, manufactured by Glaxo Inc., Research Triangle Park, N.C.; and the Spinhaler powder inhaler, manufactured by Fisons Corp., Bedford, Mass.
  • each formulation is specific to the type of device employed and may involve the use of an appropriate propellant material, in addition to diluents, adjuvants and/or carriers useful in therapy.
  • inventive compound should most advantageously be prepared in particulate form with an average particle size of less than 10 ⁇ m (or microns), most preferably 0.5 to 5 ⁇ m, for most effective delivery to the distal lung.
  • Carriers include carbohydrates such as trehalose, mannitol, xylitol, sucrose, lactose, and sorbitol. Other ingredients for use in formulations may include DPPC, DOPE, DSPC and DOPC. Natural or synthetic surfactants may be used. Polyethylene glycol may be used (even apart from its use in derivatizing the protein or analog). Dextrans, such as cyclodextran, may be used. Bile salts and other related enhancers may be used. Cellulose and cellulose derivatives may be used. Amino acids may be used, such as use in a buffer formulation.
  • the dosage regimen involved in a method for treating the above-described conditions will be determined by the attending physician, considering various factors which modify the action of drugs, e.g. the age, condition, body weight, sex and diet of the patient, the severity of any infection, time of administration and other clinical factors.
  • the dose should be in the range of 0.1 ⁇ g to 100 mg of the inventive compound per kilogram of body weight per day, preferably 0.1 to 1000 ⁇ g/kg; and more preferably 0.1 to 150 ⁇ g/kg, given in daily doses or in equivalent doses at longer or shorter intervals, e.g., every other day, twice weekly, weekly, or twice or three times daily.
  • inventive compounds may be administered by an initial bolus followed by a continuous infusion to maintain therapeutic circulating levels of drug product.
  • the inventive compounds may be administered as a one-time dose.
  • Those of ordinary skill in the art will readily optimize effective dosages and administration regimens as determined by good medical practice and the clinical condition of the individual patient. The frequency of dosing will depend on the pharmacokinetic parameters of the agents and the route of administration.
  • the optimal pharmaceutical formulation will be determined by one skilled in the art depending upon the route of administration and desired dosage. See for example, Remington's Pharmaceutical Sciences, 18th Ed. (1990, Mack Publishing Co., Easton, Pa. 18042) pages 1435-1712, the disclosure of which is hereby incorporated by reference.
  • a suitable dose may be calculated according to body weight, body surface area or organ size.
  • Appropriate dosages may be ascertained through use of established assays for determining blood levels dosages in conjunction with appropriate dose-response data.
  • the final dosage regimen will be determined by the attending physician, considering various factors which modify the action of drugs, e.g. the drug's specific activity, the severity of the damage and the responsiveness of the patient, the age, condition, body weight, sex and diet of the patient, the severity of any infection, time of administration and other clinical factors. As studies are conducted, further information will emerge regarding the appropriate dosage levels and duration of treatment for various diseases and conditions.
  • TTR human transthyretin
  • the expression plasmid pAMG21 is available from the ATCC under accession number 98113, which was deposited on Jul. 24, 1996 (see PCT WO 97/23614, published Jul. 3, 1997 for a description of pAMG21). DNA sequence coding for TTR, TTR variants or TTR-peptide fusions was placed under control of the LuxPR promoter in pAMG21.
  • the Amgen host strain #2596 is an E. coli K-12 strain that has been modified to contain both the temperature sensitive lambda repressor cI857s7 in the early ebg region and the lacI Q repressor in the late ebg region (68 minutes).
  • the presence of these two repressor genes allows the use of this host with a variety of expression systems, however both of these repressors are irrelevant to the expression from luxP R .
  • the untransformed host has no antibiotic resistances.
  • the ribosomal binding site of the cI857s7 gene has been modified to include an enhanced RBS.
  • F'tet/GM101 was then modified by the delivery of a lacI Q construct into the ebg operon between nucleotide position 2493 and 2937 as numbered in the Genbank accession number M64441Gb_Ba with the deletion of the intervening ebg sequence.
  • the construct was delivered to the chromosome using a recombinant phage called AGebg-LacIQ#5 into F'tet/GM101. After recombination and resolution only the chromosomal insert described above remains in the cell. It was renamed F'tet/GM221.
  • the F'tet episome was cured from the strain using acridine orange at a concentration of 25 ⁇ g/ml in LB. The cured strain was identified as tetracyline sensitive and was stored as GM221.
  • Oligonucleotides (1.0 nm each) were synthesized by phosphoramidite method. Nucleotides were, in some cases, altered for optimized expression in E. coli. These codon changes did not result in changes in the amino acid sequence. Each of the oligonucleotides utilized in this example are listed in Table 1.
  • PCR was performed with the Expand Long Polymerase according to the manufacturer's protocol (Boehringer Mannheim). PCR products were verified by agarose gel electrophoresis, purified and digested with Nde1 and Xho1 (New England Biolabs). Expression vector pAMG21 was digested in the same manner and then treated with calf intestinal phosphatase (Boehringer Mannheim). The vector and insert were purified from an agarose gel, then mixed and ligated by T4 DNA ligase (New England Biolabs). Ligation was done at 4° C. for 2 hrs.
  • Each ligation mixture was transformed by electroporation into the host strain GM221 described above with a Biorad GenePulser (Biorad Laboratories) using 2.5V, 25 uFD, and 200 ohms in a cuvette with a gap length of about 2 mm. After electroporation, the cells were allowed to recover in 1 ml of Luria broth (LB) for about one hour at 37° C. with gentle shaking. The entire transformation mix was plated on LB agar containing 50 ⁇ g/ml kanamycin. Colonies were screened for presence of the desired molecular weight by PCR using oligonucleotides directed against flanking vector sequence. The PCR products were evaluated by agarose gel electrophoresis. Positive clones were further screened for the ability to produce the recombinant protein product and finally verified by nucleotide sequencing.
  • LB Luria broth
  • TTR DNA and amino acid sequences of TTR are known (Mita, S et al., Biochem. Biophys. Res. Commun. 124 (2), 558-564 [1984]). These sequences have been deposited in Genbank as accession number K02091. The cDNA of native TTR excluding the signal peptide was cloned from a cDNA library derived from human liver (Clontech).
  • an oligonucleotide encoding eight codons of the TTR 5′ (Oligo 2693-79) end and an oligonucleotide encoding seven codons of TTR 3′ end including a terminating codon (Oligo 2693-80) were synthesized and used to amplify the full-length mature TTR with Expand Long polymerase using human liver cDNA library as template.
  • the resulting PCR fragment was digested with NdeI and XhoI, gel purified and ligated with NdeI/XhoI restricted expression vector pAMG21. After 2 hours at 4° C., the ligation mixture was electroporated into GM221 cells.
  • Mutant TTR(C10A) was made by using oligonucleotide 2693-80 above and oligonucleotide 2820-88 (encompasses the first 11 codons of native TTR in which the codon Cys at the tenth position was changed to Ala).
  • the PCR procedure and the process for selecting the expression strain were similar to that described above.
  • the resulting strain (strain #5619) had the DNA sequence identified in SEQ ID NO:3.
  • Plasmid 5619 was further modified by replacing the amino acids at the following positions: A37, D38, A81 and G83, with the amino acid Cysteine.
  • each pair of the complementary oligonucleotides harboring the desired mutations was used in conjunction with TTR 5′ and 3′ primers described above in a standard two-step PCR procedure designed for site-specific mutagenesis.
  • Each of the forward primers were used with a TTR 3′ primer and each of the reverse primers were used with a TTR 5′ primer in a 20-cycle PCR in which plasmid derived from strain 5619 was used as the template.
  • TTR(A37C) forward (Oligo 2823-91); TTR(A37C) reverse (Oligo 2823-92); TTR(D38C) forward (Oligo 2823-93); TTR(D38C) reverse (Oligo 2823-94); TTR(A81C) forward (Oligo 2823-95); TTR(A81C) reverse (Oligo 2823-96); TTR(G83C) forward (Oligo 2823-97); TTR(G83C) reverse (Oligo 2823-98).
  • TTR(C10A/A37C)(strain 5641) had the DNA sequence identified in SEQ ID NO:4.
  • TTR(C10A/D38C)(strain 5642) had the DNA sequence identified in SEQ ID NO:5.
  • TTR(C10A/A81C)(strain 5643) had the DNA sequence identified in SEQ ID NO:6.
  • TTR(C10A/G83C)(strain 5651) had the DNA sequence identified in SEQ ID NO:7.
  • the Lys in the 15th position in strain 5651 was further mutagenized to Ala using oligonucleotides 2953-67 and 2953-68 by a procedure similar to that described for strains 5641, 5642, 5643 and 5651.
  • the resulting strain, TTR(C10A/K15A/G83C)(strain 5895) had the DNA sequence identified in SEQ ID NO:8.
  • This example describes the preparation of various TMP-TTR fusions. Several fusion proteins containing TTR and a TMP were prepared. Each of the oligonucleotides utilized in this example are listed in Table 2.
  • a fragment containing the TMP was first amplified from a strain harboring a plasmid encoding a full-length TMP-FC fusion (see PCT Publication No. 00/24770) using oligonucleotides 2743-96 which encodes the first 7 codons of the TMP plus a 12 nucleotide 5′ extension including a Nde1 site and 2743-97 which encodes the first 7 codons of native TTR and the last 7 codons of the TMP of interest.
  • TMP-TTR (strain 5513) had the DNA sequence identified in SEQ ID NO:9.
  • TMP was then introduced to the N-terminus of strains 5641, 5642, 5643 and 5651, respectively.
  • Plasmid 5513 was digested with Xba1, the resulting Xba1/Xba1 insert containing the TMP and the first 18 codons of TTR(C10A) was gel purified and ligated with Xba1 restricted, phosphatase treated and gel purified vector derived from 5641, 5642, 5643 and 5651.
  • DNA sequencing was performed to select the correct orientation for each fusion.
  • the resulting E. coli strains containing the plasmids are described as follows: TMP-TTR(C10A/A37C)(strain 5704) had the DNA sequence identified in SEQ ID NO:10.
  • TMP-TTR(C10A/D38C) (strain 5705) had the DNA sequence identified in SEQ ID NO:11.
  • TMP-TTR(C10A/A81C) (strain 5706) had the DNA sequence identified in SEQ ID NO:12.
  • TMP-TTR(C10A/G83C) (strain 5707) had the DNA sequence identified in SEQ ID NO:13.
  • TABLE 2 SEQ ID Oligo Sequence Number 2743-96 GAGGAATAACATATGATCGAAGGTCCGACTCTGCGT 31 2743-97 TTCACCGGTACCAGTTGGACCTGCGCGTGCTGCAAG 32 CCATT
  • oligonucleotide 2694-01 which encodes the first 7 codons of human PTH
  • oligonucleotide 2694-03 which encodes the first 7 codons of TTR and amino acids 28-34 of PTH
  • Oligonucleotides 2694-01 and 2694-03 were used in a 20-cycle PCR procedure as described above to amplify PTH (1-34) with the TTR linker.
  • the template for this reaction was a strain which harbors a plasmid encoding a PTH1-34-Fc fusion (see PCT Publication No. 01/81415).
  • This example describes the preparation of an IL-1ra-TTR(C10A) fusion and a TTR(C10A)-GSGS-IL-1ra fusion.
  • TTR(C10A)-GSGS-IL-1ra fusion Each of the oligonucleotides utilized in this example are listed in Table 4.
  • oligonucleotide 2823-13 which encodes the first 7 codons of the human protein IL-1ra
  • oligonucleotide 2823-14 which encodes the last 7 amino acids of IL-1ra and the first 7 amino acids of TTR
  • the resulting PCR product was mixed with plasmid purified from strain 5619 and used as a template to amplify full-length IL-1-ra-TTR(C10A) using oligonucleotide primers 2823-13 and 2693-80.
  • the PCR product was cloned, sequenced and expressed as described above.
  • the resultant strain containing the new plasmid was designated IL-1ra -TTR(C10A) (strain 5644) and had the DNA sequence identified in SEQ ID NO:15.
  • oligonucleotide 2787-32 which encodes the last 7 amino acids of TTR
  • oligonucleotide 2787-33 which encodes the last 7 codons of IL-1-ra
  • Plasmid purified from strain 5651 was used for PCR with oligonucleotide primer 2693-79 and oligonucleotide primer 2943-47, which is a TTR 3′ primer containing a PstI restriction site.
  • This PCR product was gel purified and restriction digested with NdeI and PstI.
  • the resulting DNA fragment was used in a ligation mixture containing AMG21, digested with NdeI and XhoI, and the annealed oligonucleotide linkers 2943-48, which encodes the GSGSG linker, and oligonucleotide 2943-49, which encodes the Bradykinin antagonist peptide KRPPGFSPL with PstI 5′ and XhoI 3′ overlapping ends.
  • GM121 was transformed with this ligation product and DNA was purified from the kanamycin resistant colonies. The DNA sequence was then confirmed in the resistant colonies. The confirmed strain was grown at 30° C. and induced for expression in a 10-liter fermentation described below.
  • the new strain was designated TTR(C10A/G83C)-Bradykinin (strain 5914) and had the DNA sequence identified in SEQ ID NO:17.
  • TABLE 5 SEQ ID Num- Oligo Sequence ber 2693-79 GAGGAATAACATATGGGTCCAACTGGTACCGGTGAA 39 2943-47 AATATACTGCAGTGGTGGAATAGGAG 40 2943-48 GTCGTCACCAATCCCAAGGAAGGATCAGGATCCGGA 41 AAACGTCCGCCGGGTTTCTCCCCGCTGTAATC 2943-49 TCGAGATTACAGCGGGGAGAAACCCGGCGGACGTTTT 42 CCGGATCCTGATCCTTCCTTGGGATTGGTGACGACTG CA
  • This example describes the recombinant expression of TTR and the TTR fusion constructs in E. coli.
  • Each of the newly constructed TTR or TTR fusions were first examined for soluble expression at temperatures ranging from 16° C. to 37° C.
  • cultures (25 ml) of GM221 expressing each of the TTR or TTR fusions were grown in LB medium supplemented with 50 ⁇ g/ml kanamycin at 37° C. until the optical density (OD) at 600 nm reached 0.5 to 1.0.
  • the cultures were then placed in shakers with temperature settings at 16° C., 20° C., 25° C., 30° C., 34° C. and 37° C., respectively.
  • the induction of gene product expression from the luxPR promoter was achieved following the addition of the synthetic autoinducer N-(3-oxohexanoyl)-DL-homoserine lactone to the culture media to a final concentration of 20 ng/ml. After 6 hours, the bacterial cultures were examined by microscopy for the presence of inclusion bodies. Often soluble or partial soluble expression could be achieved by growing the cultures at temperatures lower than 30° C. for TTR and its fusions, and this temperature was used for large-scale expression. In cases where soluble expression could not be achieved, temperatures at which the level of expression was at the highest were used for large-scale shakers or fermentors.
  • the fermentation stage begins with the inoculation from a seed culture of strains produced in a shake flask containing 500 mL of sterilized Luria broth.
  • this culture obtained the appropriate cell density (0.8-2 at 600 nm)
  • the contents were used to inoculate a 20 liter fermentor containing 10 liter of complex based growth medium.
  • the fermentor is maintained at 30° C. and pH 7 with dissolved oxygen levels kept at 30% saturation.
  • the cell density reached an optical density of 10-12 OD units at 600 nm, at which point the culture was induced by the addition of N-(3-oxo-hexanoyl) homoserine lactone.
  • the cells were harvested from the fermentor by centrifugation.
  • This example describes the purification of TTR(C10A/G83C)-Bradykinin.
  • 50 tablets of Sigma protease inhibitor cocktail 1-873-580 (Saint Louis, Mo.) was dissolved in the cell suspension and the suspension was passed through a model 110-Y microfluidizer (Microfluidics, Newton, Mass.) twice at 12,000 PSI.
  • the lysate (FIG. 1, Lane 2) was centrifuged at 11,325 ⁇ g for 50 min 4° C.
  • the supernatant was removed as the soluble fraction.
  • the soluble fraction was heated in a 65° C. water bath for 30 minutes in polypropylene bottles, at which time the temperature of the contents was 63° C.
  • the soluble fraction was centrifuged at 11,325 ⁇ g for 50 minutes 4° C.
  • the supernatant was removed as Heat Soluble (FIG. 1, Lane 3).
  • the heat soluble fraction was filtered through a 0.45 ⁇ m cellulose acetate filter with two prefilters and then loaded on to a 240 ml Q-sepharose fast flow (5 cm ID) column (Amersham Pharmacia Biotech, Piscataway, N.J.) at 20 ml/min equilibrated in Q-Buffer A (20 mM tris HCl, 2.5 mM EDTA, pH 8.0) at room temperature (about 23° C.). Column was washed with about 2300 ml Q-Buffer A at 20 ml/min.
  • Q-column was eluted with a 15 column volume linear gradient to 60% Q-Buffer B (20 mM tris HCl, 1 M NaCl, 2.5 mM EDTA, pH 8.0) followed by a 2 column volume step to 100% Q-Buffer B. Fractions containing the TTR fusion as determined by SDS-PAGE were pooled into a single Q-pool (1150 ml) (FIG. 1, Lane 4) and 1.77 g of DTT was added. The Q-pool was gently stirred for 30 min at room temperature (about 23° C.).
  • P-pool was loaded on to a 105 ml (2.6 cm) type 1 ceramic hydroxyapatite column (Bio-Rad Inc., Hercules, Calif.) at 10 ml/min in HA-Buffer A. Column was washed with approximately 210 ml HA-Buffer A at 10 ml/min followed by 4 steps of 12.5%, 25%, 50%, and 100% HA-Buffer B (400 mM NaH 2 PO 4 , pH 7.0). The flowthrough was pooled as HA-pool (340 ml) (FIG. 1, Lane 6) and 524 mg of DTT was added followed by incubation at room temperature (about 23° C.) for 1 hour.
  • HA-pool 340 ml
  • Lane 6 524 mg of DTT was added followed by incubation at room temperature (about 23° C.) for 1 hour.
  • HA-pool About one-half of the HA-pool was loaded on to a 47 ml source 15Q (2.6 cm ID) column (Amersham Pharmacia Biotech) at 10 ml/min followed by a wash with about 250 ml Q-Buffer A. Column was eluted with a 20 column volume linear gradient from 10% to 50% Q-Buffer B followed a step of 2 column volumes of 100% Q-Buffer B. The remaining half of the HA-Pool was then processed using the same protocol as the first half. Fractions containing the TTR fusion as determined by SDS-PAGE were pooled into a single Q2-pool (260 ml) and concentrated to about 75 ml using a stirred cell with a 10 kDa membrane. Q2-pool (FIG.
  • TTR(C10A/G83C) fusing a peptide to either the C-terminus or N-terminus of TTR(C10A/G83C) does not have a significant impact on its oligomeric structure.
  • TTR(C10A/G83C) eluted at approximately 8.8 min corresponding to a molecular size of 49 kDa, which is comparable to the calculated molecular weight of the tetramer at 55 kDa.
  • PTH-TTR(C10A/K15A/G83C) eluted at about 8.6 min corresponding to a molecular size of 67 kDa, which is close to the calculated 71 kDa for the tetramer.
  • TTR(C10A/G83C)-Bradykinin eluted at about 8.7 min corresponding to a molecular size of 57 kDa, which is also close to the calculated 60 kDa for the tetramer.
  • TTR(C10A) IL-1-ra-TTR(C10A)
  • TTR(C10A)-IL-1-ra was injected on to a Biosep-Sec-S 3000 column (7.8 mm ID ⁇ 300 mm) (Phenomenex) in SEC-Buffer at 1 ml/min.
  • Bio-Rad molecular weight standards (151-1901) were used to calibrate the column and calculate the approximate molecular weight of the injected samples.
  • TTR(C10A) elutes at approximately 8.8 min, which corresponds to a molecular size of 49 kDa which is comparable to the calculated molecular weight of the tetramer at 55 kDa.
  • the IL-1-ra-TTR(C10A) fusion eluted at about 7.9 min corresponding to a molecular size of 188 kDa, which is noticeably larger than that expected for the tetramer at 124 kDa.
  • TTR(C10A)-IL-1-ra eluted at about 7.9 min, again corresponding to a molecular size of 188 kDa compared to the 124 kDa expected for the tetramer.
  • This example compares the binding of a TMP sequence fused to the carboxy-terminus of human immunoglobulin Fc (Fc-TMP) and TMP(m)-TTR to soluble human myeloproliferative leukemia (MPL) receptor.
  • Fc-TMP human immunoglobulin Fc
  • MPL myeloproliferative leukemia
  • this figure demonstrates that pegylation of the native TTR cysteine (Cys 10) interferes with the binding of TMP to the MPL receptor.
  • the binding of TMP(m)-TTR-PEG5K showed a significantly repressed binding response compared to its non-pegylated counterpart, and TMP(m)-TTR-PEG20K showed an even more severe inhibition.
  • This example shows the effect of injecting TMP(m)-TTR into mice on blood platelet count.
  • 50 BDF1 mice (Charles River Laboratories, Wilmington, Mass.) were split into 5 groups and injected (day 0) subcutaneously with either diluting agent (Dulbecco's PBS with 0.1% bovine serum albumin) or diluting agent with 50 ⁇ g test protein per kg animal.
  • diluting agent Dulbecco's PBS with 0.1% bovine serum albumin
  • diluting agent 50 ⁇ g test protein per kg animal.
  • Each group was divided in half and bled (140 ⁇ l) from the retro-orbital sinus on alternate time points (day 0, 3, 5, 7, 11, 12, 14, and 17). Mice were anesthetized with isoflurane prior to bleeding.
  • TMP(m)-TTR-PEG 5K was a moderate responder peaking at 2.3 ⁇ 10 12 platelets L ⁇ 1 which is just under twice the baseline level.
  • the non-pegylated form of TMP(m)-TTR shows very little response at 1.5 ⁇ 10 12 platelets L ⁇ 1 which is only 20% over the baseline level.
  • TMP(m)-TTR shows better binding in vitro than its pegylated counterparts (FIG. 4), but it has poor performance in vivo compared to TMP(m)-TTR-PEG 5K. This indicates that PEG is required to improve the biological half-life of the TTR construct, and this more than compensates for the reduced affinity for the receptor.
  • TTR(C10A) elutes at approximately 8.8 min, which corresponds to a molecular size of 57 kDa which is similar to the calculated molecular weight of the tetramer at 55 kDa.
  • This data combined with the observation that both forms of TTR are resistant to precipitation at 65° C. (data not shown) indicates that mutation of cysteine 10 to alanine does not have a significant impact on the structure or stability of TTR.
  • This example demonstrates that mutation of alanine 37 to cysteine TMP-TTR(C10A/A37C), aspartate 38 to cysteine TMP-TTR(C10A/D38C), alanine 81 to cysteine TMP-TTR(C10A/A81C), or glycine 83 to cysteine TMP-TTR(C10A/G83C) in a cysteine 10 to alanine background does not have a significant impact on the oligomeric structure of TTR.
  • this example demonstrates that pegylation of these mutant forms of TTR with a 5K or 20K PEG produces two distinct species of TTR with significantly greater molecular size than the unpegylated form.
  • the pegylation of TTR was carried out by first reducing about 8 ml of the TTR (7.28 mg/ml) with 10 mM DTT for 30 minutes at 30° C. in the presence of 50 mM tris HCl, pH 8.5.
  • the reduced TTR was then desalted using a 26 ml sephadex G25 medium column (2.6 cm ID) (Amersham Pharmacia Biotech) at 2.5 ml/min in 20 mM tris HCl, pH 8.5.
  • the concentration was then determined by measuring the absorbance of the reduced TTR at 280 nm and using the calculated extinction coefficient (29,450 M ⁇ 1 for TMP-TTR(C10A/A37C) (5.14 mg/ml).
  • One-half (4.6 ml) of the reduced sample was then immediately mixed with 810 ⁇ l of 5 mM methoxy-PEG-maleimide 5K (Shearwater Corporation, Huntsville, Ala.) and the remaining half was mixed with 1620 ⁇ l 2.5 mM methoxy-PEG-maleimide 20K (Shearwater Corporation).
  • the reaction was allowed to proceed at 30° C. for 30 min and was quenched by the addition of 46 ⁇ l 1 M DTT.
  • Each pegylated sample was then loaded on to a 5 ml HiTrap Q-sepharose column at 2.5 ml/min and washed with several column volumes of Q-Buffer A (20 mM tris HCl, pH 8.0) at 5 ml/min.
  • the columns were eluted with a linear gradient to 40% Q-Buffer B (20 mM tris HCl, 1 M NaCl, pH 8.0) followed by a 2 column volume step to 100% Q-Buffer B. Peak fractions were pooled and the concentration determined by measuring the absorbance of the pool at 280 nm. About 50 ⁇ g of each sample was injected on to a Biosep-Sec-S 3000 column (7.8 mm ID ⁇ 300 mm) (Phenomenex) in SEC-Buffer at 1 ml/min. Bio-Rad molecular weight standards (151-1901) were used to calibrate the column and calculate the approximate molecular size of the injected samples. As can be seen in FIG.
  • the apparent molecular size of the 4 non-pegylated TMP-TTR constructs is between 40 and 45 kDa which is noticeably lower than the expected 70 kDa tetramer. This retarded elution time is likely due to a slight interaction of the TMP-TTR construct with the size exclusion resin, which has been observed with several other TMP constructs (data not shown). After conjugation with the 5K PEG, the apparent molecular size increases to between 421 and 428 kDa (1.53-1.64 minutes more advanced elution than the unpegylated counterparts), which is much greater than the expected 90 kDa.
  • FC-TMP was bound to a BIAcore protein G chip at high density as per the manufacturer's instructions (BIAcore, Uppsula, Sweden).
  • Test proteins were preincubated with 5 nM MPL receptor in Binding Buffer (Dulbecco's PBS (Gibco BRL, Gaithersburg, Md.) with 0.1 mg/ml bovine serum albumin and 0.005% P20 (polyoxyethylenesorbitan) for >2 hours at room temperature (about 23° C.). For non-pegylated proteins, 0.1 mg/ml heparin was added to prevent non-specific binding. All samples were then passed over the chip at 50 ⁇ l/min in Binding Buffer. The equilibrium endpoint was taken 3 min post injection. As can be seen in FIG. 9, all TTR constructs showed similar affinity for the MPL receptor with affinities ranging from 0.881 to 2.333 nm, while the Fc-TMP construct had affinities ranging from 3.276 to 5.369 nm.
  • Binding Buffer Dulbecco's PBS (Gibco BRL, Gaithersburg, Md.) with 0.1 mg/ml bo
  • This example shows the effect of injecting pegylated TMP-TTR constructs into mice on blood platelet count.
  • 170 BDF1 mice were split into 17 groups and injected (day 0) subcutaneously with 50 ⁇ g test protein per kg animal (TMP fusion construct, Fc-TMP, or a TTR(C10A) control). Each group was divided in half and bled (140 ⁇ l) from the retro-orbital sinus on alternate time points (day 0, 3, 5, 7, 10, 12, and 14). Mice were anesthetized with isoflurane prior to bleeding. The collected blood was analyzed for a complete and differential count using an ADVIA 120 automated blood analyzer with murine software (Bayer Diagnostics, New York, N.Y.).
  • Fc-TMP showed the greatest response with platelet count rising to over 4.2 ⁇ 10 12 platelets L ⁇ 1 on day 5 which is 3 times baseline at 1.4 ⁇ 10 12 platelets L ⁇ 1 .
  • All 4 of the non-pegylated TMP-TTR constructs preformed better than the control, but not as well as Fc-TMP with platelet counts between 1.8 and 2.9 ⁇ 10 12 platelets L ⁇ 1 on day 5, which is between a 29% and 107% improvement over baseline.
  • FIG. 10A Fc-TMP showed the greatest response with platelet count rising to over 4.2 ⁇ 10 12 platelets L ⁇ 1 on day 5 which is 3 times baseline at 1.4 ⁇ 10 12 platelets L ⁇ 1 .
  • All 4 of the non-pegylated TMP-TTR constructs preformed better than the control, but not as well as Fc-TMP with platelet counts between 1.8 and 2.9 ⁇ 10 12 platelets L ⁇ 1 on day 5, which is between a 29% and 107% improvement over baseline.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Epidemiology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • Endocrinology (AREA)
  • Zoology (AREA)
  • Diabetes (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Molecular Biology (AREA)
  • Hematology (AREA)
  • Toxicology (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Heart & Thoracic Surgery (AREA)
  • Cardiology (AREA)
  • Emergency Medicine (AREA)
  • Obesity (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Peptides Or Proteins (AREA)
  • Medicinal Preparation (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Medical Preparation Storing Or Oral Administration Devices (AREA)
  • Infusion, Injection, And Reservoir Apparatuses (AREA)
  • Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)

Abstract

The present invention provides a means for increasing the serum half-life of a selected biologically active agent by utilizing transthyretin (TTR) as a fusion partner with a biologically active agent. Specifically, the present invention provides substantially homogenous preparations of TTR (or a TTR variant)-biologically active agent fusions and PEG-TTR (PEG-TTR variant)-biologically active agent fusions. As compared to the biologically active agent alone, the TTR-biologically active agent fusion and/or PEG-TTR-biologically active agent fusion has substantially increased serum half-life.

Description

    BACKGROUND OF THE INVENTION
  • Proteins, peptides and other drug molecules for therapeutic use are currently available in suitable forms in adequate quantities largely as a result of the advances in recombinant DNA technologies. The availability of such peptides and proteins has engendered advances in protein formulation and chemical modification. Chemical modification of biologically active peptides, proteins, oligonucleotides and other drugs for purposes of extending the serum half-life of such bioactive agents has been extensively studied. The ability to extend the serum half-life of such agents allows for the therapeutic potential of the agent to be realized without the need for high dosages and frequent administration. [0001]
  • Chemical modification used to extend the half-lives of proteins in vivo includes the chemical conjugation of a water soluble polymer, such as polyethylene glycol (PEG), to the protein of interest. A variety of approaches have been used to attach the polyethylene glycol molecules to the protein (PEGylation). For example, Royer (U.S. Pat. No. 4,002,531) states that reductive alkylation was used for attachment of polyethylene glycol molecules to an enzyme. Davis et al. (U.S. Pat. No. 4,179,337) disclose PEG:protein conjugates involving, for example, enzymes and insulin. Shaw (U.S. Pat. No. 4,904,584) disclose the modification of the number of lysine residues in proteins for the attachment of polyethylene glycol molecules via reactive amine groups. Hakimi et al. (U.S. Pat. No. 5,834,594) disclose substantially non-immunogenic water soluble PEG:protein conjugates, involving for example, the proteins IL-2, interferon alpha, and IL-1ra. The methods of Hakimi et al. involve the utilization of unique linkers to connect the various free amino groups in the protein to PEG. Kinstler et al. (U.S. Pat. Nos. 5,824,784 and 5,985,265) teach methods allowing for selectively N-terminally chemically modified proteins and analogs thereof, including G-CSF and consensus interferon. [0002]
  • Other approaches designed to extend the serum half-life of bioactive agents include: conjugation of the peptides to a large, stable protein which is too large to be filtered through the kidneys (e.g., serum albumin); G. D. Mao et al., [0003] Biomat., Art. Cells, Art. Org. 17:229-244 (1989); use of low- and high-density lipoproteins as transport vehicles and to increase serum half-life; P. Chris de Smidt et al., Nuc. Acids. Res., 19(17):4695-4700 (1991); the use of the Fc region of immunoglobulins to produce Fc-protein fusions; PCT WO 98/28427 (Mann et al, and references cited therein); and the use of the Fc domain to increase in vivo half-life of one or more biologically active peptides; PCT WO 00/24782 (Feige et al, and references cited therein).
  • Transthyretin (TTR) (formerly called prealbumin) is a 56 kDa tetrameric serum protein that plays important physiological roles as a transporter of thyroxine and retinol-binding protein; Hamilton and Benson, [0004] Cell. Mol. Life Sci., 58:1491-1521 (2001), and references cited therein. Blaney et al., in U.S. Pat. No. 5,714,142, describe the exploitation of TTR by endowing the drug to be administered with functionality that allows it to bind specifically to the protein. Specifically, Blaney et al. demonstrate that covalent attachment of a peptide, protein, nucleotide, oligonucleotide, oligosaccharide or other drug to a transthyretin-selective ligand will reversibly bind the drug to TTR and thereby increase the serum half-life of the agent based on the affinity of the ligand for TTR. It is stated that the intrinsic activity of the drug is not adversely affected and the resulting drug-TTR ligand conjugate will still be small enough to be orally absorbed.
  • SUMMARY OF THE INVENTION
  • It has been found, surprisingly and importantly, that TTR (or a TTR variant), and in particular, a TTR or TTR variant which has been chemically modified via conjugation to a water soluble polymer, e.g., can be used as a fusion partner with a biologically active agent to increase the serum half-life of the biologically active agent. Accordingly, the present invention provides a means for increasing the serum half-life of a selected biologically active agent. [0005]
  • The present invention thus relates to substantially homogenous preparations of TTR (or a TTR variant)-biologically active agent fusions and PEG-TTR (PEG-TTR variant)-biologically active agent fusions. As compared to the biologically active agent alone, the TTR-biologically active agent fusion and/or PEG-TTR-biologically active agent fusion has substantially increased serum half-life. [0006]
  • The present invention further relates to TTR-biologically active agent fusions and PEG-TTR-biologically active agent fusions, in a pharmaceutically acceptable carrier, to provide a pharmacologically active compound. [0007]
  • The present invention further relates to the preparation of TTR variants. Specifically, TTR proteins are modified such that cysteine residue(s) are engineered into the TTR protein sequence. The TTR variants are recoverable in high yield and are then chemically modified via conjugation of a water soluble polymer at the cysteine residue to provide a chemically modified TTR variant which can then be fused to a selected biologically active agent. [0008]
  • The present invention further relates to processes for preparing pharmacologically active compounds. For example, the principal embodiment of the method for making the substantially homogenous preparation of a PEG-TTR-peptide fusion comprises: (a) engineering a cysteine residue into a specific amino acid position within the amino acid sequence of said TTR to provide a variant of said TTR; (b) conjugating a polyethylene glycol to said TTR variant at said cysteine residue to provide a PEG-TTR; (c) fusing said PEG-TTR to a peptide of interest to provide a PEG-TTR-peptide fusion; and (d) isolating said PEG-TTR-peptide fusion. [0009]
  • The present invention also relates to methods of treatment of individuals using the pharmacologically active compounds as above.[0010]
  • BRIEF DESCRIPTION OF THE DRAWINGS
  • FIG. 1 is an SDS gel that depicts the purification of an [0011] E. coli expressed, recombinant human transthyretin (TTR) variant (C10A/G83C) with a Bradykinin peptide fused to the C-terminus of TTR. Lane 1 contains Novex Mark 12 molecular weight standards, and lanes 2-7 contain the following respectively: cell lysate, post-heating supernatant, pool from Q-sepharose chromatography step, pool from phenyl sepharose chromatography step, pool from hydroxyapatite chromatography step, and pool from source Q chromatography step.
  • FIG. 2 demonstrates by size exclusion chromatography that fusion of peptides to the amino-terminus or carboxy-terminus of a TTR variant, TTR(C10A/G83C), does not alter its oligomeric structure. Solid line is TTR(C10A/G83C), dashed line is PTH fused to the amino-terminus of TTR(C10A/G83C), and the dotted line is Bradykinin fused to the carboxy-terminus of TTR(C10A/G83C). [0012]
  • FIG. 3 demonstrates by size exclusion chromatography that fusion of proteins to the amino-terminus or carboxy-terminus of a TTR variant, TTR(C10A), does not alter its oligomeric structure. Solid line is TTR(C10A), dashed line is IL-1-ra fused to the carboxy-terminus of TTR(C10A), and the dotted line is IL-1-ra fused to the amino-terminus of TTR(C10A). [0013]
  • FIG. 4 shows the binding observed using BIAcore of various TPO-mimetic peptide (TMP) constructs to human MPL receptor: ▪ Fc-TMP,  TMP(m)-TTR, ▴ TMP(m)-TTR-PEG5K, ▾ TMP(m)-TTR-PEG20K. [0014]
  • FIG. 5 shows that injection of TMP(m)-TTR-PEG5K induces platelet formation in mice. The following symbols correspond to the following constructs: ▪ Carrier,  FC-TMP, ▴ TTR-TMP, ▾ TMP(m)-TTR, and ♦ TMP(m)-TTR-PEG5K. [0015]
  • FIG. 6 demonstrates by size exclusion chromatography that native TTR and TTR(C10A) maintain a similar oligomeric configuration (an apparent tetramer). Solid line is native TTR and the dashed line is TTR(C10A). [0016]
  • FIG. 7 demonstrates by size exclusion chromatography that conjugation of PEG to TTR increases its molecular size in a predictable uniform manner. Solid lines indicate no PEG conjugated, dashed lines indicate 5K PEG fused, and dotted lines indicate 20K PEG fused. The following constructs were used: A) TMP-TTR(C10A/A37C), B) TMP-TTR(C10A/D38C), C) TMP-TTR(C10A/A81C), and D) TMP-TTR(C10A/G83C). [0017]
  • FIG. 8 is an SDS gel that depicts the extent of pegylation of various TMP-TTR constructs involving TTR variants having a non-native cysteine engineered in at one of four different locations. [0018] Lane 1 contains Novex Mark 12 molecular weight standards; lane 2 is unpegylated TMP-TTR(C10A/A37C); lanes 3-6 are 5K pegylated versions of TMP-TTR(C10A/A37C), TMP-TTR(C10A/D38C), TMP-TTR(C10A/A81C), and TMP-TTR(C10A/G83C) respectively; lanes 7-10 are 20K pegylated versions of TMP-TTR(C10A/A37C), TMP-TTR(C10A/D38C), TMP-TTR(C10A/A81C), and TMP-TTR(C10A/G83C), respectively.
  • FIG. 9 compares the competitive binding of Fc-TMP and TMP-TTR to human MPL by BIAcore analysis. A) ▪ Fc-TMP,  TMP-TTR(C10A/A37C), ▴ TMP-TTR(C10A/D38C), ▾ TMP-TTR(C10A/A81C), ♦ TMP-TTR(C10A/G83C). B) ▪ Fc-TMP, 5K pegylated versions of TMP-TTR(C10A/A37C) (), TMP-TTR(C10A/D38C) (▴), TMP-TTR(C10A/A81C) (▾), TMP-TTR(C10A/G83C) (♦). C) ▪ Fc-TMP, 20K pegylated versions of TMP-TTR(C10A/A37C)(), TMP-TTR(C10A/D38C) (▴), TMP-TTR(C10A/A81C) (▾), TMP-TTR(C10A/G83C) (♦). [0019]
  • FIG. 10 shows that injection of TMP-TTR with PEG conjugated to engineered cysteines induces platelet formation in mice. A) ▪ TTR(C10A),  Fc-TMP, ▴ TMP-TTR(C10A/A37C), ▾ TMP-TTR(C10A/D38C) (carboxamidomethylated), ♦ TMP-TTR(C10A/A81C), [0020]
    Figure US20030191056A1-20031009-P00001
    TMP-TTR(C10A/G83C). B) ▪ TTR(C10A),  Fc-TMP, 5K pegylated versions of TMP-TTR(C10A/A37C) (▴), TMP-TTR(C10A/D38C) (▾), TMP-TTR(C10A/A81C) (♦), TMP-TTR(C10A/G83C) (
    Figure US20030191056A1-20031009-P00001
    ). C) ▪ TTR(C10A),  Fc-TMP, 20K pegylated versions of TMP-TTR(C10A/A37C) (▴), TMP-TTR(C10A/D38C) (▾), TMP-TTR(C10A/A81C) (♦), TMP-TTR(C10A/G83C) (
    Figure US20030191056A1-20031009-P00001
    ).
  • DETAILED DESCRIPTION OF THE INVENTION
  • For purposes of describing the present invention, the following terms are defined as set forth below. [0021]
  • The term “biologically active agent” refers to any chemical material or compound useful for prophylactic, therapeutic or diagnostic application. The term “pharmacologically active compound” refers to a compound suitable for administration to a mammalian, preferably a human individual, which induces a desired local or systemic effect. [0022]
  • The terms “peptide”, “polypeptide” and “protein” as used to describe biologically active agents herein are used interchangeably to refer to a naturally occurring, recombinantly produced or chemically synthesized polymer of amino acids. The terms are intended to include peptide molecules containing as few as 2 amino acids, chemically modified polypeptides, consensus molecules, analogs, derivatives or combinations thereof. [0023]
  • Any number of peptides may be used in conjunction with the present invention. Of particular interest are peptides that mimic the activity of EPO, TPO, growth hormone, G-CSF, GM-CSF, IL-1ra, leptin, CTLA4, TRAIL, TGF-α, and TGF-β. The terms “-mimetic peptide” and “-agonist peptide” refer to a peptide having biological activity comparable to a protein (e.g., EPO, TPO, G-CSF) that interacts with a protein of interest. These terms further include peptides that indirectly mimic the activity of a protein of interest, such as by potentiating the effects of the natural ligand of the protein of interest. Thus, the term “EPO-mimetic peptide” comprises any peptides that can be identified or derived as having EPO-mimetic subject matter; see, for example, Wrighton et al., [0024] Science, 273:458-63 (1996); and Naranda et al., Proc. Natl. Acad. Sci. USA 96:7569-74 (1999). Those of ordinary skill in the art appreciate that each of these references enables one to select different peptides than actually disclosed therein by following the disclosed procedures with different peptide libraries.
  • The term “TPO-mimetic peptide” (TMP) comprises peptides that can be identified or derived as having TPO-mimetic subject matter; see, for example, Cwirla et al., [0025] Science, 276:1696-9 (1997); U.S. Pat. Nos. 5,869,451 and 5,932,946; and PCT WO 00/24782 (Liu et al, and references cited therein), hereby incorporated by reference in its entirety. Those of ordinary skill in the art appreciate that each of these references enables one to select different peptides than actually disclosed therein by following the disclosed procedures with different peptide libraries.
  • The term “G-CSF-mimetic peptide” comprises any peptides that can be identified as having G-CSF-mimetic subject matter; see, for example, Paukovits et al., [0026] Hoppe-Seylers Z. Physiol. Chem. 365:303-11 (1984). Those of ordinary skill in the art appreciate that each of these references enables one to select different peptides than actually disclosed therein by following the disclosed procedures with different peptide libraries.
  • The term “CTLA4-mimetic peptide” comprises any peptides that can be identified or derived as described in Fukumoto et al., [0027] Nature Biotech. 16:267-70 (1998). Those of ordinary skill in the art appreciate that each of these references enables one to select different peptides than actually disclosed therein by following the disclosed procedures with different peptide libraries.
  • Peptide antagonists are also of interest, particularly those antagonistic to the activity of TNF, leptin, any of the interleukins, and proteins involved in complement activation (e.g., C3b). The term “-anatgonist peptide” or “inhibitor peptide” refers to a peptide that blocks or in some way interferes with the biological activity of the associated protein of interest, or has biological activity comparable to a known antagonist or inhibitor of the associated protein of interest. Thus, the term “TNF-antagonist peptide” comprises peptides that can be identified or derived as having TNF-antagonistic subject matter; see, foe example, Takasaki et al., [0028] Nature Biotech., 15:1266-70 (1997). Those of ordinary skill in the art appreciate that each of these references enables one to select different peptides than actually disclosed therein by following the disclosed procedures with different peptide libraries.
  • The terms “IL-1 antagonist” and “IL-1ra-mimetic peptide” comprises peptides that inhibit or down-regulate activation of the IL-1 receptor by IL-1. IL-1 receptor activation results from formation of a complex among IL-1, IL-1 receptor, and IL-1 receptor accessory protein. IL-1 antagonist or IL-1ra-mimetic peptides bind to IL-1, IL-1 receptor, or IL-1 receptor accessory protein and obstruct complex formation among any two or three components of the complex. Exemplary IL-1 antagonist or IL-1ra-mimetic peptides can be identified or derived as described in U.S. Pat. Nos. 5,608,035, 5,786,331, 5,880,096. Those of ordinary skill in the art appreciate that each of these references enables one to select different peptides than actually disclosed therein by following the disclosed procedures with different peptide libraries. [0029]
  • The term “VEGF-antagonist peptide” comprises peptides that can be identified or derived as having VEGF-antagonistic subject matter; see, for example, Fairbrother, [0030] Biochem., 37:17754-64 (1998). Those of ordinary skill in the art appreciate that each of these references enables one to select different peptides than actually disclosed therein by following the disclosed procedures with different peptide libraries.
  • The term “MMP inhibitor peptide” comprises peptides that can be identified or derived as having MMP inhibitory subject matter; see, for example, Koivunen, [0031] Nature Biotech., 17:768-74 (1999). Those of ordinary skill in the art appreciate that each of these references enables one to select different peptides than actually disclosed therein by following the disclosed procedures with different peptide libraries.
  • Targeting peptides are also of interest, including tumor-homing peptides, membrane-transporting peptides, and the like. [0032]
  • Exemplary peptides may be randomly generated by various techniques known in the art. For example, solid phase synthesis techniques are well known in the art, and include those described in Merrifield, [0033] Chem. Polypeptides, pp. 335-61 (Katsoyannis and Panayotis eds.)(1973); Merrifield, J. Am. Chem. Soc., 85:2149 (1963); Davis et al., Biochem. Intl., 10:394-414 (1985); Stewart and Young, Solid Phase Peptide Synthesis (1969); U.S. Pat. No. 3,941,763; Finn et al., The Proteins, 3rd ed., 2:105-253 (1976); and Erickson et al., The Proteins, 3rd ed., 2:257-527 (1976). Solid phase synthesis is the preferred technique of making individual peptides since it is the most cost-effective method of making small peptides.
  • Phage display is another useful method in generating peptides for use in the present invention. It has been stated that affinity selection from libraries of random peptides can be used to identify peptide ligands for any site of any gene product; Dedman et al., [0034] J. Biol. Chem., 268:23025-30 (1993). Phage display is particularly well suited for identifying peptides that bind to such proteins of interest as cell surface receptors or any proteins having linear epitopes; Wilson et al., Can. J. Microbiol., 44:313-29 (1998); Kay et al., Drug Disc. Today, 3:370-8 (1998). Such proteins are extensively reviewed in Herz et al., J. Receptor & Signal Transduction Res., 17(5):671-776 (1997), which is hereby incorporated by reference.
  • The peptides may also be made in transformed host cells using recombinant DNA techniques. To do so, a recombinant DNA molecule coding for the peptide is prepared. Methods of preparing such DNA and/or RNA molecules are well known in the art. For instance, sequences coding for the peptides could be excised from DNA using suitable restriction enzymes. The relevant sequences can be created using the polymerase chain reaction (PCR) with the inclusion of useful restriction sites for subsequent cloning. Alternatively, the DNA/RNA molecule could be synthesized using chemical synthesis techniques, such as the phosphoramidite method. Also, a combination of these techniques could be used. [0035]
  • Additional biologically active agents contemplated for use include recombinant or naturally occurring proteins, whether human or animal, hormones, cytokines, hematopoietic factors, growth factors, antiobesity factors, trophic factors, anti-inflammatory factors, and enzymes. Such proteins would include but are not limited to interferons (see, U.S. Pat. Nos. 5,372,808, 5,541,293 4,897,471, and 4,695,623 hereby incorporated by reference including drawings), interleukins (see, U.S. Pat. No. 5,075,222, hereby incorporated by reference including drawings), erythropoietins (see, U.S. Pat. Nos. 4,703,008, 5,441,868, 5,618,698 5,547,933, and 5,621,080 hereby incorporated by reference including drawings), granulocyte-colony stimulating factors (see, U.S. Pat. Nos. 4,810,643, 4,999,291, 5,581,476, 5,582,823, and PCT Publication No. 94/17185, hereby incorporated by reference including drawings), stem cell factor (PCT Publication Nos. 91/05795, 92/17505 and 95/17206, hereby incorporated by reference including drawings), NESP (PCT Publication No. US94/02957, hereby incorporated by reference including drawings), osteoprotegerin (PCT Publication No. 97/23614, hereby incorporated by reference including drawings), interleukin-1 receptor antagonist (IL-1ra)(PCT Publication Nos. 91/08285 and 92/16221) and leptin (OB protein) (PCT publication Nos. 96/40912, 96/05309, 97/00128, 97/01010 and 97/06816 hereby incorporated by reference including figures). [0036]
  • In addition, biologically active agents can also include but are not limited to insulin, gastrin, prolactin, adrenocorticotropic hormone (ACTH), thyroid stimulating hormone (TSH), luteinizing hormone (LH), follicle stimulating hormone (FSH), human chorionic gonadotropin (HCG), motilin, interferons (alpha, beta, gamma), interleukins (IL-1 to IL-12), tumor necrosis factor (TNF), tumor necrosis factor-binding protein (TNF-bp), brain derived neurotrophic factor (BDNF), glial derived neurotrophic factor (GDNF), neurotrophic factor 3 (NT3), fibroblast growth factors (FGF), neurotrophic growth factor (NGF), bone growth factors such as osteoprotegerin (OPG), insulin-like growth factors (IGFs), macrophage colony stimulating factor (M-CSF), granulocyte macrophage colony stimulating factor (GM-CSF), megakaryocyte derived growth factor (MGDF), keratinocyte growth factor (KGF), thrombopoietin, platelet-derived growth factor (PGDF), colony simulating growth factors (CSFs), bone morphogenetic protein (BMP), superoxide dismutase (SOD), tissue plasminogen activator (TPA), urokinase, streptokinase and kallikrein. [0037]
  • Transthyretin (TTR) contemplated for use in the present invention will have the DNA and amino acid sequences of TTR as reported in Mita et al., [0038] Biochem. Biophys. Res. Commun., 124(2):558-564 (1984). These sequences have been deposited in Genbank as accession number K02091. The 127 amino acid TTR sequence used herein does not include the signal sequence (amino acids 1-20) of the K02091 sequence and is depicted below as SEQ ID NO:1.
    GPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGEL SEQ ID NO:1
    HGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAAL
    LSPYSYSTTAVVTNPKE
  • The term “TTR variant” refers to a molecule or sequence that is a modified form a native TTR. For example, a native TTR comprises sites that may be removed because they provide structural features or biological activity that are not required for the fusion molecules of the present invention. Thus, the term “TTR variant” comprises a molecule or sequence that lacks one or more native TTR sites or residues or that has had one or more native TTR sites or residues replaced with a different amino acid or that has had one or more residues added to the sequence. For purposes of an example, a TTR variant wherein the Alanine residue at amino acid sequence position 37 has been replaced with a Cysteine residue, will be designated TTR variant (A37C); and a TTR variant wherein both the Alanine residue at amino acid sequence position 37 and the Glycine residue at amino acid sequence position 83 has been replaced with a Cysteine residue, will be designated TTR variant (A37C/G83C). [0039]
  • A preferred TTR or TTR variant may be chemically modified using water soluble polymers such as polyethylene glycol (PEG). The PEG group may be of any convenient molecular weight and may be straight chain or branched. The average molecular weight of the PEG will preferably range from about 2 kDa to about 100 kDa, more preferably from about 5 kDa to about 50 kDa, most preferably about 20 kDa. [0040]
  • The PEG groups will generally be attached to the compounds of the invention via acylation, reductive alkylation, Michael addition, thiol alkylation or other chemoselective conjugation/ligation methods through a reactive group on the peg moiety (e.g., an aldehyde, amino, ester, thiol, -haloacetyl, maleimido or hydrazino group) to a reactive group on the target compound (e.g., an aldehyde, amino, ester, thiol, -haloacetyl, maleimido or hydrazino group). [0041]
  • Other water soluble polymers used include copolymers of ethylene glycol/propylene glycol, carboxymethylcellulose, polyvinyl alcohol, polyvinyl pyrrolidone, poly-1,3-dioxolane, poly-1,3,6-trioxane, ethylene/maleic anhydride copolymer, polyaminoacids (either homopolymers or random copolymers), and dextran. [0042]
  • A DNA molecule encoding the peptide of interest, protein of interest, TTR or TTR variant can be prepared using well known recombinant DNA technology methods such as those set forth in Sambrook et al. ([0043] Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. [1989]) and/or Ausubel et al., eds, Current Protocols in Molecular Biology, Green Publishers Inc. and Wiley and Sons, NY (1994). A gene or cDNA encoding the protein of interest or fragment thereof may be obtained for example by screening a genomic or cDNA library with a suitable probe. Suitable probes include, for example, oligonucleotides, cDNA fragments, or genomic DNA fragments, that are expected to have some homology to the gene encoding the protein of interest, such that the probe will hybridize with the gene encoding the protein of interest under selected hybridization conditions. An alternate means of screening a DNA library is by polymerase chain reaction “PCR” amplification of the gene encoding the protein of interest. PCR is typically accomplished using oligonucleotide “primers” which have a sequence that is believed to have sufficient homology to the gene to be amplified such that at least a sufficient portion of the primer will hybridize with the gene.
  • Alternatively, a gene encoding the peptide of interest or protein of interest may be prepared by chemical synthesis using methods well known to the skilled artisan such as those described by Engels et al., [0044] Angew. Chem. Intl. Ed., 28:716-734 (1989). These methods include, inter alia, the phosphotriester, phosphoramidite, and H-phosphonate methods for nucleic acid synthesis. A preferred method for such chemical synthesis is polymer-supported synthesis using standard phosphoramidite chemistry. Typically, the DNA encoding the protein of interest will be several hundred nucleotides in length. Nucleic acids larger than about 100 nucleotides can be synthesized as several fragments using these methods. The fragments can then be ligated together to form a gene coding for the full length protein of interest. Usually, the DNA fragment encoding the amino terminus of the polypeptide will have an ATG, which encodes a methionine residue. This methionine may or may not be present on the mature form of the protein of interest. The methionine can be removed inside the cell or during the process of secretion. Preferred TTR polypeptides may include TTR with the nucleic acid sequence altered to optimize expression in E. coli and to introduce convenient restriction sites. A general discussion of codon optimization for expression in E. coli is described in Kane, Curr. Opin. Biotechnol., 6:494-500 (1995).
  • Once the genes encoding the protein of interest and the TTR polypeptide have been obtained, they may be modified using standard methods to create restriction endonuclease sites at the 5′ and/or 3′ ends. Creation of the restriction sites permits the genes to be properly inserted into amplification and/or expression vectors. Addition of restriction sites is typically accomplished using PCR, where one primer of each PCR reaction typically contains, inter alia, the nucleotide sequence of the desired restriction site. [0045]
  • The gene or cDNA encoding the peptide of interest, or protein of interest can be inserted into an appropriate expression vector for expression in a host cell. The vector is selected to be functional in the particular host cell employed (i.e., the vector is compatible with the host cell machinery such that amplification and/or expression of the gene encoding the protein of interest can occur). [0046]
  • Typically, the vectors used in any of the host cells will contain a promoter (also referred to as a “5′ flanking sequence”) and other regulatory elements as well such as an enhancer(s), an origin of replication element, a transcriptional termination element, a ribosome binding site element, a polylinker region for inserting the nucleic acid encoding the polypeptide to be expressed, and a selectable marker element. Each of these elements is discussed below. Optionally, the vector may contain a “tag” DNA sequence, i.e., an oligonucleotide sequence located at either the 5′ or 3′ end of the fusion DNA construct. The tag DNA encodes a molecule such as hexaHis, c-myc, FLAG (Invitrogen, San Diego, Calif.) or another small immunogenic sequence. When placed in the proper reading frame, this tag will be expressed along with the fusion protein, and can serve as an affinity tag for purification of the fusion protein from the host cell. Optionally, the tag can subsequently be removed from the purified fusion protein by various means such as using a selected peptidase for example. [0047]
  • The promoter may be homologous (i.e., from the same species and/or strain as the host cell), heterologous (i.e., from a species other than the host cell species or strain), hybrid (i.e., a combination of promoters from more than one source), synthetic, or it may be the native protein of interest promoter. Further, the promoter may be a constitutive or an inducible promoter. As such, the source of the promoter may be any unicellular prokaryotic or eukaryotic organism, any vertebrate or invertebrate organism, or any plant, provided that the promoter is functional in, and can be activated by, the host cell machinery. [0048]
  • The promoters useful in the vectors of this invention may be obtained by any of several methods well known in the art. Typically, promoters useful herein will have been previously identified by mapping and/or by restriction endonuclease digestion and can thus be isolated from the proper tissue source using the appropriate restriction endonucleases. In some cases, the full nucleotide sequence of the promoter may be known. Here, the promoter may be synthesized using the methods described above for nucleic acid synthesis or cloning. [0049]
  • Where all or only a portion of the promoter sequence is known, the complete promoter may be obtained using PCR and/or by screening a genomic library with suitable oligonucleotide and/or 5′ flanking sequence fragments from the same or another species. [0050]
  • Suitable promoters for practicing this invention are inducible promoters such as the lux promoter, the lac promoter, the arabinose promoter, the trp promoter, the tac promoter, the tna promoter, synthetic lambda promoters (from bacteriophage lambda), and the T5 or T7 promoters. Preferred promoters include the lux, and lac promoters. [0051]
  • The origin of replication element is typically a part of prokaryotic expression vectors whether purchased commercially or constructed by the user. In some cases, amplification of the vector to a certain copy number can be important for optimal expression of the protein or polypeptide of interest. In other cases, a constant copy number is preferred. In any case, a vector with an origin of replication that fulfills the requirements can be readily selected by the skilled artisan. If the vector of choice does not contain an origin of replication site, one may be chemically synthesized based on a known sequence, and ligated into the vector. [0052]
  • The transcription termination element is typically located 3′ of the end of the fusion protein DNA construct, and serves to terminate transcription of the RNA message coding for the fusion polypeptide. Usually, the transcription termination element in prokaryotic cells is a G-C rich fragment followed by a poly T sequence. While the element is easily cloned from a library or even purchased commercially as part of a vector, it can also be readily synthesized using methods for nucleic acid synthesis such as those described above. [0053]
  • Expression vectors typically contain a gene coding for a selectable marker. This gene encodes a protein necessary for the survival and growth of a host cell grown in a selective culture medium. Typical selection marker genes encode proteins that (a) confer resistance to antibiotics or other toxins, e.g., ampicillin, tetracycline, chloramphenicol, or kanamycin for prokaryotic host cells, (b) complement auxotrophic deficiencies of the cell; or (c) supply critical nutrients not available from complex media. Preferred selectable markers are the kanamycin resistance gene, the ampicillin resistance gene, the chloramphenicol resistance gene, and the tetracycline resistance gene. [0054]
  • The ribosome binding element, commonly called the Shine-Dalgarno sequence in prokaryotes, is necessary for the initiation of translation of mRNA. The element is typically located 3′ to the promoter and 5′ to the coding sequence of the fusion protein DNA construct. The Shine-Dalgarno sequence is varied but is typically a polypurine (i.e., having a high A-G content). Many Shine-Dalgarno sequences have been identified, each of which can be readily synthesized using methods set forth above and used in a prokaryotic vector. [0055]
  • Where one or more of the elements set forth above are not already present in the vector to be used, they may be individually obtained and ligated into the vector. Methods used for obtaining each of the elements are well known to the skilled artisan and are comparable to the methods set forth above (i.e., synthesis of the DNA, library screening, and the like). [0056]
  • Each element may be individually ligated into the vector by cutting the vector with the appropriate restriction endonuclease(s) such that the ends of the element to be ligated in and the ends of the vector are compatible for ligation. In some cases, it may be necessary to “blunt” the ends to be ligated together in order to obtain a satisfactory ligation. Blunting can be accomplished by first filling in “sticky ends” using an enzyme such as Klenow DNA polymerase or T4 DNA polymerase in the presence of all four nucleotides. This procedure is well known in the art and is described for example in Sambrook et al., supra. [0057]
  • Alternatively, two or more of the elements to be inserted into the vector may first be ligated together (if they are to be positioned adjacent to each other) and then ligated into the vector. [0058]
  • Another method for constructing the vector is to conduct all ligations of the various elements simultaneously in one reaction mixture. Here, many nonsense or nonfunctional vectors may be generated due to improper ligation or insertion of the elements, however the functional vector may be identified by expression of the selectable marker. Proper sequence of the ligation product can be confirmed by digestion with restriction endonucleases or by DNA sequencing. [0059]
  • After the vector has been constructed and a fusion protein DNA construct has been inserted into the proper site of the vector, the completed vector may be inserted into a suitable host cell for fusion protein expression. [0060]
  • Host cells suitable for the present invention are bacterial cells. For example, the various strains of [0061] E. coli (e.g., HB101, JM109, DH5α, DH10, and MC1061) are well-known host cells for use in preparing recombinant polypeptides. The choice of bacterial strain is typically made so that the strain and the expression vector to be used are compatible. Various strains of B. subtilis, Pseudomonas spp., other Bacillus spp., Streptomyces spp., and the like may also be employed in practicing this invention in conjunction with appropriate expression vectors.
  • Insertion (also referred to as “transformation” or “transfection”) of the vector into the selected host cell may be accomplished using such methods as calcium phosphate precipitation or electroporation. The method selected will in part be a function of the type of host cell to be used. These methods and other suitable methods are well known to the skilled artisan, and are set forth, for example, in Sambrook et al., supra. [0062]
  • The host cells containing the vector (i.e., transformed or transfected host cells) may be cultured using one or more standard media well known to the skilled artisan. The selected medium will typically contain all nutrients necessary for the growth and survival of the host cells. Suitable media for culturing [0063] E. coli cells, are, for example, Luria broth (“LB”), YT broth, SOB, SOC, and/or Terrific Broth (“TB”).
  • There are several ways to prepare the DNA construct encoding the fusion protein which comprises the TTR gene, the gene encoding the peptide or protein of interest, and, optionally, a DNA molecule encoding a linker peptide which is located between the two genes. [0064]
  • In one procedure, the TTR gene and gene encoding the protein of interest (the “fusion partner genes”) can be ligated together in either orientation (e.g., TTR gene at the 5′ or 3′ end of the construct). Where a linker DNA molecule is to be included, it can first be ligated to one of the fusion partner genes, and that construct can then be ligated to the other fusion partner gene. Ligations are typically accomplished using DNA ligase enzyme in accordance with the manufacturer's instructions. [0065]
  • A separate procedure provides for first ligating one fusion partner gene into the selected vector, after which the other fusion partner gene can be ligated into the vector in a position that is either 3′ or 5′ to the first fusion partner gene. Where a linker DNA molecule is to be included, the linker DNA molecule may be ligated to either fusion partner gene either before or after that gene has been ligated into the vector. [0066]
  • The TTR-TMPs of the present invention can be used to treat conditions generally known as those that involve an existing megakaryocyte/platelet deficiency or an expected megakaryocyte/platelet deficiency (e.g., because of planned surgery or platelet donation). Such conditions will usually be the result of a deficiency (temporary or permanent) of active Mpl ligand in vivo. The generic term for platelet deficiency is thrombocytopenia, and hence the methods and compositions of the present invention are generally available for treating thrombocytopenia in patients in need thereof. Thrombocytopenia (platelet deficiencies) may be present for various reasons, including chemotherapy and other therapy with a variety of drugs, radiation therapy, surgery, accidental blood loss, and other specific disease conditions. [0067]
  • Exemplary specific disease conditions that involve thrombocytopenia and may be treated in accordance with this invention are: aplastic anemia, idiopathic thrombocytopenia, metastatic tumors which result in thrombocytopenia, systemic lupus erythematosus, splenomegaly, Fanconi's syndrome, vitamin B12 deficiency, folic acid deficiency, May-Hegglin anomaly, Wiskott-Aldrich syndrome, and paroxysmal nocturnal hemoglobinuria. Also, certain treatments for AIDS result in thrombocytopenia (e.g., AZT). Certain wound healing disorders might also benefit from an increase in platelet numbers. [0068]
  • With regard to anticipated platelet deficiencies, e.g., due to future surgery, a compound of the present invention could be administered several days to several hours prior to the need for platelets. With regard to acute situations, e.g., accidental and massive blood loss, a compound of this invention could be administered along with blood or purified platelets. [0069]
  • The TMP compounds of this invention may also be useful in stimulating certain cell types other than megakaryocytes if such cells are found to express Mpl receptor. Conditions associated with such cells that express the Mpl receptor, which are responsive to stimulation by the Mpl ligand, are also within the scope of this invention. [0070]
  • The TMP compounds of this invention may be used in any situation in which production of platelets or platelet precursor cells is desired, or in which stimulation of the c-Mpl receptor is desired. Thus, for example, the compounds of this invention may be used to treat any condition in a mammal wherein there is a need of platelets, megakaryocytes, and the like. Such conditions are described in detail in the following exemplary sources: WO95/26746; WO95/21919; WO95/18858; WO95/21920 and are incorporated herein. [0071]
  • The TMP compounds of this invention may also be useful in maintaining the viability or storage life of platelets and/or megakaryocytes and related cells. Accordingly, it could be useful to include an effective amount of one or more such compounds in a composition containing such cells. [0072]
  • The therapeutic methods, compositions and compounds of the present invention may also be employed, alone or in combination with other cytokines, soluble Mpl receptor, hematopoietic factors, interleukins, growth factors or antibodies in the treatment of disease states characterized by other symptoms as well as platelet deficiencies. It is anticipated that the inventive compound will prove useful in treating some forms of thrombocytopenia in combination with general stimulators of hematopoiesis, such as IL-3 or GM-CSF. Other megakaryocytic stimulatory factors, i.e., meg-CSF, stem cell factor (SCF), leukemia inhibitory factor (LIF), oncostatin M (OSM), or other molecules with megakaryocyte stimulating activity may also be employed with Mpl ligand. Additional exemplary cytokines or hematopoietic factors for such co-administration include IL-1 alpha, IL-1 beta, IL-2, IL-3, IL-4, IL-5, IL-6, IL-11, colony stimulating factor-1 (CSF-1), SCF, GM-CSF, granulocyte colony stimulating factor (G-CSF), EPO, interferon-alpha (IFN-alpha), consensus interferon, IFN-beta, or IFN-gamma. It may further be useful to administer, either simultaneously or sequentially, an effective amount of a soluble mammalian Mpl receptor, which appears to have an effect of causing megakaryocytes to fragment into platelets once the megakaryocytes have reached mature form. Thus, administration of an inventive compound (to enhance the number of mature megakaryocytes) followed by administration of the soluble Mpl receptor (to inactivate the ligand and allow the mature megakaryocytes to produce platelets) is expected to be a particularly effective means of stimulating platelet production. The dosage recited above would be adjusted to compensate for such additional components in the therapeutic composition. Progress of the treated patient can be monitored by conventional methods. [0073]
  • The present invention also provides pharmaceutical compositions of the inventive compounds. Such pharmaceutical compositions may be for administration for injection, or for oral, nasal, transdermal or other forms of administration, including, e.g., by intravenous, intradermal, intramuscular, intramammary, intraperitoneal, intrathecal, intraocular, retrobulbar, intrapulmonary (e.g., aerosolized drugs) or subcutaneous injection (including depot administration for long term release); by sublingual, anal, vaginal, or by surgical implantation, e.g., embedded under the splenic capsule, brain, or in the cornea. The treatment may consist of a single dose or a plurality of doses over a period of time. In general, comprehended by the invention are pharmaceutical compositions comprising effective amounts of a compound of the invention together with pharmaceutically acceptable diluents, preservatives, solubilizers, emulsifiers, adjuvants and/or carriers. Such compositions include diluents of various buffer content (e.g., Tris-HCl, acetate, phosphate), pH and ionic strength; additives such as detergents and solubilizing agents (e.g., [0074] Tween 80, Polysorbate 80), anti-oxidants (e.g., ascorbic acid, sodium metabisulfite), preservatives (e.g., Thimersol, benzyl alcohol) and bulking substances (e.g., lactose, mannitol); incorporation of the material into particulate preparations of polymeric compounds such as polylactic acid, polyglycolic acid, etc. or into liposomes. Hyaluronic acid may also be used, and this may have the effect of promoting sustained duration in the circulation. The pharmaceutical compositions optionally may include still other pharmaceutically acceptable liquid, semisolid, or solid diluents that serve as pharmaceutical vehicles, excipients, or media, including but are not limited to, polyoxyethylene sorbitan monolaurate, magnesium stearate, methyl- and propylhydroxybenzoate, starches, sucrose, dextrose, gum acacia, calcium phosphate, mineral oil, cocoa butter, and oil of theobroma. Such compositions may influence the physical state, stability, rate of in vivo release, and rate of in vivo clearance of the present proteins and derivatives. See, e.g., Remington's Pharmaceutical Sciences, 18th Ed. (1990, Mack Publishing Co., Easton, Pa. 18042) pages 1435-1712 which are herein incorporated by reference. The compositions may be prepared in liquid form, or may be in dried powder, such as lyophilized form. Implantable sustained release formulations are also contemplated, as are transdermal formulations.
  • Controlled release formulation may be desirable. The drug could be incorporated into an inert matrix which permits release by either diffusion or leaching mechanisms e.g., gums. Slowly degenerating matrices may also be incorporated into the formulation, e.g., alginates, polysaccharides. Another form of a controlled release of this therapeutic is by a method based on the Oros therapeutic system (Alza Corp.), i.e., the drug is enclosed in a semipermeable membrane which allows water to enter and push drug out through a single small opening due to osmotic effects. Some enteric coatings also have a delayed release effect. [0075]
  • Also contemplated herein is pulmonary delivery of the present protein (or derivatives thereof). The protein (or derivative) is delivered to the lungs of a mammal while inhaling and traverses across the lung epithelial lining to the blood stream. (Other reports of this include Adjei et al., Pharmaceutical Research 7:565-569 (1990); Adjei et al., International Journal of Pharmaceutics 63:135-144 (1990)(leuprolide acetate); Braquet et al., Journal of Cardiovascular Pharmacology 13 (suppl.5): s.143-146 (1989)(endothelin-1); Hubbard et al., Annals of Internal Medicine 3:206-212 (1989)(1-antitrypsin); Smith et al., J. Clin. Invest. 84:1145-1146 (1989)(1-proteinase); Oswein et al., “Aerosolization of Proteins”, Proceedings of Symposium on Respiratory Drug Delivery II, Keystone, Colo., March, 1990 (recombinant human growth hormone); Debs et al., The Journal of Immunology 140:3482-3488 (1988)(interferon- and tumor necrosis factor) and Platz et al., U.S. Pat. No. 5,284,656 (granulocyte colony stimulating factor). [0076]
  • Contemplated for use in the practice of this invention are a wide range of mechanical devices designed for pulmonary delivery of therapeutic products, including but not limited to nebulizers, metered dose inhalers, and powder inhalers, all of which are familiar to those skilled in the art. [0077]
  • Some specific examples of commercially available devices suitable for the practice of this invention are the Ultravent nebulizer, manufactured by Mallinckrodt, Inc., St. Louis, Miss.; the Acorn II nebulizer, manufactured by Marquest Medical Products, Englewood, Colo.; the Ventolin metered dose inhaler, manufactured by Glaxo Inc., Research Triangle Park, N.C.; and the Spinhaler powder inhaler, manufactured by Fisons Corp., Bedford, Mass. [0078]
  • All such devices require the use of formulations suitable for the dispensing of the inventive compound. Typically, each formulation is specific to the type of device employed and may involve the use of an appropriate propellant material, in addition to diluents, adjuvants and/or carriers useful in therapy. [0079]
  • The inventive compound should most advantageously be prepared in particulate form with an average particle size of less than 10 μm (or microns), most preferably 0.5 to 5 μm, for most effective delivery to the distal lung. [0080]
  • Carriers include carbohydrates such as trehalose, mannitol, xylitol, sucrose, lactose, and sorbitol. Other ingredients for use in formulations may include DPPC, DOPE, DSPC and DOPC. Natural or synthetic surfactants may be used. Polyethylene glycol may be used (even apart from its use in derivatizing the protein or analog). Dextrans, such as cyclodextran, may be used. Bile salts and other related enhancers may be used. Cellulose and cellulose derivatives may be used. Amino acids may be used, such as use in a buffer formulation. [0081]
  • The dosage regimen involved in a method for treating the above-described conditions will be determined by the attending physician, considering various factors which modify the action of drugs, e.g. the age, condition, body weight, sex and diet of the patient, the severity of any infection, time of administration and other clinical factors. Generally, the dose should be in the range of 0.1 μg to 100 mg of the inventive compound per kilogram of body weight per day, preferably 0.1 to 1000 μg/kg; and more preferably 0.1 to 150 μg/kg, given in daily doses or in equivalent doses at longer or shorter intervals, e.g., every other day, twice weekly, weekly, or twice or three times daily. [0082]
  • The inventive compounds may be administered by an initial bolus followed by a continuous infusion to maintain therapeutic circulating levels of drug product. As another example, the inventive compounds may be administered as a one-time dose. Those of ordinary skill in the art will readily optimize effective dosages and administration regimens as determined by good medical practice and the clinical condition of the individual patient. The frequency of dosing will depend on the pharmacokinetic parameters of the agents and the route of administration. The optimal pharmaceutical formulation will be determined by one skilled in the art depending upon the route of administration and desired dosage. See for example, Remington's Pharmaceutical Sciences, 18th Ed. (1990, Mack Publishing Co., Easton, Pa. 18042) pages 1435-1712, the disclosure of which is hereby incorporated by reference. Depending on the route of administration, a suitable dose may be calculated according to body weight, body surface area or organ size. Appropriate dosages may be ascertained through use of established assays for determining blood levels dosages in conjunction with appropriate dose-response data. The final dosage regimen will be determined by the attending physician, considering various factors which modify the action of drugs, e.g. the drug's specific activity, the severity of the damage and the responsiveness of the patient, the age, condition, body weight, sex and diet of the patient, the severity of any infection, time of administration and other clinical factors. As studies are conducted, further information will emerge regarding the appropriate dosage levels and duration of treatment for various diseases and conditions. [0083]
  • The following Examples are intended for illustration purposes only, and should not be construed to limit the invention in any way. [0084]
  • EXAMPLE 1
  • This example describes the preparation of DNA for native recombinant human transthyretin (TTR) and the following TTR variants: TTR(C10A), TTR(C10A/A37C), TTR(C10A/D38C), TTR(C10A/A81C), TTR(C10A/G83C), and TTR(C10A/K15A/G83C). [0085]
  • The expression plasmid pAMG21 is available from the ATCC under accession number 98113, which was deposited on Jul. 24, 1996 (see PCT WO 97/23614, published Jul. 3, 1997 for a description of pAMG21). DNA sequence coding for TTR, TTR variants or TTR-peptide fusions was placed under control of the LuxPR promoter in pAMG21. [0086]
  • The Amgen host strain #2596 (GM221) is an [0087] E. coli K-12 strain that has been modified to contain both the temperature sensitive lambda repressor cI857s7 in the early ebg region and the lacIQ repressor in the late ebg region (68 minutes). The presence of these two repressor genes allows the use of this host with a variety of expression systems, however both of these repressors are irrelevant to the expression from luxPR. The untransformed host has no antibiotic resistances. The ribosomal binding site of the cI857s7 gene has been modified to include an enhanced RBS. It has been inserted into the ebg operon between nucleotide position 1170 and 1411 as numbered in Genbank accession number M64441Gb_Ba with deletion of the intervening ebg sequence. The construct was delivered to the chromosome using a recombinant phage called MMebg-cI857s7 enhanced RBS #4 into F'tet/393. After recombination and resolution only the chromosomal insert described above remains in the cell. It was renamed F'tet/GM101. F'tet/GM101 was then modified by the delivery of a lacIQ construct into the ebg operon between nucleotide position 2493 and 2937 as numbered in the Genbank accession number M64441Gb_Ba with the deletion of the intervening ebg sequence. The construct was delivered to the chromosome using a recombinant phage called AGebg-LacIQ#5 into F'tet/GM101. After recombination and resolution only the chromosomal insert described above remains in the cell. It was renamed F'tet/GM221. The F'tet episome was cured from the strain using acridine orange at a concentration of 25 μg/ml in LB. The cured strain was identified as tetracyline sensitive and was stored as GM221.
  • Oligonucleotides (1.0 nm each) were synthesized by phosphoramidite method. Nucleotides were, in some cases, altered for optimized expression in [0088] E. coli. These codon changes did not result in changes in the amino acid sequence. Each of the oligonucleotides utilized in this example are listed in Table 1.
  • PCR was performed with the Expand Long Polymerase according to the manufacturer's protocol (Boehringer Mannheim). PCR products were verified by agarose gel electrophoresis, purified and digested with Nde1 and Xho1 (New England Biolabs). Expression vector pAMG21 was digested in the same manner and then treated with calf intestinal phosphatase (Boehringer Mannheim). The vector and insert were purified from an agarose gel, then mixed and ligated by T4 DNA ligase (New England Biolabs). Ligation was done at 4° C. for 2 hrs. Each ligation mixture was transformed by electroporation into the host strain GM221 described above with a Biorad GenePulser (Biorad Laboratories) using 2.5V, 25 uFD, and 200 ohms in a cuvette with a gap length of about 2 mm. After electroporation, the cells were allowed to recover in 1 ml of Luria broth (LB) for about one hour at 37° C. with gentle shaking. The entire transformation mix was plated on LB agar containing 50 μg/ml kanamycin. Colonies were screened for presence of the desired molecular weight by PCR using oligonucleotides directed against flanking vector sequence. The PCR products were evaluated by agarose gel electrophoresis. Positive clones were further screened for the ability to produce the recombinant protein product and finally verified by nucleotide sequencing. [0089]
  • The DNA and amino acid sequences of TTR are known (Mita, S et al., Biochem. Biophys. Res. Commun. 124 (2), 558-564 [1984]). These sequences have been deposited in Genbank as accession number K02091. The cDNA of native TTR excluding the signal peptide was cloned from a cDNA library derived from human liver (Clontech). Specifically, an oligonucleotide encoding eight codons of the [0090] TTR 5′ (Oligo 2693-79) end and an oligonucleotide encoding seven codons of TTR 3′ end including a terminating codon (Oligo 2693-80) were synthesized and used to amplify the full-length mature TTR with Expand Long polymerase using human liver cDNA library as template. The resulting PCR fragment was digested with NdeI and XhoI, gel purified and ligated with NdeI/XhoI restricted expression vector pAMG21. After 2 hours at 4° C., the ligation mixture was electroporated into GM221 cells. Single colonies were picked and plasmid DNA was prepared and sequenced. One resulting plasmid (strain #5316) was shown to have the correct DNA sequence of native TTR (plus a methionine at the N-terminus) and was used for expression. This DNA sequence is identified in SEQ ID NO:2.
  • Mutant TTR(C10A) was made by using oligonucleotide 2693-80 above and oligonucleotide 2820-88 (encompasses the first 11 codons of native TTR in which the codon Cys at the tenth position was changed to Ala). The PCR procedure and the process for selecting the expression strain were similar to that described above. The resulting strain (strain #5619) had the DNA sequence identified in SEQ ID NO:3. [0091]
  • Plasmid 5619 was further modified by replacing the amino acids at the following positions: A37, D38, A81 and G83, with the amino acid Cysteine. As described below, each pair of the complementary oligonucleotides harboring the desired mutations was used in conjunction with [0092] TTR 5′ and 3′ primers described above in a standard two-step PCR procedure designed for site-specific mutagenesis. Each of the forward primers were used with a TTR 3′ primer and each of the reverse primers were used with a TTR 5′ primer in a 20-cycle PCR in which plasmid derived from strain 5619 was used as the template. The resulting PCR amplified 5′ and 3′ fragments were mixed and used as the template for the second step PCR to generate the full-length mutants. Subsequent cloning and sequencing procedures were similar to those already described. The following oligonucleotides were utilized: TTR(A37C) forward (Oligo 2823-91); TTR(A37C) reverse (Oligo 2823-92); TTR(D38C) forward (Oligo 2823-93); TTR(D38C) reverse (Oligo 2823-94); TTR(A81C) forward (Oligo 2823-95); TTR(A81C) reverse (Oligo 2823-96); TTR(G83C) forward (Oligo 2823-97); TTR(G83C) reverse (Oligo 2823-98). The resulting E. coli strains containing the plasmids are described as follows: TTR(C10A/A37C)(strain 5641) had the DNA sequence identified in SEQ ID NO:4. TTR(C10A/D38C)(strain 5642) had the DNA sequence identified in SEQ ID NO:5. TTR(C10A/A81C)(strain 5643) had the DNA sequence identified in SEQ ID NO:6. TTR(C10A/G83C)(strain 5651) had the DNA sequence identified in SEQ ID NO:7.
  • The Lys in the 15th position in strain 5651 was further mutagenized to Ala using oligonucleotides 2953-67 and 2953-68 by a procedure similar to that described for strains 5641, 5642, 5643 and 5651. The resulting strain, TTR(C10A/K15A/G83C)(strain 5895) had the DNA sequence identified in SEQ ID NO:8. [0093]
    TABLE 1
    SEQ ID
    Oligo Sequence Number
    2693-79 GAGGAATAACATATGGGTCCAACTGGTACCGGTGAA 18
    2693-80 CCGCGGATCCTCGAGATTATTCCTTGGGATTGGTGA 19
    2820-88 GAGGAATAACATATGGGTCCAACTGGTACCGGTGAA 20
    TCCAAGGCTCCT
    2823-91 AGAAAGGCTTGTGATGACACCTGG 21
    2823-92 CCAGGTGTCATCACAAGCCTTTCT 22
    2823-93 AGAAAGGCTGCTTGTGACACCTGG 23
    2823-94 CCAGGTGTCACAAGCAGCCTTTCT 24
    2823-95 TACTGGAAGTGTCTTGGCATCTCC 25
    2823-96 GGAGATGCCAAGACACTTCCAGTA 26
    2823-97 AAGGCACTTTGCATCTCCCCATTC 27
    2823-98 GAATGGGGAGATGCAAAGTGCCTT 28
    2953-67 CTGATGGTCGCAGTTCTAGAT 29
    2953-68 ATCTAGAACTGCGACCATCAG 30
  • EXAMPLE 2
  • This example describes the preparation of various TMP-TTR fusions. Several fusion proteins containing TTR and a TMP were prepared. Each of the oligonucleotides utilized in this example are listed in Table 2. [0094]
  • A fragment containing the TMP was first amplified from a strain harboring a plasmid encoding a full-length TMP-FC fusion (see PCT Publication No. 00/24770) using oligonucleotides 2743-96 which encodes the first 7 codons of the TMP plus a 12 [0095] nucleotide 5′ extension including a Nde1 site and 2743-97 which encodes the first 7 codons of native TTR and the last 7 codons of the TMP of interest. The resulting PCR fragment was mixed with plasmid derived from strain 5619 and the mixture was used as a template for oligonucleotide primers 2743-96 and 2693-80 to amplify full-length TMP-TTR. Similar procedures described above were used for cloning and expression. The resulting strain, TMP-TTR (strain 5513) had the DNA sequence identified in SEQ ID NO:9.
  • The TMP was then introduced to the N-terminus of strains 5641, 5642, 5643 and 5651, respectively. Plasmid 5513 was digested with Xba1, the resulting Xba1/Xba1 insert containing the TMP and the first 18 codons of TTR(C10A) was gel purified and ligated with Xba1 restricted, phosphatase treated and gel purified vector derived from 5641, 5642, 5643 and 5651. DNA sequencing was performed to select the correct orientation for each fusion. The resulting [0096] E. coli strains containing the plasmids are described as follows: TMP-TTR(C10A/A37C)(strain 5704) had the DNA sequence identified in SEQ ID NO:10. TMP-TTR(C10A/D38C) (strain 5705) had the DNA sequence identified in SEQ ID NO:11. TMP-TTR(C10A/A81C) (strain 5706) had the DNA sequence identified in SEQ ID NO:12. TMP-TTR(C10A/G83C) (strain 5707) had the DNA sequence identified in SEQ ID NO:13.
    TABLE 2
    SEQ ID
    Oligo Sequence Number
    2743-96 GAGGAATAACATATGATCGAAGGTCCGACTCTGCGT 31
    2743-97 TTCACCGGTACCAGTTGGACCTGCGCGTGCTGCAAG 32
    CCATT
  • EXAMPLE 3
  • This example describes the preparation of PTH (1-34)-TTR(C10A/K15A/G83C) fusion. Each of the oligonucleotides utilized in this example are listed in Table 3. [0097]
  • Two new oligonucleotides, oligonucleotide 2694-01, which encodes the first 7 codons of human PTH, and oligonucleotide 2694-03, which encodes the first 7 codons of TTR and amino acids 28-34 of PTH, were synthesized to make the fusion. Oligonucleotides 2694-01 and 2694-03 were used in a 20-cycle PCR procedure as described above to amplify PTH (1-34) with the TTR linker. The template for this reaction was a strain which harbors a plasmid encoding a PTH1-34-Fc fusion (see PCT Publication No. 01/81415). The resulting PCR mixture was combined with strain 5895 and used as the template to amplify the full length PTH (1-34)-TTR(C10A/K15A/G83C) using primers 2694-01 and 2693-80. After sequence confirmation, the resulting expression strain containing the new plasmid was designated PTH-TTR(C10A/K15A/G83C) (strain 5933) and had the DNA sequence identified in SEQ ID NO:14. [0098]
    TABLE 3
    SEQ ID
    Oligo Sequence Number
    2694-01 GAGGAATAACATATGTCTGTTTCTGAAATCCAG 33
    2694-03 TTCACCGGTACCAGTTGGACCAAAGTTATGAACGTC 34
  • EXAMPLE 4
  • This example describes the preparation of an IL-1ra-TTR(C10A) fusion and a TTR(C10A)-GSGS-IL-1ra fusion. Each of the oligonucleotides utilized in this example are listed in Table 4. [0099]
  • To prepare the IL-1ra-TTR(C10A) fusion, two oligonucleotides, oligonucleotide 2823-13, which encodes the first 7 codons of the human protein IL-1ra, and oligonucleotide 2823-14, which encodes the last 7 amino acids of IL-1ra and the first 7 amino acids of TTR, were synthesized. The plasmid derived from a strain which expresses IL-1ra (see PCT Publication No. 91/08285) was amplified using oligonucleotides 2823-13 and 2823-14. The resulting PCR product was mixed with plasmid purified from strain 5619 and used as a template to amplify full-length IL-1-ra-TTR(C10A) using oligonucleotide primers 2823-13 and 2693-80. The PCR product was cloned, sequenced and expressed as described above. The resultant strain containing the new plasmid was designated IL-1ra -TTR(C10A) (strain 5644) and had the DNA sequence identified in SEQ ID NO:15. [0100]
  • To make TTR(C10A)-IL-1ra, the following two oligonucleotides, oligonucleotide 2787-32, which encodes the last 7 amino acids of TTR, the first 7 amino acids of IL-1-ra between which a GSGS linker was introduced, and oligonucleotide 2787-33, which encodes the last 7 codons of IL-1-ra, were synthesized. These two oligonucleotide primers were used to amplify plasmid 2693, and the resulting PCR product was mixed with plasmid 5619, and together these were used as a template to amplify full-length TTR(C10A)-IL-1ra using primers 2787-33 and 2693-79. The PCR product was cloned, sequenced and expressed as described above. The resultant strain containing the new plasmid was designated TTR(C10A)-IL-1ra (strain 5645) and had the DNA sequence identified in SEQ ID NO:16. [0101]
    TABLE 4
    SEQ ID
    Oligo Sequence Number
    2823-13 GAGGAATAACATATGCGACCGTCCGGACGTAA 35
    2823-14 TTCTACTTCCAGGAAGACGAAGGTCCAACTGGTACC 36
    2787-32 GTCGTCACCAATCCCAAGGAAGGTAGTGGTAGCCGA 37
    CCGTCCGGCCGTAAGAGC
    2787-33 CCGCGGATCCTCGAGATTATTCGTCTTCCTGGAAGT 38
    AGAA
  • EXAMPLE 5
  • This example describes the preparation of TTR(C10A/G83C)-Bradykinin. Each of the oligonucleotides utilized in this example are listed in Table 5. [0102]
  • Plasmid purified from strain 5651 was used for PCR with oligonucleotide primer 2693-79 and oligonucleotide primer 2943-47, which is a [0103] TTR 3′ primer containing a PstI restriction site. This PCR product was gel purified and restriction digested with NdeI and PstI. The resulting DNA fragment was used in a ligation mixture containing AMG21, digested with NdeI and XhoI, and the annealed oligonucleotide linkers 2943-48, which encodes the GSGSG linker, and oligonucleotide 2943-49, which encodes the Bradykinin antagonist peptide KRPPGFSPL with PstI 5′ and XhoI 3′ overlapping ends. GM121 was transformed with this ligation product and DNA was purified from the kanamycin resistant colonies. The DNA sequence was then confirmed in the resistant colonies. The confirmed strain was grown at 30° C. and induced for expression in a 10-liter fermentation described below. The new strain was designated TTR(C10A/G83C)-Bradykinin (strain 5914) and had the DNA sequence identified in SEQ ID NO:17.
    TABLE 5
    SEQ
    ID
    Num-
    Oligo Sequence ber
    2693-79 GAGGAATAACATATGGGTCCAACTGGTACCGGTGAA 39
    2943-47 AATATACTGCAGTGGTGGAATAGGAG 40
    2943-48 GTCGTCACCAATCCCAAGGAAGGATCAGGATCCGGA 41
    AAACGTCCGCCGGGTTTCTCCCCGCTGTAATC
    2943-49 TCGAGATTACAGCGGGGAGAAACCCGGCGGACGTTTT 42
    CCGGATCCTGATCCTTCCTTGGGATTGGTGACGACTG
    CA
  • EXAMPLE 6
  • This example describes the recombinant expression of TTR and the TTR fusion constructs in [0104] E. coli. Each of the newly constructed TTR or TTR fusions were first examined for soluble expression at temperatures ranging from 16° C. to 37° C. For this purpose, cultures (25 ml) of GM221 expressing each of the TTR or TTR fusions were grown in LB medium supplemented with 50 μg/ml kanamycin at 37° C. until the optical density (OD) at 600 nm reached 0.5 to 1.0. The cultures were then placed in shakers with temperature settings at 16° C., 20° C., 25° C., 30° C., 34° C. and 37° C., respectively. The induction of gene product expression from the luxPR promoter was achieved following the addition of the synthetic autoinducer N-(3-oxohexanoyl)-DL-homoserine lactone to the culture media to a final concentration of 20 ng/ml. After 6 hours, the bacterial cultures were examined by microscopy for the presence of inclusion bodies. Often soluble or partial soluble expression could be achieved by growing the cultures at temperatures lower than 30° C. for TTR and its fusions, and this temperature was used for large-scale expression. In cases where soluble expression could not be achieved, temperatures at which the level of expression was at the highest were used for large-scale shakers or fermentors.
  • Large-scale expression was normally done in 4 liter flasks. Four to eight 4 liter shakers containing 1 liter of LB was inoculated with overnight cultures of TTR or its fusion strains. Expression was done essentially as described above. Cells were collected by centrifugation. [0105]
  • The fermentation stage, employing aseptic technique, begins with the inoculation from a seed culture of strains produced in a shake flask containing 500 mL of sterilized Luria broth. When this culture obtained the appropriate cell density (0.8-2 at 600 nm), the contents were used to inoculate a 20 liter fermentor containing 10 liter of complex based growth medium. The fermentor is maintained at 30° C. and [0106] pH 7 with dissolved oxygen levels kept at 30% saturation. When the cell density reached an optical density of 10-12 OD units at 600 nm, at which point the culture was induced by the addition of N-(3-oxo-hexanoyl) homoserine lactone. At 6 hours post-induction the cells were harvested from the fermentor by centrifugation.
  • EXAMPLE 7
  • This example describes the purification of TTR(C10A/G83C)-Bradykinin. About 193 g of [0107] E. coli paste from clone 5914 stored at −80° C. was defrosted in 1447 ml of 50 mM tris HCl, 5 mM EDTA, pH 8.0. 50 tablets of Sigma protease inhibitor cocktail 1-873-580 (Saint Louis, Mo.) was dissolved in the cell suspension and the suspension was passed through a model 110-Y microfluidizer (Microfluidics, Newton, Mass.) twice at 12,000 PSI. The lysate (FIG. 1, Lane 2) was centrifuged at 11,325×g for 50 min 4° C. The supernatant was removed as the soluble fraction. The soluble fraction was heated in a 65° C. water bath for 30 minutes in polypropylene bottles, at which time the temperature of the contents was 63° C. The soluble fraction was centrifuged at 11,325×g for 50 minutes 4° C. The supernatant was removed as Heat Soluble (FIG. 1, Lane 3). The heat soluble fraction was filtered through a 0.45 μm cellulose acetate filter with two prefilters and then loaded on to a 240 ml Q-sepharose fast flow (5 cm ID) column (Amersham Pharmacia Biotech, Piscataway, N.J.) at 20 ml/min equilibrated in Q-Buffer A (20 mM tris HCl, 2.5 mM EDTA, pH 8.0) at room temperature (about 23° C.). Column was washed with about 2300 ml Q-Buffer A at 20 ml/min. Q-column was eluted with a 15 column volume linear gradient to 60% Q-Buffer B (20 mM tris HCl, 1 M NaCl, 2.5 mM EDTA, pH 8.0) followed by a 2 column volume step to 100% Q-Buffer B. Fractions containing the TTR fusion as determined by SDS-PAGE were pooled into a single Q-pool (1150 ml) (FIG. 1, Lane 4) and 1.77 g of DTT was added. The Q-pool was gently stirred for 30 min at room temperature (about 23° C.). To the Q-pool, 410 ml of 3.8 M ammonium sulfate pH 7.0 was slowly added and the pH was lowered from about 7.5 to 7.0 by slow addition of 1 M HCl. About one-half of the Q-pool was then loaded on to an 84 ml phenyl sepharose high performance column (2.6 cm ID) (Amersham Pharmacia Biotech) in P-Buffer A (50 mM NaH2PO4, 1 M ammonium sulfate, pH 7.0) at 10 ml/min. The column was washed with about 170 ml P-Buffer A followed by three step elutions using 50%, 80%, and 100% P-Buffer B (50 mM NaH2PO4, pH 7.0). The remaining half of the Q-pool was then processed using the same protocol as the first half. Fractions containing the TTR fusion as determined by SDS-PAGE were pooled into a single P-pool (260 ml) (FIG. 1, Lane 5) and the P-pool was dialyzed against 4 L of HA-Buffer A (10 mM NaH2PO4, pH 7.0) for 2 hours at room temperature (about 23° C.) using 20.4 mm diameter 8 kDa cutoff dialysis tubing (Spectrum Laboratories Inc., Rancho Dominguez, Calif.). The dialysis buffer was changed with a fresh 4 L of HA-Buffer A and dialysis was continued for approximately an additional 15 hours. The P-pool was removed from dialysis and 600 μl of 1 M DTT was added followed by incubation at room temperature (about 23° C.) for about 1 hour. P-pool was loaded on to a 105 ml (2.6 cm) type 1 ceramic hydroxyapatite column (Bio-Rad Inc., Hercules, Calif.) at 10 ml/min in HA-Buffer A. Column was washed with approximately 210 ml HA-Buffer A at 10 ml/min followed by 4 steps of 12.5%, 25%, 50%, and 100% HA-Buffer B (400 mM NaH2PO4, pH 7.0). The flowthrough was pooled as HA-pool (340 ml) (FIG. 1, Lane 6) and 524 mg of DTT was added followed by incubation at room temperature (about 23° C.) for 1 hour. About one-half of the HA-pool was loaded on to a 47 ml source 15Q (2.6 cm ID) column (Amersham Pharmacia Biotech) at 10 ml/min followed by a wash with about 250 ml Q-Buffer A. Column was eluted with a 20 column volume linear gradient from 10% to 50% Q-Buffer B followed a step of 2 column volumes of 100% Q-Buffer B. The remaining half of the HA-Pool was then processed using the same protocol as the first half. Fractions containing the TTR fusion as determined by SDS-PAGE were pooled into a single Q2-pool (260 ml) and concentrated to about 75 ml using a stirred cell with a 10 kDa membrane. Q2-pool (FIG. 1, Lane 7) was then filtered through a 0.22 μm cellulose acetate filter and the protein concentration was determined to be 16.9 mg/ml using a calculated extinction coefficient of 18,450 M−1 cm−1. The pyrogen level was determined to be <1 EU/mg of protein using the Limulus Ameboycyte Lysate assay (Associates of Cape Cod, Falmouth, Mass.). The nucleic acid content was determined to be negligible, since the ratio of the absorbance at 260 nm over 280 nm was determined to be 0.52.
  • EXAMPLE 8
  • This example demonstrates that fusing a peptide to either the C-terminus or N-terminus of TTR(C10A/G83C) does not have a significant impact on its oligomeric structure. TTR(C10A/G83C), PTH-TTR(C10A/K15A/G83C), and TTR(C10A/G83C)-Bradykinin in 20 mM tris pH 8.0 and about 250 mM NaCl were reduced with 9 mM DTT for about 1 hour at room temperature (about 23° C.). About 50 μg of the reduced TTR was injected on to a Biosep-Sec-[0108] S 3000 column (7.8 mm ID×300 mm) (Phenomenex, Torrance, Calif.) in SEC-Buffer (50 mM NaH2PO4, 500 mM NaCl, pH 6.7) at 1 ml/min. Bio-Rad molecular weight standards (151-1901) were used to calibrate the column and calculate the approximate molecular size of the injected samples. As can be seen in FIG. 2, TTR(C10A/G83C) eluted at approximately 8.8 min corresponding to a molecular size of 49 kDa, which is comparable to the calculated molecular weight of the tetramer at 55 kDa. PTH-TTR(C10A/K15A/G83C) eluted at about 8.6 min corresponding to a molecular size of 67 kDa, which is close to the calculated 71 kDa for the tetramer. TTR(C10A/G83C)-Bradykinin eluted at about 8.7 min corresponding to a molecular size of 57 kDa, which is also close to the calculated 60 kDa for the tetramer.
  • EXAMPLE 9
  • This example demonstrates that fusing a protein containing disulfide bonds to either the C-terminus or N-terminus of TTR(C10A) does not have a significant impact on its oligomeric structure. About 50 μg each of TTR(C10A), IL-1-ra-TTR(C10A), and TTR(C10A)-IL-1-ra was injected on to a Biosep-Sec-[0109] S 3000 column (7.8 mm ID×300 mm) (Phenomenex) in SEC-Buffer at 1 ml/min. Bio-Rad molecular weight standards (151-1901) were used to calibrate the column and calculate the approximate molecular weight of the injected samples. As can be seen in FIG. 3, TTR(C10A) elutes at approximately 8.8 min, which corresponds to a molecular size of 49 kDa which is comparable to the calculated molecular weight of the tetramer at 55 kDa. The IL-1-ra-TTR(C10A) fusion eluted at about 7.9 min corresponding to a molecular size of 188 kDa, which is noticeably larger than that expected for the tetramer at 124 kDa. Similarly, TTR(C10A)-IL-1-ra eluted at about 7.9 min, again corresponding to a molecular size of 188 kDa compared to the 124 kDa expected for the tetramer. These size discrepancies are likely due to differences in the shape of the molecule, since size exclusion chromatography is shape dependant and the standards are calibrated for globular proteins.
  • EXAMPLE 10
  • This example compares the binding of a TMP sequence fused to the carboxy-terminus of human immunoglobulin Fc (Fc-TMP) and TMP(m)-TTR to soluble human myeloproliferative leukemia (MPL) receptor. In addition, this example shows the effect of pegylation of the native TTR cysteine on the binding of the TMP fusion to the MPL receptor. The preparation of the pegylated TTR fusions is described in detail in Example 13. [0110]
  • For this example, human MPL receptor was covalently bound to a BIAcore CM5 chip at R[0111] L=1300 RU using the EDC/NHS chemistry as per the manufacturer's instructions (BIAcore, Uppsula, Sweden). All samples were passed over the chip at 50 μl/min in Dulbecco's PBS (Gibco BRL, Gaithersburg, Md.) with 0.1 mg/ml bovine serum albumin and 0.005% P20 (polyoxyethylenesorbitan). The equilibrium endpoint was taken 3 min post injection. As can be seen in FIG. 4, Fc-TMP shows superior binding characteristics compared to TMP(m)-TTR. Further, this figure demonstrates that pegylation of the native TTR cysteine (Cys 10) interferes with the binding of TMP to the MPL receptor. The binding of TMP(m)-TTR-PEG5K showed a significantly repressed binding response compared to its non-pegylated counterpart, and TMP(m)-TTR-PEG20K showed an even more severe inhibition. This indicates that the presence of PEG on cysteine 10 likely causes steric interference for binding of the fused TMP to the MPL receptor, and larger PEGs produce more interference.
  • EXAMPLE 11
  • This example shows the effect of injecting TMP(m)-TTR into mice on blood platelet count. For this example 50 BDF1 mice (Charles River Laboratories, Wilmington, Mass.) were split into 5 groups and injected (day 0) subcutaneously with either diluting agent (Dulbecco's PBS with 0.1% bovine serum albumin) or diluting agent with 50 μg test protein per kg animal. Each group was divided in half and bled (140 μl) from the retro-orbital sinus on alternate time points ([0112] day 0, 3, 5, 7, 11, 12, 14, and 17). Mice were anesthetized with isoflurane prior to bleeding. The collected blood was analyzed for a complete and differential count using an ADVIA 120 automated blood analyzer with murine software (Bayer Diagnostics, New York, N.Y.). As seen in FIG. 5, Fc-TMP showed the greatest response with platelet count peaking at 4.3×1012 platelets L−1 on day 5, which is over 3.4 times baseline at 1.2×1012 platelets L−1. TMP(m)-TTR-PEG 5K was a moderate responder peaking at 2.3×1012 platelets L−1 which is just under twice the baseline level. The non-pegylated form of TMP(m)-TTR shows very little response at 1.5×1012 platelets L−1 which is only 20% over the baseline level. The non-pegylated form of TMP(m)-TTR shows better binding in vitro than its pegylated counterparts (FIG. 4), but it has poor performance in vivo compared to TMP(m)-TTR-PEG 5K. This indicates that PEG is required to improve the biological half-life of the TTR construct, and this more than compensates for the reduced affinity for the receptor.
  • EXAMPLE 12
  • This example demonstrates that mutation of [0113] cysteine 10 on TTR to alanine TTR(C10A) does not have a significant impact on its oligomeric structure. About 50 μg each of TTR and TTR(C10A) was injected on to a Biosep-Sec-S 3000 column (7.8 mm ID×300 mm) (Phenomenex) in SEC-Buffer at 1 ml/min. Bio-Rad molecular weight standards (151-1901) were used to calibrate the column and calculate the approximate molecular size of the injected samples. As can be seen in FIG. 6, TTR(C10A) elutes at approximately 8.8 min, which corresponds to a molecular size of 57 kDa which is similar to the calculated molecular weight of the tetramer at 55 kDa. This data combined with the observation that both forms of TTR are resistant to precipitation at 65° C. (data not shown) indicates that mutation of cysteine 10 to alanine does not have a significant impact on the structure or stability of TTR.
  • EXAMPLE 13
  • This example demonstrates that mutation of alanine 37 to cysteine TMP-TTR(C10A/A37C), aspartate 38 to cysteine TMP-TTR(C10A/D38C), alanine 81 to cysteine TMP-TTR(C10A/A81C), or glycine 83 to cysteine TMP-TTR(C10A/G83C) in a [0114] cysteine 10 to alanine background does not have a significant impact on the oligomeric structure of TTR. In addition, this example demonstrates that pegylation of these mutant forms of TTR with a 5K or 20K PEG produces two distinct species of TTR with significantly greater molecular size than the unpegylated form. The pegylation of TTR was carried out by first reducing about 8 ml of the TTR (7.28 mg/ml) with 10 mM DTT for 30 minutes at 30° C. in the presence of 50 mM tris HCl, pH 8.5. The reduced TTR was then desalted using a 26 ml sephadex G25 medium column (2.6 cm ID) (Amersham Pharmacia Biotech) at 2.5 ml/min in 20 mM tris HCl, pH 8.5. The concentration was then determined by measuring the absorbance of the reduced TTR at 280 nm and using the calculated extinction coefficient (29,450 M−1 for TMP-TTR(C10A/A37C) (5.14 mg/ml). One-half (4.6 ml) of the reduced sample was then immediately mixed with 810 μl of 5 mM methoxy-PEG-maleimide 5K (Shearwater Corporation, Huntsville, Ala.) and the remaining half was mixed with 1620 μl 2.5 mM methoxy-PEG-maleimide 20K (Shearwater Corporation). The reaction was allowed to proceed at 30° C. for 30 min and was quenched by the addition of 46 μl 1 M DTT. Each pegylated sample was then loaded on to a 5 ml HiTrap Q-sepharose column at 2.5 ml/min and washed with several column volumes of Q-Buffer A (20 mM tris HCl, pH 8.0) at 5 ml/min. The columns were eluted with a linear gradient to 40% Q-Buffer B (20 mM tris HCl, 1 M NaCl, pH 8.0) followed by a 2 column volume step to 100% Q-Buffer B. Peak fractions were pooled and the concentration determined by measuring the absorbance of the pool at 280 nm. About 50 μg of each sample was injected on to a Biosep-Sec-S 3000 column (7.8 mm ID×300 mm) (Phenomenex) in SEC-Buffer at 1 ml/min. Bio-Rad molecular weight standards (151-1901) were used to calibrate the column and calculate the approximate molecular size of the injected samples. As can be seen in FIG. 7, the apparent molecular size of the 4 non-pegylated TMP-TTR constructs is between 40 and 45 kDa which is noticeably lower than the expected 70 kDa tetramer. This retarded elution time is likely due to a slight interaction of the TMP-TTR construct with the size exclusion resin, which has been observed with several other TMP constructs (data not shown). After conjugation with the 5K PEG, the apparent molecular size increases to between 421 and 428 kDa (1.53-1.64 minutes more advanced elution than the unpegylated counterparts), which is much greater than the expected 90 kDa. The observation of an exaggerated molecular weight of pegylated molecules on size exclusion chromatography is frequently observed phenomenon (data not shown). The 20K PEG constructs elute earlier than the largest calibration standard (670 kDa) showing a 1.28-1.40 minutes more advanced elution than their 5K pegylated counterparts. This data taken together demonstrates that all 4 engineered mutant forms of TMP-TTR can be pegylated drastically increasing their apparent molecular size.
  • About 2 μg of the pegylated TMP-TTR constructs were analyzed by SDS-PAGE (FIG. 8). This figure demonstrates by gel shift that most of the TMP-TTR monomers were modified by only one methoxy-PEG-malemide, and the reaction was nearly complete leaving very little unmodified monomer. [0115]
  • EXAMPLE 14
  • This example demonstrates that Fc-TMP, TMP-TTR(C10A/A37C), TMP-TTR(C10A/D38C), TMP-TTR(C10A/A81C), and TMP-TTR(C10A/G83C) have similar affinities for binding human MPL receptor in vitro. For this example, FC-TMP was bound to a BIAcore protein G chip at high density as per the manufacturer's instructions (BIAcore, Uppsula, Sweden). Test proteins were preincubated with 5 nM MPL receptor in Binding Buffer (Dulbecco's PBS (Gibco BRL, Gaithersburg, Md.) with 0.1 mg/ml bovine serum albumin and 0.005% P20 (polyoxyethylenesorbitan) for >2 hours at room temperature (about 23° C.). For non-pegylated proteins, 0.1 mg/ml heparin was added to prevent non-specific binding. All samples were then passed over the chip at 50 μl/min in Binding Buffer. The equilibrium endpoint was taken 3 min post injection. As can be seen in FIG. 9, all TTR constructs showed similar affinity for the MPL receptor with affinities ranging from 0.881 to 2.333 nm, while the Fc-TMP construct had affinities ranging from 3.276 to 5.369 nm. [0116]
  • EXAMPLE 15
  • This example shows the effect of injecting pegylated TMP-TTR constructs into mice on blood platelet count. For this example 170 BDF1 mice were split into 17 groups and injected (day 0) subcutaneously with 50 μg test protein per kg animal (TMP fusion construct, Fc-TMP, or a TTR(C10A) control). Each group was divided in half and bled (140 μl) from the retro-orbital sinus on alternate time points ([0117] day 0, 3, 5, 7, 10, 12, and 14). Mice were anesthetized with isoflurane prior to bleeding. The collected blood was analyzed for a complete and differential count using an ADVIA 120 automated blood analyzer with murine software (Bayer Diagnostics, New York, N.Y.). As seen in FIG. 10A, Fc-TMP showed the greatest response with platelet count rising to over 4.2×1012 platelets L−1 on day 5 which is 3 times baseline at 1.4×1012 platelets L−1. All 4 of the non-pegylated TMP-TTR constructs preformed better than the control, but not as well as Fc-TMP with platelet counts between 1.8 and 2.9×1012 platelets L−1 on day 5, which is between a 29% and 107% improvement over baseline. As can be seen in FIG. 10B, addition of a 5K PEG group to the engineered cysteine of all 4 TMP-TTR constructs substantially improves efficacy with platelet counts between 3.7 and 4.4×1012 platelets L−1 (2.8 to 3.4 times baseline). Also as can be seen in FIG. 10C, conjugation of a 20K PEG to TMP-TTR results in an additional, but less dramatic improvement in efficacy with platelet counts between 4.2 and 4.6×1012 platelets L−1 (3.2 to 3.5 times baseline). Since all of the TMP fusion constructs had similar binding affinities for MPL in vitro, this difference is likely due to the effect of PEG conjugation increasing the effective biological half-life of the construct.
  • 1 42 1 127 PRT Homo sapiens 1 Gly Pro Thr Gly Thr Gly Glu Ser Lys Cys Pro Leu Met Val Lys Val 1 5 10 15 Leu Asp Ala Val Arg Gly Ser Pro Ala Ile Asn Val Ala Val His Val 20 25 30 Phe Arg Lys Ala Ala Asp Asp Thr Trp Glu Pro Phe Ala Ser Gly Lys 35 40 45 Thr Ser Glu Ser Gly Glu Leu His Gly Leu Thr Thr Glu Glu Glu Phe 50 55 60 Val Glu Gly Ile Tyr Lys Val Glu Ile Asp Thr Lys Ser Tyr Trp Lys 65 70 75 80 Ala Leu Gly Ile Ser Pro Phe His Glu His Ala Glu Val Val Phe Thr 85 90 95 Ala Asn Asp Ser Gly Pro Arg Arg Tyr Thr Ile Ala Ala Leu Leu Ser 100 105 110 Pro Tyr Ser Tyr Ser Thr Thr Ala Val Val Thr Asn Pro Lys Glu 115 120 125 2 387 DNA Homo sapiens 2 agtggtccaa ctggtaccgg tgaatccaag tgtcctctga tggtcaaagt tctagatgct 60 gtccgaggca gtcctgccat caatgtggcc gtgcatgtgt tcagaaaggc tgctgatgac 120 acctgggagc catttgcctc tgggaaaacc agtgagtctg gagagctgca tgggctcaca 180 actgaggagg aatttgtaga agggatatac aaagtggaaa tagacaccaa atcttactgg 240 aaggcacttg gcatctcccc attccatgag catgcagagg tggtattcac agccaacgac 300 tccggccccc gccgctacac cattgccgcc ctgctgagcc cctactccta ttccaccacg 360 gctgtcgtca ccaatcccaa ggaataa 387 3 387 DNA Homo sapiens 3 atgggtccaa ctggtaccgg tgaatccaag gctcctctga tggtcaaagt tctagatgct 60 gtccgaggca gtcctgccat caatgtggcc gtgcatgtgt tcagaaaggc tgctgatgac 120 acctgggagc catttgcctc tgggaaaacc agtgagtctg gagagctgca tgggctcaca 180 actgaggagg aatttgtaga agggatatac aaagtggaaa tagacaccaa atcttactgg 240 aaggcacttg gcatctcccc attccatgag catgcagagg tggtattcac agccaacgac 300 tccggccccc gccgctacac cattgccgcc ctgctgagcc cctactccta ttccaccacg 360 gctgtcgtca ccaatcccaa ggaataa 387 4 387 DNA Homo sapiens 4 atgggtccaa ctggtaccgg tgaatccaag gctcctctga tggtcaaagt tctagatgct 60 gtccgaggca gtcctgccat caatgtggcc gtgcatgtgt tcagaaaggc ttgtgatgac 120 acctgggagc catttgcctc tgggaaaacc agtgagtctg gagagctgca tgggctcaca 180 actgaggagg aatttgtaga agggatatac aaagtggaaa tagacaccaa atcttactgg 240 aaggcacttg gcatctcccc attccatgag catgcagagg tggtattcac agccaacgac 300 tccggccccc gccgctacac cattgccgcc ctgctgagcc cctactccta ttccaccacg 360 gctgtcgtca ccaatcccaa ggaataa 387 5 387 DNA Homo sapiens 5 atgggtccaa ctggtaccgg tgaatccaag gctcctctga tggtcaaagt tctagatgct 60 gtccgaggca gtcctgccat caatgtggcc gtgcatgtgt tcagaaaggc tgcttgtgac 120 acctgggagc catttgcctc tgggaaaacc agtgagtctg gagagctgca tgggctcaca 180 actgaggagg aatttgtaga agggatatac aaagtggaaa tagacaccaa atcttactgg 240 aaggcacttg gcatctcccc attccatgag catgcagagg tggtattcac agccaacgac 300 tccggccccc gccgctacac cattgccgcc ctgctgagcc cctactccta ttccaccacg 360 gctgtcgtca ccaatcccaa ggaataa 387 6 387 DNA Homo sapiens 6 atgggtccaa ctggtaccgg tgaatccaag gctcctctga tggtcaaagt tctagatgct 60 gtccgaggca gtcctgccat caatgtggcc gtgcatgtgt tcagaaaggc tgctgatgac 120 acctgggagc catttgcctc tgggaaaacc agtgagtctg gagagctgca tgggctcaca 180 actgaggagg aatttgtaga agggatatac aaagtggaaa tagacaccaa atcttactgg 240 aagtgtcttg gcatctcccc attccatgag catgcagagg tggtattcac agccaacgac 300 tccggccccc gccgctacac cattgccgcc ctgctgagcc cctactccta ttccaccacg 360 gctgtcgtca ccaatcccaa ggaataa 387 7 387 DNA Homo sapiens 7 atgggtccaa ctggtaccgg tgaatccaag gctcctctga tggtcaaagt tctagatgct 60 gtccgaggca gtcctgccat caatgtggcc gtgcatgtgt tcagaaaggc tgctgatgac 120 acctgggagc catttgcctc tgggaaaacc agtgagtctg gagagctgca tgggctcaca 180 actgaggagg aatttgtaga agggatatac aaagtggaaa tagacaccaa atcttactgg 240 aaggcacttt gcatctcccc attccatgag catgcagagg tggtattcac agccaacgac 300 tccggccccc gccgctacac cattgccgcc ctgctgagcc cctactccta ttccaccacg 360 gctgtcgtca ccaatcccaa ggaataa 387 8 387 DNA Homo sapiens 8 atgggtccaa ctggtaccgg tgaatccaag gctcctctga tggtcgcagt tctagatgct 60 gtccgaggca gtcctgccat caatgtggcc gtgcatgtgt tcagaaaggc tgctgatgac 120 acctgggagc catttgcctc tgggaaaacc agtgagtctg gagagctgca tgggctcaca 180 actgaggagg aatttgtaga agggatatac aaagtggaaa tagacaccaa atcttactgg 240 aaggcacttt gcatctcccc attccatgag catgcagagg tggtattcac agccaacgac 300 tccggccccc gccgctacac cattgccgcc ctgctgagcc cctactccta ttccaccacg 360 gctgtcgtca ccaatcccaa ggaataa 387 9 495 DNA Homo sapiens 9 atgatcgaag gtccgactct gcgtcagtgg ctggctgctc gtgctggcgg tggtggcgga 60 gggggtggca ttgagggccc aacccttcgc caatggcttg cagcacgcgc aggtccaact 120 ggtaccggtg aatccaagtg tcctctgatg gtcaaagttc tagatgctgt ccgaggcagt 180 cctgccatca atgtggccgt gcatgtgttc agaaaggctg ctgatgacac ctgggagcca 240 tttgcctctg ggaaaaccag tgagtctgga gagctgcatg ggctcacaac tgaggaggaa 300 tttgtagaag ggatatacaa agtggaaata gacaccaaat cttactggaa ggcacttggc 360 atctccccat tccatgagca tgcagaggtg gtattcacag ccaacgactc cggcccccgc 420 cgctacacca ttgccgccct gctgagcccc tactcctatt ccaccacggc tgtcgtcacc 480 aatcccaagg aataa 495 10 495 DNA Homo sapiens 10 atgatcgaag gtccgactct gcgtcagtgg ctggctgctc gtgctggcgg tggtggcgga 60 gggggtggca ttgagggccc aacccttcgc caatggcttg cagcacgcgc aggtccaact 120 ggtaccggtg aatccaaggc tcctctgatg gtcaaagttc tagatgctgt ccgaggcagt 180 cctgccatca atgtggccgt gcatgtgttc agaaaggctt gtgatgacac ctgggagcca 240 tttgcctctg ggaaaaccag tgagtctgga gagctgcatg ggctcacaac tgaggaggaa 300 tttgtagaag ggatatacaa agtggaaata gacaccaaat cttactggaa ggcacttggc 360 atctccccat tccatgagca tgcagaggtg gtattcacag ccaacgactc cggcccccgc 420 cgctacacca ttgccgccct gctgagcccc tactcctatt ccaccacggc tgtcgtcacc 480 aatcccaagg aataa 495 11 495 DNA Homo sapiens 11 atgatcgaag gtccgactct gcgtcagtgg ctggctgctc gtgctggcgg tggtggcgga 60 gggggtggca ttgagggccc aacccttcgc caatggcttg cagcacgcgc aggtccaact 120 ggtaccggtg aatccaaggc tcctctgatg gtcaaagttc tagatgctgt ccgaggcagt 180 cctgccatca atgtggccgt gcatgtgttc agaaaggctg cttgtgacac ctgggagcca 240 tttgcctctg ggaaaaccag tgagtctgga gagctgcatg ggctcacaac tgaggaggaa 300 tttgtagaag ggatatacaa agtggaaata gacaccaaat cttactggaa ggcacttggc 360 atctccccat tccatgagca tgcagaggtg gtattcacag ccaacgactc cggcccccgc 420 cgctacacca ttgccgccct gctgagcccc tactcctatt ccaccacggc tgtcgtcacc 480 aatcccaagg aataa 495 12 495 DNA Homo sapiens 12 atgatcgaag gtccgactct gcgtcagtgg ctggctgctc gtgctggcgg tggtggcgga 60 gggggtggca ttgagggccc aacccttcgc caatggcttg cagcacgcgc aggtccaact 120 ggtaccggtg aatccaaggc tcctctgatg gtcaaagttc tagatgctgt ccgaggcagt 180 cctgccatca atgtggccgt gcatgtgttc agaaaggctg ctgatgacac ctgggagcca 240 tttgcctctg ggaaaaccag tgagtctgga gagctgcatg ggctcacaac tgaggaggaa 300 tttgtagaag ggatatacaa agtggaaata gacaccaaat cttactggaa gtgtcttggc 360 atctccccat tccatgagca tgcagaggtg gtattcacag ccaacgactc cggcccccgc 420 cgctacacca ttgccgccct gctgagcccc tactcctatt ccaccacggc tgtcgtcacc 480 aatcccaagg aataa 495 13 495 DNA Homo sapiens 13 atgatcgaag gtccgactct gcgtcagtgg ctggctgctc gtgctggcgg tggtggcgga 60 gggggtggca ttgagggccc aacccttcgc caatggcttg cagcacgcgc aggtccaact 120 ggtaccggtg aatccaaggc tcctctgatg gtcaaagttc tagatgctgt ccgaggcagt 180 cctgccatca atgtggccgt gcatgtgttc agaaaggctg ctgatgacac ctgggagcca 240 tttgcctctg ggaaaaccag tgagtctgga gagctgcatg ggctcacaac tgaggaggaa 300 tttgtagaag ggatatacaa agtggaaata gacaccaaat cttactggaa ggcactttgc 360 atctccccat tccatgagca tgcagaggtg gtattcacag ccaacgactc cggcccccgc 420 cgctacacca ttgccgccct gctgagcccc tactcctatt ccaccacggc tgtcgtcacc 480 aatcccaagg aataa 495 14 489 DNA Homo sapiens 14 atgtctgttt ctgaaatcca gctgatgcat aacctgggta aacatctgaa ctctatggaa 60 cgtgttgaat ggctgcgtaa gaaactgcag gacgttcata actttggtcc aactggtacc 120 ggtgaatcca aggctcctct gatggtcgca gttctagatg ctgtccgagg cagtcctgcc 180 atcaatgtgg ccgtgcatgt gttcagaaag gctgctgatg acacctggga gccatttgcc 240 tctgggaaaa ccagtgagtc tggagagctg catgggctca caactgagga ggaatttgta 300 gaagggatat acaaagtgga aatagacacc aaatcttact ggaagtgtct tggcatctcc 360 ccattccatg agcatgcaga ggtggtattc acagccaacg actccggccc ccgccgctac 420 accattgccg ccctgctgag cccctactcc tattccacca cggctgtcgt caccaatccc 480 aaggaataa 489 15 843 DNA Homo sapiens 15 atgcgaccgt ccggccgtaa gagctccaaa atgcaggctt tccgtatctg ggacgttaac 60 cagaaaacct tctacctgcg caacaaccag ctggttgctg gctacctgca gggtccgaac 120 gttaacctgg aagaaaaaat cgacgttgta ccgatcgaac cgcacgctct gttcctgggt 180 atccacggtg gtaaaatgtg cctgagctgc gtgaaatctg gtgacgaaac tcgtctgcag 240 ctggaagcag ttaacatcac tgacctgagc gaaaaccgca aacaggacaa acgtttcgca 300 ttcatccgct ctgacagcgg cccgaccacc agcttcgaat ctgctgcttg cccgggttgg 360 ttcctgtgca ctgctatgga agctgaccag ccggtaagcc tgaccaacat gccggacgaa 420 ggcgtgatgg taaccaaatt ctacttccag gaagacgaag gtccaactgg taccggtgaa 480 tccaaggctc ctctgatggt caaagttcta gatgctgtcc gaggcagtcc tgccatcaat 540 gtggccgtgc atgtgttcag aaaggctgct gatgacacct gggagccatt tgcctctggg 600 aaaaccagtg agtctggaga gctgcatggg ctcacaactg aggaggaatt tgtagaaggg 660 atatacaaag tggaaataga caccaaatct tactggaagg cacttggcat ctccccattc 720 catgagcatg cagaggtggt attcacagcc aacgactccg gcccccgccg ctacaccatt 780 gccgccctgc tgagccccta ctcctattcc accacggctg tcgtcaccaa tcccaaggaa 840 taa 843 16 855 DNA Homo sapiens 16 atgggtccaa ctggtaccgg tgaatccaag gctcctctga tggtcaaagt tctagatgct 60 gtccgaggca gtcctgccat caatgtggcc gtgcatgtgt tcagaaaggc tgctgatgac 120 acctgggagc catttgcctc tgggaaaacc agtgagtctg gagagctgca tgggctcaca 180 actgaggagg aatttgtaga agggatatac aaagtggaaa tagacaccaa atcttactgg 240 aaggcacttg gcatctcccc attccatgag catgcagagg tggtattcac agccaacgac 300 tccggccccc gccgctacac cattgccgcc ctgctgagcc cctactccta ttccaccacg 360 gctgtcgtca ccaatcccaa ggaaggtagt ggtagccgac cgtccggccg taagagctcc 420 aaaatgcagg ctttccgtat ctgggacgtt aaccagaaaa ccttctacct gcgcaacaac 480 cagctggttg ctggctacct gcagggtccg aacgttaacc tggaagaaaa aatcgacgtt 540 gtaccgatcg aaccgcacgc tctgttcctg ggtatccacg gtggtaaaat gtgcctgagc 600 tgcgtgaaat ctggtgacga aactcgtctg cagctggaag cagttaacat cactgacctg 660 agcgaaaacc gcaaacagga caaacgtttc gcattcatcc gctctgacag cggcccgacc 720 accagcttcg aatctgctgc ttgcccgggt tggttcctgt gcactgctat ggaagctgac 780 cagccggtaa gcctgaccaa catgccggac gaaggcgtga tggtaaccaa attctacttc 840 caggaagacg aataa 855 17 439 DNA Homo sapiens 17 catatgggtc caactggtac cggtgaatcc aaggctcctc tgatggtcaa agttctagat 60 gctgtccgag gcagtcctgc catcaatgtg gccgtgcatg tgttcagaaa ggctgctgat 120 gacacctggg agccatttgc ctctgggaaa accagtgagt ctggagagct gcatgggctc 180 acaactgagg aggaatttgt agaagggata tacaaagtgg aaatagacac caaatcttac 240 tggaaggcac tttgcatctc cccattccat gagcatgcag aggtggtatt cacagccaac 300 gactccggcc cccgccgcta caccattgcc gccctgctga gcccctactc ctattccacc 360 actgcagtcg tcaccaatcc caaggaagga tcaggatccg gaaaacgtcc gccgggtttc 420 tccccgctgt aatctcgag 439 18 36 DNA Homo sapiens 18 gaggaataac atatgggtcc aactggtacc ggtgaa 36 19 36 DNA Homo sapiens 19 ccgcggatcc tcgagattat tccttgggat tggtga 36 20 48 DNA Homo sapiens 20 gaggaataac atatgggtcc aactggtacc ggtgaatcca aggctcct 48 21 24 DNA Homo sapiens 21 agaaaggctt gtgatgacac ctgg 24 22 24 DNA Homo sapiens 22 ccaggtgtca tcacaagcct ttct 24 23 24 DNA Homo sapiens 23 agaaaggctg cttgtgacac ctgg 24 24 24 DNA Homo sapiens 24 ccaggtgtca caagcagcct ttct 24 25 24 DNA Homo sapiens 25 tactggaagt gtcttggcat ctcc 24 26 24 DNA Homo sapiens 26 ggagatgcca agacacttcc agta 24 27 24 DNA Homo sapiens 27 aaggcacttt gcatctcccc attc 24 28 24 DNA Homo sapiens 28 gaatggggag atgcaaagtg cctt 24 29 21 DNA Homo sapiens 29 ctgatggtcg cagttctaga t 21 30 21 DNA Homo sapiens 30 atctagaact gcgaccatca g 21 31 36 DNA Homo sapiens 31 gaggaataac atatgatcga aggtccgact ctgcgt 36 32 41 DNA Homo sapiens 32 ttcaccggta ccagttggac ctgcgcgtgc tgcaagccat t 41 33 33 DNA Homo sapiens 33 gaggaataac atatgtctgt ttctgaaatc cag 33 34 36 DNA Homo sapiens 34 ttcaccggta ccagttggac caaagttatg aacgtc 36 35 32 DNA Homo sapiens 35 gaggaataac atatgcgacc gtccggacgt aa 32 36 36 DNA Homo sapiens 36 ttctacttcc aggaagacga aggtccaact ggtacc 36 37 54 DNA Homo sapiens 37 gtcgtcacca atcccaagga aggtagtggt agccgaccgt ccggccgtaa gagc 54 38 40 DNA Homo sapiens 38 ccgcggatcc tcgagattat tcgtcttcct ggaagtagaa 40 39 36 DNA Homo sapiens 39 gaggaataac atatgggtcc aactggtacc ggtgaa 36 40 26 DNA Homo sapiens 40 aatatactgc agtggtggaa taggag 26 41 68 DNA Homo sapiens 41 gtcgtcacca atcccaagga aggatcagga tccggaaaac gtccgccggg tttctccccg 60 ctgtaatc 68 42 76 DNA Homo sapiens 42 tcgagattac agcggggaga aacccggcgg acgttttccg gatcctgatc cttccttggg 60 attggtgacg actgca 76

Claims (26)

What is claimed is:
1. A method for increasing the serum half-life of a biologically active agent comprising fusing the biologically active agent to transthyretin (TTR) or a TTR variant.
2. The method of claim 1 where said TTR or TTR variant is chemically modified with a chemical selected from the group consisting of dextran, poly(n-vinyl pyurrolidone), polyethylene glycols, propropylene glycol homopolymers, polypropylene oxide/ethylene oxide co-polymers, polyoxyethylated polyols and polyvinyl alcohols.
3. The method of claim 2 where said TTR or TTR variant is chemically modified with polyethylene glycol.
4. The method of claim 3 wherein said polyethylene glycol has a molecular weight of between about 1 kD and 100 kD.
5. The method of claim 4 wherein said polyethylene glycol has a molecular weight of between about 5 kD and 30 kD.
6. The method of claim 1 wherein said TTR is encoded by the nucleic acid molecule of SEQ ID NO:2.
7. The method of claim 1 wherein the biologically active agent is a protein.
8. The method of claim 1 wherein the biologically active agent is a peptide.
9. The method of claim 8 wherein the peptide is a TPO mimetic peptide (TMP).
10. A substantially homogenous preparation of a TTR-biologically active agent fusion, optionally in a pharmaceutically acceptable diluent, carrier or adjuvant.
11. A substantially homogenous preparation of a PEG-TTR-biologically active agent fusion, optionally in a pharmaceutically acceptable diluent, carrier or adjuvant.
12. The preparation of claim 11 wherein the biologically active agent is a protein.
13. The preparation of claim 11 wherein the biologically active agent is a peptide.
14. The preparation of claim 13 wherein the peptide is a TPO mimetic peptide (TMP).
15. A substantially homogenous preparation of a TTR variant-biologically active agent fusion, optionally in a pharmaceutically acceptable diluent, carrier or adjuvant.
16. A substantially homogenous preparation of a PEG-TTR variant-biologically active agent fusion, optionally in a pharmaceutically acceptable diluent, carrier or adjuvant.
17. The preparation of claim 16 wherein the biologically active agent is a protein.
18. The preparation of claim 16 wherein the biologically active agent is a peptide.
19. The preparation of claim 18 wherein the peptide is a TPO mimetic peptide (TMP).
20. The preparation of any of claims 10-19 wherein the fusion contains a linker peptide.
21. A process for preparing a substantially homogenous preparation of a TTR-biologically active agent fusion comprising: (a) fusing said TTR to a biologically active agent to provide a TTR-biologically active agent fusion; and (b) isolating said TTR-biologically active agent fusion.
22. A process for preparing a substantially homogenous preparation of a TTR variant-biologically active agent fusion comprising: (a) engineering a cysteine residue into a specific amino acid position within the amino acid sequence of said TTR to provide a variant of said TTR; (b) fusing said TTR variant to a biologically active agent to provide a TTR variant-biologically active agent fusion; and (c) isolating said TTR variant-biologically active agent fusion.
23. A process for preparing a substantially homogenous preparation of a PEG-TTR-biologically active agent fusion comprising: (a) conjugating a polyethylene glycol to said TTR to provide a PEG-TTR; (b) fusing said PEG-TTR to a biologically active agent to provide a PEG-TTR-biologically active agent fusion; and (c) isolating said PEG-TTR-biologically active agent fusion.
24. A process for preparing a substantially homogenous preparation of a PEG-TTR variant-biologically active agent fusion comprising: (a) engineering a cysteine residue into a specific amino acid position within the amino acid sequence of said TTR to provide a variant of said TTR; (b) conjugating a polyethylene glycol to said TTR variant at said cysteine residue to provide a PEG-TTR variant; (c) fusing said PEG-TTR variant to a biologically active agent to provide a PEG-TTR-biologically active agent fusion; and (d) isolating said PEG-TTR-biologically active agent fusion.
25. A method of treating thrombocytopenia comprising administering a therapeutically effective dose of a preparation of claim 14.
26. A method of treating thrombocytopenia comprising administering a therapeutically effective dose of a preparation of claim 19.
US10/117,109 2002-04-04 2002-04-04 Use of transthyretin peptide/protein fusions to increase the serum half-life of pharmacologically active peptides/proteins Abandoned US20030191056A1 (en)

Priority Applications (14)

Application Number Priority Date Filing Date Title
US10/117,109 US20030191056A1 (en) 2002-04-04 2002-04-04 Use of transthyretin peptide/protein fusions to increase the serum half-life of pharmacologically active peptides/proteins
CA002480883A CA2480883A1 (en) 2002-04-04 2003-04-03 Use of transthyretin peptide/protein fusions to increase the serum half-life of pharmacologically active peptides/proteins
AU2003224844A AU2003224844B2 (en) 2002-04-04 2003-04-03 Use of transthyretin peptide/protein fusions to increase the serum half-life of pharmacologically active peptides/proteins
US10/407,078 US20030195154A1 (en) 2002-04-04 2003-04-03 Use of transthyretin peptide/protein fusions to increase the serum half-life of pharmacologically active peptides/proteins
JP2003583462A JP4738743B2 (en) 2002-04-04 2003-04-03 Use of transthyretin peptide / protein fusions to increase serum half-life of pharmacologically active peptides / proteins
MXPA04009680A MXPA04009680A (en) 2002-04-04 2003-04-03 Use of transthyretin peptide/protein fusions to increase the serum half-life of pharmacologically active peptides/proteins.
EP10178081A EP2298331A3 (en) 2002-04-04 2003-04-03 Use of transthyretin peptide/protein fusions to increase the serum half-life of pharmacologically active peptides/proteins
EP03721538A EP1496926B1 (en) 2002-04-04 2003-04-03 Use of transthyretin peptide/protein fusions to increase the serum half-life of pharmacologically active peptides/proteins
ES03721538T ES2400341T3 (en) 2002-04-04 2003-04-03 Use of transthyretin protein / peptide fusions to increase serum half-life of pharmacologically active peptides / proteins
PCT/US2003/010443 WO2003086444A1 (en) 2002-04-04 2003-04-03 Use of transthyretin peptide/protein fusions to increase the serum half-life of pharmacologically active peptides/proteins
PL03372849A PL372849A1 (en) 2002-04-04 2003-04-03 Use of transthyretin peptide/protein fusions to increase the serum half-life of pharmacologically active peptides/proteins
US12/380,451 US8633153B2 (en) 2002-04-04 2009-02-26 Transthyretin variants
JP2010264759A JP2011136981A (en) 2002-04-04 2010-11-29 Use of transthyretin peptide/protein fusion to increase serum half-life of pharmacologically active peptide/protein
US14/157,325 US20140234945A1 (en) 2002-04-04 2014-01-16 Transthyretin variants

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
US10/117,109 US20030191056A1 (en) 2002-04-04 2002-04-04 Use of transthyretin peptide/protein fusions to increase the serum half-life of pharmacologically active peptides/proteins

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US10/407,078 Continuation-In-Part US20030195154A1 (en) 2002-04-04 2003-04-03 Use of transthyretin peptide/protein fusions to increase the serum half-life of pharmacologically active peptides/proteins

Publications (1)

Publication Number Publication Date
US20030191056A1 true US20030191056A1 (en) 2003-10-09

Family

ID=28674128

Family Applications (4)

Application Number Title Priority Date Filing Date
US10/117,109 Abandoned US20030191056A1 (en) 2002-04-04 2002-04-04 Use of transthyretin peptide/protein fusions to increase the serum half-life of pharmacologically active peptides/proteins
US10/407,078 Abandoned US20030195154A1 (en) 2002-04-04 2003-04-03 Use of transthyretin peptide/protein fusions to increase the serum half-life of pharmacologically active peptides/proteins
US12/380,451 Expired - Fee Related US8633153B2 (en) 2002-04-04 2009-02-26 Transthyretin variants
US14/157,325 Abandoned US20140234945A1 (en) 2002-04-04 2014-01-16 Transthyretin variants

Family Applications After (3)

Application Number Title Priority Date Filing Date
US10/407,078 Abandoned US20030195154A1 (en) 2002-04-04 2003-04-03 Use of transthyretin peptide/protein fusions to increase the serum half-life of pharmacologically active peptides/proteins
US12/380,451 Expired - Fee Related US8633153B2 (en) 2002-04-04 2009-02-26 Transthyretin variants
US14/157,325 Abandoned US20140234945A1 (en) 2002-04-04 2014-01-16 Transthyretin variants

Country Status (9)

Country Link
US (4) US20030191056A1 (en)
EP (2) EP2298331A3 (en)
JP (2) JP4738743B2 (en)
AU (1) AU2003224844B2 (en)
CA (1) CA2480883A1 (en)
ES (1) ES2400341T3 (en)
MX (1) MXPA04009680A (en)
PL (1) PL372849A1 (en)
WO (1) WO2003086444A1 (en)

Cited By (29)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2005074460A3 (en) * 2003-12-05 2005-09-29 Becton Dickinson Co Methods of enhancing immune response in the intradermal compartment and compounds useful in the methods
US7311902B2 (en) 2003-04-15 2007-12-25 Smithkline Beecham Corporation Conjugates comprising human IL-18 and substitution mutants thereof
US20080020978A1 (en) * 2005-10-21 2008-01-24 Gegg Colin V Jr CGRP peptide antagonists and conjugates
US20090054332A1 (en) * 2007-06-21 2009-02-26 Conjuchem Biotechnologies, Inc. Thombopoietin peptide conjugates
US20090281028A1 (en) * 2006-10-25 2009-11-12 Sullivan John K OSK1 peptide analogs and pharmaceutical compositions
EP2425860A1 (en) 2005-08-12 2012-03-07 Amgen Inc. Modified Fc molecules
WO2012040518A2 (en) 2010-09-22 2012-03-29 Amgen Inc. Carrier immunoglobulins and uses thereof
US20120101021A1 (en) * 2009-02-06 2012-04-26 Surendra Sharma Compositions, formulations and methods of treating preeclampsia-type disorders of pregnancy
WO2012117336A2 (en) 2011-02-28 2012-09-07 Istituto Di Ricovero E Cura A Carattere Scientifico Materno-Infantile Burlo Garofolo - Ospedale Di Alta Specializzazione E Di Rilievo Nazionale Per La Salute Della Donna E Del Bambino Apoptosis-inducing molecules and uses therefor
WO2012125973A2 (en) 2011-03-16 2012-09-20 Amgen Inc. Potent and selective inhibitors of nav1.3 and nav1.7
US8420779B2 (en) 2007-05-22 2013-04-16 Amgen Inc. Compositions and methods for producing bioactive fusion proteins
WO2013074861A1 (en) * 2011-11-18 2013-05-23 Alnylam Pharmaceuticals, Inc. Quantification of transthyretin and its isoforms
WO2014099984A1 (en) 2012-12-20 2014-06-26 Amgen Inc. Apj receptor agonists and uses thereof
WO2014165277A2 (en) 2013-03-12 2014-10-09 Amgen Inc. POTENT AND SELECTIVE INHIBITORS OF Nav1.7
WO2015191781A2 (en) 2014-06-10 2015-12-17 Amgen Inc. Apelin polypeptides
US9399775B2 (en) 2011-11-18 2016-07-26 Alnylam Pharmaceuticals, Inc. RNAi agents, compositions and methods of use thereof for treating transthyretin (TTR) associated diseases
WO2018132768A1 (en) 2017-01-13 2018-07-19 Sanna Pietro P Methods and compositions for treating hpa hyperactivity
EP3385279A1 (en) 2009-03-20 2018-10-10 Amgen Inc. Carrier immunoglobulins and uses thereof
WO2019028382A1 (en) 2017-08-04 2019-02-07 Amgen Inc. Method of conjugation of cys-mabs
US10208307B2 (en) 2015-07-31 2019-02-19 Alnylam Pharmaceuticals, Inc. Transthyretin (TTR) iRNA compositions and methods of use thereof for treating or preventing TTR-associated diseases
WO2019070901A1 (en) 2017-10-04 2019-04-11 Amgen Inc. Transthyretin immunoglobulin fusions
US10344073B2 (en) 2014-01-09 2019-07-09 Hadasit Medical Research Services And Development Ltd. Cell compositions and methods for cancer therapy
CN111437398A (en) * 2019-12-17 2020-07-24 童妍(上海)医疗器械有限公司 Transthyretin entering eye and its application in preparing drops
WO2020198074A1 (en) 2019-03-22 2020-10-01 Reflexion Pharmaceuticals, Inc. D-peptidic compounds for vegf
WO2020198075A2 (en) 2019-03-22 2020-10-01 Reflexion Pharmaceuticals, Inc. Multivalent d-peptidic compounds for target proteins
CN112043820A (en) * 2020-09-16 2020-12-08 童妍(上海)医疗器械有限公司 Eye preparation and preparation method and application thereof
US11806360B2 (en) 2017-09-19 2023-11-07 Alnylam Pharmaceuticals, Inc. Compositions and methods for treating transthyretin (TTR) mediated amyloidosis
US11959081B2 (en) 2021-08-03 2024-04-16 Alnylam Pharmaceuticals, Inc. Transthyretin (TTR) iRNA compositions and methods of use thereof
US12227744B2 (en) 2008-10-20 2025-02-18 Alnylam Pharmaceuticals, Inc. Compositions and methods for inhibiting expression of transthyretin

Families Citing this family (37)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7737260B2 (en) * 2003-11-13 2010-06-15 Hanmi Pharm. Co., Ltd Protein complex using an immunoglobulin fragment and method for the preparation thereof
US8263084B2 (en) * 2003-11-13 2012-09-11 Hanmi Science Co., Ltd Pharmaceutical composition for treating obesity-related disease comprising insulinotropic peptide conjugate
US20090238838A1 (en) * 2003-11-13 2009-09-24 Hanmi Pharm. Ind. Co. Ltd. Insulinotropic peptide conjugate using an immunoglobulin fc
EP1704165B1 (en) * 2003-12-18 2010-03-17 Novo Nordisk A/S Glp-1 compounds
WO2005077976A2 (en) * 2004-02-13 2005-08-25 Avidis Sa Coiled-coil domains from c4b-binding protein
EP1773400A2 (en) * 2004-07-08 2007-04-18 Amgen Inc. Therapeutic peptides
CN100344323C (en) * 2004-09-30 2007-10-24 华东师范大学 Human glucagon-like peptide-1 compound and its preparing method
GB0426146D0 (en) 2004-11-29 2004-12-29 Bioxell Spa Therapeutic peptides and method
ATE435235T1 (en) * 2004-12-22 2009-07-15 Lilly Co Eli FORMULATIONS OF GLP-1 ANALOGUE FUSION PROTEINS
MY146381A (en) 2004-12-22 2012-08-15 Amgen Inc Compositions and methods relating relating to anti-igf-1 receptor antibodies
ES2397289T3 (en) * 2005-09-22 2013-03-06 Biocompatibles Uk Ltd. GLP-1 fusion polypeptides (glucagon-like peptide 1) with increased peptidase resistance
JP5096363B2 (en) 2005-12-16 2012-12-12 ネクター セラピューティックス GLP-1 polymer complex
EP1854455B1 (en) 2006-05-10 2009-10-07 Biocompatibles UK Limited Spherical microcapsules comprising GLP-1 peptides, their production and use
EP1972349A1 (en) * 2007-03-21 2008-09-24 Biocompatibles UK Limited GLP-1 fusion peptides conjugated to polymer(s), their production and use
EP1975176A1 (en) * 2007-03-27 2008-10-01 Biocompatibles UK Limited Novel glp-1 fusion peptides, their production and use
CL2008001887A1 (en) 2007-06-29 2008-10-03 Amgen Inc PROTEINS OF UNION TO ANTIGEN THAT JOIN THE RECEPTOR ACTIVATED BY PROTEASES 2 (PAR-2); NUCLEIC ACID THAT CODES THEM; VECTOR AND GUEST CELL; METHOD OF PRODUCTION; AND COMPOSITION THAT UNDERSTANDS THEM.
EP2163243A1 (en) * 2008-09-12 2010-03-17 Biocompatibles UK Limited Treatment of acute myocardial infarction (AMI) using encapsulated cells encoding and secreting GLP-1 peptides or analogs thereof
EP2382228B2 (en) 2009-01-21 2026-01-07 Amgen Inc. Compositions and methods of treating inflammatory and autoimmune diseases
MX2011009897A (en) 2009-03-20 2011-12-08 Amgen Inc Alpha-4-beta-7 heterodimer specific antagonist antibody.
JP2013500987A (en) 2009-07-31 2013-01-10 アムジェン インコーポレイテッド Polypeptides, compositions and methods that bind to type 3 metalloproteinase tissue inhibitor (TIMP-3)
CN105440134A (en) 2010-08-16 2016-03-30 安姆根公司 Antibody of combination of muscle amicine, compound and method
JP2014510265A (en) 2011-02-02 2014-04-24 アムジェン インコーポレイテッド Methods and compositions for inhibition of IGF-IR
JP2014132832A (en) * 2011-05-10 2014-07-24 Sekisui Chem Co Ltd Medicament, functional food product, stabilization method of target protein, fusion protein, nucleic acid, and recombinant
US9309318B2 (en) 2012-10-17 2016-04-12 Amgen, Inc. Compositions relating to anti-IL-21 receptor antibodies
AU2014236867A1 (en) 2013-03-15 2015-09-24 Amgen Inc. Methods and compositions relating to anti-CCR7 antigen binding proteins
US20160045609A1 (en) 2014-08-14 2016-02-18 Mamoun M. Alhamadsheh Conjugation of pharmaceutically active agents with transthyretin ligands through adjustable linkers to increase serum half-life
JP6672257B2 (en) 2014-08-27 2020-03-25 アムジエン・インコーポレーテツド Tissue metalloproteinase inhibitor type 3 (TIMP-3) variants, compositions and methods
IL283764B2 (en) 2015-04-10 2024-01-01 Amgen Inc Interleukin for the expansion of myotonic control T-2 cells
US20170252417A1 (en) * 2016-03-07 2017-09-07 Massachusetts Institute Of Technology Protein-chaperoned t-cell vaccines
CN108623690A (en) * 2017-03-16 2018-10-09 兰州大学 A kind of fusion protein of thrombopoietin and its preparation method and application
CN106977609B (en) * 2017-04-19 2020-07-28 刘崇东 Fusion protein, preparation method and application thereof
JP7360142B2 (en) * 2019-05-21 2023-10-12 国立大学法人 熊本大学 New screening method for amyloidosis treatment drugs
SG11202112762TA (en) 2019-07-08 2021-12-30 Amgen Inc Multispecific transthyretin immunoglobulin fusions
EP4004025A1 (en) 2019-07-26 2022-06-01 Visterra, Inc. Interleukin-2 agents and uses thereof
EP3988122A4 (en) * 2019-12-17 2023-01-18 Yizhou (Shanghai) Biological Medicine Co, Ltd. USE OF TRANSTHYRETIN FOR INTRODUCTION TO THE EYE AND MAKING DROPS
KR20230060514A (en) 2020-09-01 2023-05-04 다케다 야쿠힌 고교 가부시키가이샤 Interleukin-2 muteins and uses thereof
CA3203977A1 (en) 2020-12-04 2022-06-09 Visterra, Inc. Methods of using interleukin-2 agents

Family Cites Families (59)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4179337A (en) 1973-07-20 1979-12-18 Davis Frank F Non-immunogenic polypeptides
US3941763A (en) 1975-03-28 1976-03-02 American Home Products Corporation PGlu-D-Met-Trp-Ser-Tyr-D-Ala-Leu-Arg-Pro-Gly-NH2 and intermediates
US4002531A (en) * 1976-01-22 1977-01-11 Pierce Chemical Company Modifying enzymes with polyethylene glycol and product produced thereby
US6936694B1 (en) 1982-05-06 2005-08-30 Intermune, Inc. Manufacture and expression of large structural genes
JPS5923252A (en) * 1982-07-30 1984-02-06 Fuji Photo Film Co Ltd Method for determining low molecular component in sample liquid containing protein
US4703008A (en) 1983-12-13 1987-10-27 Kiren-Amgen, Inc. DNA sequences encoding erythropoietin
NZ210501A (en) 1983-12-13 1991-08-27 Kirin Amgen Inc Erythropoietin produced by procaryotic or eucaryotic expression of an exogenous dna sequence
KR850004274A (en) 1983-12-13 1985-07-11 원본미기재 Method for preparing erythropoietin
JPS63500636A (en) 1985-08-23 1988-03-10 麒麟麦酒株式会社 DNA encoding multipotent granulocyte colony stimulating factor
US4810643A (en) 1985-08-23 1989-03-07 Kirin- Amgen Inc. Production of pluripotent granulocyte colony-stimulating factor
US5120712A (en) 1986-05-05 1992-06-09 The General Hospital Corporation Insulinotropic hormone
US5118666A (en) 1986-05-05 1992-06-02 The General Hospital Corporation Insulinotropic hormone
US4904584A (en) 1987-12-23 1990-02-27 Genetics Institute, Inc. Site-specific homogeneous modification of polypeptides
US5075222A (en) 1988-05-27 1991-12-24 Synergen, Inc. Interleukin-1 inhibitors
US4902502A (en) * 1989-01-23 1990-02-20 Cetus Corporation Preparation of a polymer/interleukin-2 conjugate
JP2657113B2 (en) 1989-10-16 1997-09-24 アムジエン・インコーポレーテツド Stem cell factor
EP0502956B1 (en) 1989-11-29 1997-04-23 Amgen Boulder Inc. Production of recombinant human interleukin-1 inhibitor
US5545618A (en) 1990-01-24 1996-08-13 Buckley; Douglas I. GLP-1 analogs useful for diabetes treatment
US5372808A (en) 1990-10-17 1994-12-13 Amgen Inc. Methods and compositions for the treatment of diseases with consensus interferon while reducing side effect
NZ241954A (en) 1991-03-15 1994-01-26 Amgen Inc Compositions of g-csf for pulmonary administration.
DE69233069T2 (en) 1991-03-15 2003-11-27 Amgen Inc., Thousand Oaks PEGYLATION OF POLYPEPTIDES
US5595732A (en) 1991-03-25 1997-01-21 Hoffmann-La Roche Inc. Polyethylene-protein conjugates
WO1992017505A1 (en) 1991-04-05 1992-10-15 Board Of Regents Of The University Of Washington Monoclonal antibodies to stem cell factor receptors
US5716805A (en) * 1991-10-25 1998-02-10 Immunex Corporation Methods of preparing soluble, oligomeric proteins
US5962406A (en) * 1991-10-25 1999-10-05 Immunex Corporation Recombinant soluble CD40 ligand polypeptide and pharmaceutical composition containing the same
IT1255439B (en) 1992-07-17 1995-10-31 Getters Spa NON-EVAPORABLE GETTER PUMP
US5581476A (en) 1993-01-28 1996-12-03 Amgen Inc. Computer-based methods and articles of manufacture for preparing G-CSF analogs
HU225496B1 (en) * 1993-04-07 2007-01-29 Scios Inc Pharmaceutical compositions of prolonged delivery, containing peptides
ZA946122B (en) 1993-08-17 1995-03-20 Amgen Inc Erythropoietin analogs
US5705483A (en) 1993-12-09 1998-01-06 Eli Lilly And Company Glucagon-like insulinotropic peptides, compositions and methods
US6288030B1 (en) 1993-12-22 2001-09-11 Amgen Inc. Stem cell factor formulations and methods
SG47030A1 (en) 1994-01-03 1998-03-20 Genentech Inc Thrombopoietin
US5880096A (en) 1994-02-02 1999-03-09 Affymax Technologies N.V. Peptides and compounds that bind to the IL-1 receptor
US5608035A (en) 1994-02-02 1997-03-04 Affymax Technologies N.V. Peptides and compounds that bind to the IL-1 receptor
US5786331A (en) 1994-02-02 1998-07-28 Affymax Technologies N.V. Peptides and compounds that bind to the IL-1 receptor
WO1995021919A2 (en) 1994-02-14 1995-08-17 Kirin Brewery Company, Limited Protein having tpo activity
JPH09508797A (en) 1994-02-14 1997-09-09 ザイモジェネティクス,インコーポレイティド Hematopoietic proteins and materials and methods for producing same
WO1995022992A2 (en) 1994-02-23 1995-08-31 Chiron Corp Method and compositions for increasing the serum half-life of pharmacologically active agents
BR9506017A (en) 1994-03-31 1997-10-14 Amagen Inc Isolated poninculeotide polypeptide Dna sequence and Cdna vector Dna host cell antibody Pharmaceutical composition derived from Mgdf Mgdf polypeptide product with peg groups and preparation thereof and process to produce a human Mgdf polypeptide and a thrombocytopenic condition to increase the number of mature and megakaryotics platelets in a patient in need of them and to attach a water-soluble polymer to a Mgdf polypeptide a polyethylene glycol molecule to a Mgdf polypeptide and water-soluble glycol polypeptide to a mgdf polypeptide
US5532166A (en) * 1994-04-18 1996-07-02 Ma; Yinfa Quantitative retinol assay for serum and dried blood spots
US6309853B1 (en) 1994-08-17 2001-10-30 The Rockfeller University Modulators of body weight, corresponding nucleic acids and proteins, and diagnostic and therapeutic uses thereof
US5824784A (en) 1994-10-12 1998-10-20 Amgen Inc. N-terminally chemically modified protein compositions and methods
AU6028396A (en) 1995-06-07 1996-12-30 Amgen, Inc. Ob protein compositions and method
US5869451A (en) 1995-06-07 1999-02-09 Glaxo Group Limited Peptides and compounds that bind to a receptor
US5581005A (en) 1995-06-16 1996-12-03 The Procter & Gamble Company Method for manufacturing cobalt catalysts
GB2302559B (en) 1995-06-23 1998-06-03 Draftex Ind Ltd Opening arrangements and methods for closure members
US5746516A (en) 1995-08-11 1998-05-05 Hitachi Powdered Metals Co., Ltd. Porous bearing system having internal grooves and electric motor provided with the same
CA2229450A1 (en) 1995-08-17 1997-02-27 Amgen Inc. Methods of reducing or maintaining reduced levels of blood lipids using ob protein compositions
US6369027B1 (en) 1995-12-22 2002-04-09 Amgen Inc. Osteoprotegerin
EA004790B1 (en) 1996-12-20 2004-08-26 Амген Инк. Ob fusion protein compositions and methods
DK2319928T3 (en) 1998-10-23 2013-06-24 Kirin Amgen Inc Dimeric thrombopoietic peptidomimetics that bind to MPL receptor and have thrombopoietic activity
US6660843B1 (en) 1998-10-23 2003-12-09 Amgen Inc. Modified peptides as therapeutic agents
WO2001077137A1 (en) * 2000-04-12 2001-10-18 Human Genome Sciences, Inc. Albumin fusion proteins
KR100345214B1 (en) 1999-08-17 2002-07-25 이강춘 The nasal transmucosal delivery of peptides conjugated with biocompatible polymers
JP2003531149A (en) * 2000-04-13 2003-10-21 ザ・ロツクフエラー・ユニバーシテイ Enhancement of antibody-derived immune response
US6756480B2 (en) 2000-04-27 2004-06-29 Amgen Inc. Modulators of receptors for parathyroid hormone and parathyroid hormone-related protein
BR0116024A (en) 2000-12-07 2005-12-13 Lilly Co Eli Heterologous Fusion Protein and Use thereof
US20020160394A1 (en) * 2001-01-24 2002-10-31 Bayer Corporation Regulation of transthyretin to treat obesity
EP1567178A4 (en) * 2002-11-01 2009-07-15 Amgen Inc Modulators of receptors for parathyrois hormone and parathyroid hormone-related protein

Cited By (56)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7311902B2 (en) 2003-04-15 2007-12-25 Smithkline Beecham Corporation Conjugates comprising human IL-18 and substitution mutants thereof
US20090304744A1 (en) * 2003-12-05 2009-12-10 Becton, Dickinson And Company Methods of enhancing immune response in the intradermal compartment and compounds useful thereof
US20050281832A1 (en) * 2003-12-05 2005-12-22 Campbell Robert L Methods of enhancing immune response in the intradermal compartment and compounds useful thereof
WO2005074460A3 (en) * 2003-12-05 2005-09-29 Becton Dickinson Co Methods of enhancing immune response in the intradermal compartment and compounds useful in the methods
EP2425860A1 (en) 2005-08-12 2012-03-07 Amgen Inc. Modified Fc molecules
US20080020978A1 (en) * 2005-10-21 2008-01-24 Gegg Colin V Jr CGRP peptide antagonists and conjugates
US8168592B2 (en) 2005-10-21 2012-05-01 Amgen Inc. CGRP peptide antagonists and conjugates
US7825093B2 (en) 2006-10-25 2010-11-02 Amgen Inc. Methods of using OSK1 peptide analogs
US20090281028A1 (en) * 2006-10-25 2009-11-12 Sullivan John K OSK1 peptide analogs and pharmaceutical compositions
US20090305399A1 (en) * 2006-10-25 2009-12-10 Sullivan John K DNA encoding OSK1 toxin peptide analogs and vectors and cells for combinant expression
US7803769B2 (en) 2006-10-25 2010-09-28 Amgen Inc. OSK1 peptide analogs and pharmaceutical compositions
US7820623B2 (en) 2006-10-25 2010-10-26 Amgen Inc. Conjugated toxin peptide therapeutic agents
US20090299044A1 (en) * 2006-10-25 2009-12-03 Sullivan John K DNA encoding chimeric toxin peptide fusion proteins and vectors and mammalian cells for recombinant expression
US7834164B2 (en) 2006-10-25 2010-11-16 Amgen Inc. DNA encoding OSK1 toxin peptide analogs and vectors and cells for combinant expression
US7910102B2 (en) 2006-10-25 2011-03-22 Amgen Inc. Methods of using conjugated toxin peptide therapeutic agents
US8043829B2 (en) 2006-10-25 2011-10-25 Amgen Inc. DNA encoding chimeric toxin peptide fusion proteins and vectors and mammalian cells for recombinant expression
US8420779B2 (en) 2007-05-22 2013-04-16 Amgen Inc. Compositions and methods for producing bioactive fusion proteins
EP2738257A1 (en) 2007-05-22 2014-06-04 Amgen Inc. Compositions and methods for producing bioactive fusion proteins
WO2008157824A3 (en) * 2007-06-21 2009-12-30 Conjuchem Biotechnologies Inc. Thrombopoietin peptide conjugates
US20090054332A1 (en) * 2007-06-21 2009-02-26 Conjuchem Biotechnologies, Inc. Thombopoietin peptide conjugates
US12227744B2 (en) 2008-10-20 2025-02-18 Alnylam Pharmaceuticals, Inc. Compositions and methods for inhibiting expression of transthyretin
US20120101021A1 (en) * 2009-02-06 2012-04-26 Surendra Sharma Compositions, formulations and methods of treating preeclampsia-type disorders of pregnancy
EP3385279A1 (en) 2009-03-20 2018-10-10 Amgen Inc. Carrier immunoglobulins and uses thereof
WO2012040518A2 (en) 2010-09-22 2012-03-29 Amgen Inc. Carrier immunoglobulins and uses thereof
WO2012117336A2 (en) 2011-02-28 2012-09-07 Istituto Di Ricovero E Cura A Carattere Scientifico Materno-Infantile Burlo Garofolo - Ospedale Di Alta Specializzazione E Di Rilievo Nazionale Per La Salute Della Donna E Del Bambino Apoptosis-inducing molecules and uses therefor
WO2012125973A2 (en) 2011-03-16 2012-09-20 Amgen Inc. Potent and selective inhibitors of nav1.3 and nav1.7
JP2018021924A (en) * 2011-11-18 2018-02-08 アルナイラム ファーマシューティカルズ, インコーポレイテッドAlnylam Pharmaceuticals, Inc. Quantification of transthyretin and its isoforms
US10570391B2 (en) 2011-11-18 2020-02-25 Alnylam Pharmaceuticals, Inc. RNAi agents, compositions and methods of use thereof for treating transthyretin (TTR) associated diseases
US9399775B2 (en) 2011-11-18 2016-07-26 Alnylam Pharmaceuticals, Inc. RNAi agents, compositions and methods of use thereof for treating transthyretin (TTR) associated diseases
WO2013074861A1 (en) * 2011-11-18 2013-05-23 Alnylam Pharmaceuticals, Inc. Quantification of transthyretin and its isoforms
WO2014099984A1 (en) 2012-12-20 2014-06-26 Amgen Inc. Apj receptor agonists and uses thereof
EP3907237A1 (en) 2012-12-20 2021-11-10 Amgen Inc. Apj receptor agonists and uses thereof
WO2014165277A2 (en) 2013-03-12 2014-10-09 Amgen Inc. POTENT AND SELECTIVE INHIBITORS OF Nav1.7
US11530251B2 (en) 2014-01-09 2022-12-20 Hadasit Medical Research Services And Development Ltd. Methods for cancer therapy using isolated NTB-A ectodomain polypeptides
EP4101461A1 (en) 2014-01-09 2022-12-14 Hadasit Medical Research Services and Development Ltd. Improved cell compositions and methods for cancer therapy
US10344073B2 (en) 2014-01-09 2019-07-09 Hadasit Medical Research Services And Development Ltd. Cell compositions and methods for cancer therapy
EP4257152A2 (en) 2014-06-10 2023-10-11 Amgen Inc. Apelin polypeptides
EP3674314A2 (en) 2014-06-10 2020-07-01 Amgen, Inc Apelin polypeptides
WO2015191781A2 (en) 2014-06-10 2015-12-17 Amgen Inc. Apelin polypeptides
US10941182B2 (en) 2014-06-10 2021-03-09 Amgen Inc. Apelin polypeptides
US11807693B2 (en) 2014-06-10 2023-11-07 Amgen Inc. Apelin polypeptides
US10683501B2 (en) 2015-07-31 2020-06-16 Alnylam Pharmaceuticals, Inc. Transthyretin (TTR) iRNA compositions and methods of use thereof for treating or preventing TTR-associated diseases
US12049628B2 (en) 2015-07-31 2024-07-30 Alnylam Pharmaceuticals, Inc. Transthyretin (TTR) iRNA compositions and methods of use thereof for treating or preventing TTR-associated diseases
US10208307B2 (en) 2015-07-31 2019-02-19 Alnylam Pharmaceuticals, Inc. Transthyretin (TTR) iRNA compositions and methods of use thereof for treating or preventing TTR-associated diseases
US11286486B2 (en) 2015-07-31 2022-03-29 Alnylam Pharmaceuticals, Inc. Transthyretin (TTR) iRNA compositions and methods of use thereof for treating or preventing TTR-associated diseases
WO2018132768A1 (en) 2017-01-13 2018-07-19 Sanna Pietro P Methods and compositions for treating hpa hyperactivity
WO2019028382A1 (en) 2017-08-04 2019-02-07 Amgen Inc. Method of conjugation of cys-mabs
EP4464719A2 (en) 2017-08-04 2024-11-20 Amgen Inc. Method of conjugation of cys-mabs
US11806360B2 (en) 2017-09-19 2023-11-07 Alnylam Pharmaceuticals, Inc. Compositions and methods for treating transthyretin (TTR) mediated amyloidosis
WO2019070901A1 (en) 2017-10-04 2019-04-11 Amgen Inc. Transthyretin immunoglobulin fusions
US12269898B2 (en) 2017-10-04 2025-04-08 Amgen Inc. Transthyretin immunoglobulin fusions
WO2020198075A2 (en) 2019-03-22 2020-10-01 Reflexion Pharmaceuticals, Inc. Multivalent d-peptidic compounds for target proteins
WO2020198074A1 (en) 2019-03-22 2020-10-01 Reflexion Pharmaceuticals, Inc. D-peptidic compounds for vegf
CN111437398A (en) * 2019-12-17 2020-07-24 童妍(上海)医疗器械有限公司 Transthyretin entering eye and its application in preparing drops
CN112043820A (en) * 2020-09-16 2020-12-08 童妍(上海)医疗器械有限公司 Eye preparation and preparation method and application thereof
US11959081B2 (en) 2021-08-03 2024-04-16 Alnylam Pharmaceuticals, Inc. Transthyretin (TTR) iRNA compositions and methods of use thereof

Also Published As

Publication number Publication date
CA2480883A1 (en) 2003-10-23
EP2298331A2 (en) 2011-03-23
AU2003224844A1 (en) 2003-10-27
JP2005529108A (en) 2005-09-29
EP1496926B1 (en) 2012-12-19
EP1496926A1 (en) 2005-01-19
US20140234945A1 (en) 2014-08-21
US20030195154A1 (en) 2003-10-16
JP4738743B2 (en) 2011-08-03
PL372849A1 (en) 2005-08-08
EP1496926A4 (en) 2006-10-18
ES2400341T3 (en) 2013-04-09
WO2003086444A1 (en) 2003-10-23
US20090191624A1 (en) 2009-07-30
MXPA04009680A (en) 2005-01-11
AU2003224844B2 (en) 2009-05-21
EP2298331A3 (en) 2011-04-13
US8633153B2 (en) 2014-01-21
JP2011136981A (en) 2011-07-14

Similar Documents

Publication Publication Date Title
US20030191056A1 (en) Use of transthyretin peptide/protein fusions to increase the serum half-life of pharmacologically active peptides/proteins
KR101028626B1 (en) Peptides and Related Compounds Having Platelet Angiogenic Activity
US8748571B2 (en) Thrombopoietic compounds
JP2003533187A (en) Modified peptide containing Fc domain as therapeutic agent
JP2007091746A (en) Modified peptide as therapeutic agent
US20110071077A1 (en) Thrombopoietic Compounds
HK1122820A (en) Peptides and related compounds having thrombopoietic activity
AU2002340176A1 (en) Peptides and related compounds having thrombopoietic activity

Legal Events

Date Code Title Description
AS Assignment

Owner name: AMGEN INC., CALIFORNIA

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:WALKER, KENNETH;XIONG, FEI;REEL/FRAME:012793/0391

Effective date: 20020403

STCB Information on status: application discontinuation

Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION