US11639376B2 - Constructs having a SIRP-α domain or variant thereof - Google Patents

Constructs having a SIRP-α domain or variant thereof Download PDF

Info

Publication number
US11639376B2
US11639376B2 US16/736,651 US202016736651A US11639376B2 US 11639376 B2 US11639376 B2 US 11639376B2 US 202016736651 A US202016736651 A US 202016736651A US 11639376 B2 US11639376 B2 US 11639376B2
Authority
US
United States
Prior art keywords
sirp
variant
polypeptide
domain
antibody
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Active
Application number
US16/736,651
Other versions
US20200239543A1 (en
Inventor
Jaume Pons
Laura Deming
Corey Goodman
Bang Janet Sim
Steven Elliot KAUDER
Hong Wan
Tracy Chia-Chien Kuo
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
ALX Oncology Inc
Original Assignee
ALX Oncology Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by ALX Oncology Inc filed Critical ALX Oncology Inc
Priority to US16/736,651 priority Critical patent/US11639376B2/en
Assigned to Alexo Therapeutics Inc. reassignment Alexo Therapeutics Inc. ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: GOODMAN, COREY, PONS, JAUME, DEMING, LAURA, KAUDER, Steven Elliot, KUO, TRACY CHIA-CHIEN, SIM, BANG JANET, WAN, HONG
Assigned to ALX Oncology Inc. reassignment ALX Oncology Inc. CHANGE OF NAME (SEE DOCUMENT FOR DETAILS). Assignors: Alexo Therapeutics Inc.
Publication of US20200239543A1 publication Critical patent/US20200239543A1/en
Application granted granted Critical
Publication of US11639376B2 publication Critical patent/US11639376B2/en
Priority to US18/540,092 priority patent/US20240343778A1/en
Active legal-status Critical Current
Anticipated expiration legal-status Critical

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70596Molecules with a "CD"-designation not provided for elsewhere
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C07K14/4701Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
    • C07K14/4702Regulators; Modulating activity
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/177Receptors; Cell surface antigens; Cell surface determinants
    • A61K38/1774Immunoglobulin superfamily (e.g. CD2, CD4, CD8, ICAM molecules, B7 molecules, Fc-receptors, MHC-molecules)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/1703Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • A61K38/1709Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/177Receptors; Cell surface antigens; Cell surface determinants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/3955Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/39558Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • A61K47/6811Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a protein or peptide, e.g. transferrin or bleomycin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/04Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00Drugs for disorders of the respiratory system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00Drugs for disorders of the respiratory system
    • A61P11/06Antiasthmatics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P13/00Drugs for disorders of the urinary system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P13/00Drugs for disorders of the urinary system
    • A61P13/12Drugs for disorders of the urinary system of the kidneys
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • A61P17/06Antipsoriatics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/02Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P21/00Drugs for disorders of the muscular or neuromuscular system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P21/00Drugs for disorders of the muscular or neuromuscular system
    • A61P21/04Drugs for disorders of the muscular or neuromuscular system for myasthenia gravis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/08Drugs for disorders of the metabolism for glucose homeostasis
    • A61P3/10Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/04Antibacterial agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/02Antineoplastic agents specific for leukemia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/06Immunosuppressants, e.g. drugs for graft rejection
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • A61P9/10Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07HSUGARS; DERIVATIVES THEREOF; NUCLEOSIDES; NUCLEOTIDES; NUCLEIC ACIDS
    • C07H21/00Compounds containing two or more mononucleotide units having separate phosphate or polyphosphate groups linked by saccharide radicals of nucleoside groups, e.g. nucleic acids
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/76Albumins
    • C07K14/765Serum albumin, e.g. HSA
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2818Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2833Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against MHC-molecules, e.g. HLA-molecules
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2863Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2887Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against CD20
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/545Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2300/00Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C07K14/4701Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
    • C07K14/4702Regulators; Modulating activity
    • C07K14/4703Inhibitors; Suppressors
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • C07K2317/524CH2 domain
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • C07K2317/526CH3 domain
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • C07K2317/732Antibody-dependent cellular cytotoxicity [ADCC]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/94Stability, e.g. half-life, pH, temperature or enzyme-resistance
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/02Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/30Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto

Definitions

  • polypeptides comprising: a signal-regulatory protein ⁇ (SIRP- ⁇ ) D1 variant comprising a SIRP- ⁇ D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP- ⁇ D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP- ⁇ D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92.
  • the wild type SIRP- ⁇ D1 domain has a sequence according to any one of SEQ ID NOs: 1-10.
  • the SIRP- ⁇ D1 domain comprises between one and nine additional amino acid mutations relative to a wild-type SIRP- ⁇ D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54 residue 56, residue 66, and residue 92.
  • the SIRP- ⁇ D1 variant comprises the amino acid sequence, EEELQX 1 IQPDKSVLVAAGETATLRCTX 2 TSLX 3 PVGPIQWFRGAGPGRX 4 LIYNQX 5 X 6 GX 7 FPR VTTVSDX 8 TKRNNMDFSIRIGX 9 ITPADAGTYYCX 10 KFRKGSPDDVEFKSGAGTELSVRAKPS (SEQ ID NO: 49), wherein X 1 is V, L, or I; X 2 is A, I, V, or L; X 3 is I, F, S, or T; X 4 is E, V, or L; X 5 is K or R; X 6 is E or Q; X 7 is H, P, or R; X 8 is L, T, S, or G; X 9 is A; and X 10 is V or I; and wherein the SIRP- ⁇ D1 variant has at least two amino acid substitutions relative to a wild-type SIRP- ⁇ D1 domain having a
  • the SIRP- ⁇ D1 variant has an amino acid sequence according to any one of SEQ ID NOs: 78-85.
  • the SIRP- ⁇ D1 variant comprises the amino acid sequence, EEELQX 1 IQPDKSVLVAAGETATLRCTX 2 TSLX 3 PVGPIQWFRGAGPGRX 4 LIYNQX 5 X 6 GX 7 FPR VTTVSDX 8 TKRNNMDFSIRIGX 9 X 10 X 11 X 12 ADAGTYYCX 13 KFRKGSPDDVEFKSGAGTELSVR AKPS (SEQ ID NO: 218), wherein X 1 is V, L, or I; X 2 is A, V, L, or I; X 3 is I, S, T, or F; X 4 is E, L, or V; X 5 is K or R; X 6 is E or Q; X 7 is H, R, or P; X 8 is S, G, L, or T; X 9 is any amino acid;
  • X 9 is A. In some embodiments, X 9 is N. In some embodiments, X 10 is I. In some embodiments, X 9 is N and X 10 is P. In some embodiments, X 9 is N and X 11 is any amino acid other than S, T, or C. In some embodiments, X 11 is T. In some embodiments, X 11 is an amino acid other than T. In some embodiments, X 12 is P. In some embodiments, X 9 is N and X 12 is any amino acid other than P.
  • the SIRP- ⁇ D1 variant comprises the amino acid sequence, EEELQX 1 IQPDKSVLVAAGETATLRCTX 2 TSLX 3 PVGPIQWFRGAGPGRX 4 LIYNQX 5 X 6 GX 7 FPR VTTVSDX 8 TKRNNMDFSIRIGX 9 ITX 10 ADAGTYYCX 11 KFRKGSPDDVEFKSGAGTELSVRAKP S (SEQ ID NO: 219), wherein X 1 is V, L, or I; X 2 is A, V, L, or I; X 3 is I, S, T, or F; X 4 is E, L, or V; X 5 is K or R; X 6 is E or Q; X 7 is H, R, or P; X 8 is S, G, L, or T; X 9 is N; X 10 is any amino acid other than P; and X 11 is V or I; and wherein the SIRP- ⁇ D1 variant has at least two amino acid substitutions relative to
  • the SIRP- ⁇ D1 variant comprises the amino acid sequence, EEELQX 1 IQPDKSVLVAAGETATLRCTX 2 TSLX 3 PVGPIQWFRGAGPGRELIYNQX 4 EGX 5 FPRV TTVSDX 6 TKRNNMDFSIRIGX 7 ITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSVRAKPS (SEQ ID NO: 52), wherein X 1 is V, L, or I; X 2 is A, I, or L; X 3 is I, T, S, or F; X 4 is K or R; X 5 is H, P, or R; X 6 is L, T, or G; and X 7 is A; and wherein the SIRP- ⁇ D1 variant has at least two amino acid substitutions relative to a wild-type SIRP- ⁇ D1 domain having a sequence according to SEQ ID NO: 1.
  • X 1 is V or I
  • X 2 is A or I
  • X 3 is I or F
  • X 4 is K or R
  • X 5 is H or P
  • X 6 is L or T
  • X 7 is A.
  • the SIRP- ⁇ D1 variant has at least three amino acid substitutions relative to a wild-type SIRP- ⁇ D1 domain having a sequence according to SEQ ID NO: 1.
  • the SIRP- ⁇ D1 variant has at least four amino acid substitutions relative to a wild-type SIRP- ⁇ D1 domain having a sequence according to SEQ ID NO: 1.
  • the SIRP- ⁇ D1 variant has at least five amino acid substitutions relative to a wild-type SIRP- ⁇ D1 domain having a sequence according to SEQ ID NO: 1. In some embodiments, the SIRP- ⁇ D1 variant has at least six amino acid substitutions relative to a wild-type SIRP- ⁇ D1 domain having a sequence according to SEQ ID NO: 1. In some embodiments, the SIRP- ⁇ D1 variant has at least seven amino acid substitutions relative to a wild-type SIRP- ⁇ D1 domain having a sequence according to SEQ ID NO: 1. In some embodiments, X 1 is I. In some embodiments, X 2 is I. In some embodiments, X 3 is F. In some embodiments, X 4 is R.
  • X 5 is P. In some embodiments, X 6 is T. In some embodiments, each of X 1 , X 2 , X 3 , X 4 , X 5 , and X 6 is not a wild-type amino acid. In some embodiments, the SIRP- ⁇ D1 variant has an amino acid sequence according to any one of SEQ ID NOs: 81-85.
  • the SIRP- ⁇ D1 variant comprises the amino acid sequence, EEELQX 1 IQPDKSVSVAAGESAILHCTX 2 TSLX 3 PVGPIQWFRGAGPARELIYNQX 4 EG X 5 FPRVTTVSEX 6 TKRENMDFSISISX 7 ITPADAGTYYCVKFRKGSPDTEFKSGAGTELSVRAKP S (SEQ ID NO: 212), wherein X 1 is V, L, or I; X 2 is V, I, or L; X 3 is I, T, S, or F; X 4 is K or R; X 5 is H, P, or R; X 6 is S, T, or G; and X 7 is A; and wherein the SIRP- ⁇ D1 variant has at least two amino acid substitutions relative to a wild-type SIRP- ⁇ D1 domain having the sequence of SEQ ID NO: 2.
  • the polypeptide binds to human CD47 with a K D less than about 5 ⁇ 10 ⁇ 9 M.
  • the polypeptide further comprises an Fc domain monomer linked to the N-terminus or the C-terminus of the polypeptide, wherein the Fc domain monomer is a human IgG1, IgG2, or IgG4 Fc region.
  • the Fc domain monomer comprises at least one mutation relative to a wild-type human IgG1, IgG2, or IgG4 Fc region.
  • the polypeptide has the amino acid sequence of any one of SEQ ID NO: 135, SEQ ID NO: 136, or SEQ ID NO: 137.
  • the Fc domain monomer comprises (a)_one of the following amino acid substitutions relative to wild type human IgG1: T366W, T366S, L368A, Y407V, T366Y, T394W, F405W, Y349T, Y349E, Y349V, L351T, L351H, L351N, L351K, P353S, S354D, D356K, D356R, D356S, E357K, E357R, E357Q, S364A, T366E, L368T, L368Y, L368E, K370E, K370D, K370Q, K392E, K392D, T394N, P395N, P396T, V397T, V397Q, L398T, D399K, D399R, D399N, F405T, F405H, F405R,
  • the Fc domain monomer comprises (a) one of the following amino acid substitutions relative to wild type human IgG1: T366W, T366S, L368A, Y407V, T366Y, T394W, F405W, Y349T, Y349E, Y349V, L351T, L351H, L351N, L351K, P353S, S354D, D356K, D356R, D356S, E357K, E357R, E357Q, S364A, T366E, L368T, L368Y, L368E, K370E, K370D, K370Q, K392E, K392D, T394N, P395N, P396T, V397T, V397Q, L398T, D399K, D399R, D399N, F405T, F405H, F405R,
  • the polypeptide exhibits a reduction of phagocytosis in a phagocytosis assay compared to a polypeptide with a wild-type human IgG Fc region.
  • the Fc domain monomer is linked to a second polypeptide comprising a second Fc domain monomer to form an Fc domain dimer.
  • the second Fc domain monomer is linked to an additional polypeptide.
  • the additional polypeptide comprises an antibody variable domain.
  • the antibody variable domain targets an antigen expressed on a cell.
  • the cell is a cancer cell.
  • the antibody variable domain targets a cell surface protein involved in immune cell regulation.
  • the additional polypeptide comprises a therapeutic protein.
  • the therapeutic protein is a cytokine, an interleukin, an antigen, a steroid, an anti-inflammatory agent, or an immunomodulatory agent.
  • the additional polypeptide comprises a SIRP- ⁇ D1 variant.
  • the polypeptide further comprises a human serum albumin (HSA) (SEQ ID NO: 12).
  • HSA human serum albumin
  • the HSA comprises a C34S or K573P amino acid substitution relative to SEQ ID NO: 12.
  • the polypeptide has an amino acid sequence according to any one of SEQ ID NOs: 152-159.
  • the polypeptide further comprises an albumin-binding peptide.
  • the albumin-binding peptide comprises the amino acid sequence DICLPRWGCLW (SEQ ID NO: 160).
  • the polypeptide further comprises a polyethylene glycol (PEG) polymer.
  • PEG polyethylene glycol
  • the PEG polymer is joined to a cysteine substitution in the polypeptide.
  • polypeptides comprising: a signal-regulatory protein ⁇ (SIRP- ⁇ ) D1 variant, wherein the SIRP- ⁇ D1 variant comprises the amino acid sequence, EEX 1 X 2 QX 3 IQPDKX 4 VX 5 VAAGEX 6 X 7 X 8 LX 9 CTX 10 TSLX 11 PVGPIQWFRGAGPX 12 RX 13 LIYNQX 14 X 15 GX 16 FPRVTTVSX 17 X 18 TX 19 RX 20 NMDFX 21 IX 2 IX 23 X 24 ITX 25 ADAGTYYCX 26 KX 27 RKGSPD X 28 X 29 EX 30 KSGAGTELSVRX 31 KPS (SEQ ID NO: 47), wherein X 1 is E, or G; X 2 is L, I, or V; X 3 is V, L, or I; X 4 is S, or F; X 5 is L, or S; X 6 is S, or T; X
  • one of the Fc domain monomers in the Fc domain dimer comprises a human IgG1 Fc region comprising L234A, L235A, G237A, and N297A mutations.
  • the polypeptide comprises an amino acid sequence according to any one of SEQ ID NOs: 98-104, 107-113, 116-122, or 135-137.
  • the Fc variant exhibits ablated or reduced binding to an Fc ⁇ receptor compared to a wild-type version of a human IgG Fc region.
  • the IgG1 or IgG2 Fc variant exhibits ablated or reduced binding to CD16a, CD32a, CD32b, CD32c, and CD64 Fc ⁇ receptors compared to a wild-type version of a human IgG1 or IgG2 Fc region.
  • the IgG4 Fc variant exhibits ablated or reduced binding to CD16a and CD32b Fc ⁇ receptors compared to a wild-type version of the human IgG4 Fc region.
  • the IgG1 or IgG2 Fc variant exhibits ablated or reduced binding to C1q compared to a wild-type version of a human IgG1 or IgG2 Fc fusion.
  • the Fc variant binds to an Fc ⁇ receptor with a K D greater than about 5 ⁇ 10 ⁇ 6 M.
  • polypeptides comprising an Fc variant, wherein the Fc variant comprises an Fc domain dimer having two Fc domain monomers, wherein each Fc domain monomer independently is selected from (i) a human IgG1 Fc region consisting of mutations L234A, L235A, G237A, and N297A; (ii) a human IgG2 Fc region consisting of mutations A330S, P331S and N297A; or (iii) a human IgG4 Fc region comprising mutations S228P, E233P, F234V, L235A, delG236, and N297A.
  • At least one of the Fc domain monomers is a human IgG1 Fc region consisting of mutations L234A, L235A, G237A, and N297A. In some embodiments, at least one of the Fc domain monomers is a human IgG2 Fc region consisting of mutations A330S, P331S and N297A. In some embodiments, the Fc variant exhibits ablated or reduced binding to an Fc ⁇ receptor compared to the wild-type version of the human IgG Fc region.
  • the Fc variant exhibits ablated or reduced binding to CD16a, CD32a, CD32b, CD32c, and CD64 Fc ⁇ receptors compared to the wild-type version of the human IgG Fc region. In some embodiments, the Fc variant exhibits ablated or reduced binding to C1q compared to the wild-type version of the human IgG Fc fusion. In some embodiments, at least one of the Fc domain monomers is a human IgG4 Fc region comprising mutations S228P, E233P, F234V, L235A, delG236, and N297A.
  • the Fc variant exhibits ablated or reduced binding to a Fc ⁇ receptor compared to the wild-type human IgG4 Fc region. In some embodiments, the Fc variant exhibits ablated or reduced binding to CD16a and CD32b Fc ⁇ receptors compared to the wild-type version of its human IgG4 Fc region. In some embodiments, the Fc variant binds to an Fc ⁇ receptor with a K D greater than about 5 ⁇ 10 ⁇ 6 M. In some embodiments, the polypeptide further comprises a CD47 binding polypeptide. In some embodiments, the Fc variant exhibits ablated or reduced binding to an Fc ⁇ receptor compared to a wild-type version of a human IgG Fc region.
  • the CD47 binding polypeptide does not cause acute anemia in rodents and non-human primates. In some embodiments, the CD47 binding polypeptide does not cause acute anemia in humans. In some embodiments, the CD47 binding polypeptide is a signal-regulatory protein ⁇ (SIRP- ⁇ ) polypeptide or a fragment thereof.
  • SIRP- ⁇ signal-regulatory protein ⁇
  • the SIRP- ⁇ polypeptide comprises a SIRP- ⁇ D1 variant comprising the amino acid sequence, EEELQX 1 IQPDKSVLVAAGETATLRCTX 2 TSLX 3 PVGPIQWFRGAGPGRX 4 LIYNQX 5 EGX 6 FPR VTTVSDX 7 TKRNNMDFSIRIGX 8 ITPADAGTYYCX 9 KFRKGSPDDVEFKSGAGTELSVRAKPS (SEQ ID NO: 221), wherein X 1 is V or I; X 2 is A or I; X 3 is I or F; X 4 is E or V; X 5 is K or R; X 6 is H or P; X 7 is L or T; X 8 is any amino acid other than N; and X 9 is V or I.
  • the SIRP- ⁇ polypeptide comprises a SIRP- ⁇ D1 variant wherein X 1 is V or I; X 2 is A or I; X 3 is I or F; X 4 is E; X 5 is K or R; X 6 is H or P; X 7 is L or T; X 8 is not N; and X 9 is V.
  • polypeptides comprising: a signal-regulatory protein ⁇ (SIRP- ⁇ ) D1 variant, wherein the SIRP- ⁇ D1 variant is a non-naturally occurring high affinity SIRP- ⁇ D1 domain, wherein the SIRP- ⁇ D1 variant binds to human CD47 with an affinity that is at least 10-fold greater than the affinity of a naturally occurring D1 domain; and an Fc domain monomer, wherein the Fc domain monomer is linked to a second polypeptide comprising a second Fc domain monomer to form an Fc domain, wherein the Fc domain has ablated or reduced effector function.
  • the non-naturally occurring high affinity SIRP- ⁇ D1 domain comprises an amino acid mutation at residue 80.
  • polypeptides comprising a signal-regulatory protein ⁇ (SIRP- ⁇ ) D1 variant, wherein the SIRP- ⁇ D1 variant binds CD47 from a first species with a K D less than 250 nM; and wherein the SIRP- ⁇ D1 variant binds CD47 from a second species with a K D less than 250 nM; and the K D for CD47 from the first species and the K D for CD47 from the second species are within 100 fold of each other; wherein the first species and the second species are selected from the group consisting of: human, rodent, and non-human primate.
  • the SIRP- ⁇ D1 variant binds CD47 from at least 3 different species.
  • the non-human primate is cynomolgus monkey.
  • polypeptides comprising: (a) a signal-regulatory protein ⁇ (SIRP- ⁇ ) D1 domain that binds human CD47 with a K D less than 250 nM; and (b) an Fc domain monomer linked to the N-terminus or the C-terminus of the SIRP- ⁇ D1 domain, wherein the polypeptide does not cause acute anemia in rodents and non-human primates.
  • the polypeptide is a non-naturally occurring variant of a human SIRP- ⁇ .
  • administration of the polypeptide in vivo results in hemoglobin reduction by less than 50% during the first week after administration.
  • the polypeptide further comprises at least one Fc variant, wherein the Fc variant is selected from (i) a human IgG1 Fc region consisting of mutations L234A, L235A, G237A, and N297A; (ii) a human IgG2 Fc region consisting of mutations A330S, P331 S and N297A; or (iii) a human IgG4 Fc region comprising mutations S228P, E233P, F234V, L235A, delG236, and N297A.
  • Fc variant is selected from (i) a human IgG1 Fc region consisting of mutations L234A, L235A, G237A, and N297A; (ii) a human IgG2 Fc region consisting of mutations A330S, P331 S and N297A; or (iii) a human IgG4 Fc region comprising mutations S228P, E233P, F234V
  • the Fc variant is a human IgG1 Fc region consisting of mutations L234A, L235A, G237A, and N297A. In some embodiments, the Fc variant is a human IgG2 Fc region consisting of mutations A330S, P331S and N297A. In some embodiments, the Fc variant is a human IgG4 Fc region comprising mutations S228P, E233P, F234V, L235A, delG236, and N297A.
  • the polypeptide comprises a signal-regulatory protein ⁇ (SIRP- ⁇ ) D1 variant comprising a SIRP- ⁇ D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP- ⁇ D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP- ⁇ D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92.
  • SIRP- ⁇ signal-regulatory protein ⁇
  • the polypeptide comprises a signal-regulatory protein ⁇ (SIRP- ⁇ ) D1 variant, wherein the SIRP- ⁇ D1 variant comprises the amino acid sequence, EEX 1 X 2 QX 3 IQPDKX 4 VX 5 VAAGEX 6 X 7 X 8 X 9 CTX 10 TSLX 11 PVGPIQWFRGAGPX 12 RX 13 LIYNQ X 14 X 15 GX 16 FPRVTTVSX 17 X 18 TX 19 RX 20 NMDFX 21 IX 22 IX 23 X 24 ITX 25 ADAGTYYCX 26 KX 27 RKGS PDX 28 X 29 EX 30 KSGAGTELSVRX 31 KPS (SEQ ID NO: 47), wherein X 1 is E, or G; X 2 is L, I, or V; X 3 is V, L, or I; X 4 is S, or F; X 5 is L, or S; X 6 is S, or T; X 7 is A, or V;
  • the polypeptide comprises an Fc variant, wherein the Fc variant comprises an Fc domain dimer having two Fc domain monomers, wherein each Fc domain monomer independently is selected from (i) a human IgG1 Fc region consisting of mutations L234A, L235A, G237A, and N297A; (ii) a human IgG2 Fc region consisting of mutations A330S, P331S and N297A; or (iii) a human IgG4 Fc region comprising mutations S228P, E233P, F234V, L235A, delG236, and N297A.
  • the polypeptide comprises a signal-regulatory protein ⁇ (SIRP- ⁇ ) D1 variant, wherein the SIRP- ⁇ D1 variant is a non-naturally occurring high affinity SIRP- ⁇ D1 domain, wherein the SIRP- ⁇ D1 variant binds to human CD47 with an affinity that is at least 10-fold greater than the affinity of a naturally occurring D1 domain; and an Fc domain monomer, wherein the Fc domain monomer is linked to a second polypeptide comprising a second Fc domain monomer to form an Fc domain, wherein the Fc domain has ablated or reduced effector function.
  • the non-naturally occurring high affinity SIRP- ⁇ D1 domain comprises an amino acid mutation at residue 80.
  • the polypeptide comprises a signal-regulatory protein ⁇ (SIRP- ⁇ ) D1 variant, wherein the SIRP- ⁇ D1 variant binds CD47 from a first species with a K D less than 250 nM; and wherein the SIRP- ⁇ D1 variant binds CD47 from a second species with a K D less than 250 nM; and the K D for CD47 from the first species and the K D for CD47 from the second species are within 100 fold of each other; wherein the first species and the second species are selected from the group consisting of: human, rodent, and non-human primate.
  • SIRP- ⁇ signal-regulatory protein ⁇
  • the polypeptide comprises (a) a signal-regulatory protein ⁇ (SIRP- ⁇ ) D1 domain that binds human CD47 with a K D less than 250 nM; and (b) an Fc domain monomer linked to the N-terminus or the C-terminus of the SIRP- ⁇ D1 domain, wherein the polypeptide does not cause acute anemia in rodents and non-human primates.
  • the disease or disorder is a cancer, an autoimmune disease, or an inflammatory disease.
  • the disease or disorder is a cancer
  • the cancer is selected from solid tumor cancer, hematological cancer, acute myeloid leukemia, chronic lymphocytic leukemia, chronic myeloid leukemia, acute lymphoblastic leukemia, non-Hodgkin lymphoma, Hodgkin lymphoma, multiple myeloma, bladder cancer, pancreatic cancer, cervical cancer, endometrial cancer, lung cancer, bronchus cancer, liver cancer, ovarian cancer, colon and rectal cancer, stomach cancer, gastric cancer, gallbladder cancer, gastrointestinal stromal tumor cancer, thyroid cancer, head and neck cancer, oropharyngeal cancer, esophageal cancer, melanoma, non-melanoma skin cancer, Merkel cell carcinoma, virally induced cancer, neuroblastoma, breast cancer, prostate cancer, renal cancer, renal cell cancer, renal pelvis cancer, leukemia, lymphoma, sarcoma, glioma, brain tumor, and carcinoma.
  • the disease or disorder is an autoimmune disease or an inflammatory disease
  • the autoimmune disease or the inflammatory disease is selected from multiple sclerosis, rheumatoid arthritis, a spondyloarthropathy, systemic lupus erythematosus, an antibody-mediated inflammatory or autoimmune disease, graft versus host disease, sepsis, diabetes, psoriasis, atherosclerosis, Sjogren's syndrome, progressive systemic sclerosis, scleroderma, acute coronary syndrome, ischemic reperfusion, Crohn's Disease, endometriosis, glomerulonephritis, myasthenia gravis, idiopathic pulmonary fibrosis, asthma, acute respiratory distress syndrome (ARDS), vasculitis, and inflammatory autoimmune myositis.
  • multiple sclerosis rheumatoid arthritis, a spondyloarthropathy, systemic lupus erythematosus
  • the SIRP- ⁇ D1 variant has a sequence according to any one of SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159.
  • the method further comprises administering at least one additional agent.
  • the at least one additional agent is an antibody, tumor associated antigen, or a non-antibody therapeutic.
  • at least two additional agents are administered.
  • the at least two additional agents comprise two antibodies.
  • the at least two additional agents comprise an antibody and a tumor associated antigen.
  • the at least one additional agent is an antibody.
  • the antibody is a human IgG1 isotype antibody.
  • the antibody is a human IgG2 isotype antibody. In some embodiments, the antibody is a human IgG4 isotype antibody. In some embodiments, the antibody is selected from an anti-HER2 antibody, anti-CD20 antibody, anti-CD19 antibody, anti-CS1 antibody, anti-CD38 antibody, anti-EGFR antibody, anti-PD1 antibody, anti-OX40 antibody, anti-PD-1 antibody, anti-PD-L1 antibody, anti-CD274 antibody, anti-CTLA-4 antibody, anti-CD137 antibody, anti-4-1BB antibody, anti-B7-H3 antibody, anti-FZD7 antibody, anti-CD27 antibody, anti-CCR4 antibody, anti-CD38 antibody, anti-CSF1R antibody, anti-CSF antibody, anti-CD30 antibody, anti-BAFF antibody, anti-VEGF antibody, or anti-VEGFR2 antibody.
  • the antibody is selected from an anti-HER2 antibody, anti-CD20 antibody, anti-CD19 antibody, anti-CS1 antibody, anti-CD38 antibody, anti-PD-1 antibody, anti-RANKL antibody, or anti-PD-L1 antibody.
  • the at least one additional agent is at least one antibody and the antibody is selected from cetuximab, necitumumab, pembrolizumab, nivolumab, pidilizumab, MEDI0680, MED16469, atezolizumab, avelumab, durvalumab, MEDI6383, RG7888, ipilimumab, tremelimumab, urelumab, PF-05082566, enoblituzumab, vantictumab, varlilumab, mogamalizumab, SAR650984, daratumumab, trastuzumab, trastuzumab emtans
  • the antibody is trastuzumab.
  • the SIRP- ⁇ D1 variant has a sequence according to any one of SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159.
  • the antibody is rituximab.
  • the SIRP- ⁇ D1 variant has a sequence according to any one of SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159.
  • the antibody is cetuximab.
  • the SIRP- ⁇ D1 variant has a sequence according to any one of SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159.
  • the antibody is daratumumab.
  • the SIRP- ⁇ D1 variant has a sequence according to any one of SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159.
  • the antibody is belimumab.
  • the SIRP- ⁇ D1 variant has a sequence according to any one of SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159. In some embodiments, n the antibody is bevacizumab. In some embodiments, the SIRP- ⁇ D1 variant has a sequence according to any one of SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159. In some embodiments, the antibody is denosumab.
  • the SIRP- ⁇ D1 variant has a sequence according to any one of SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159.
  • the antibody is pantimumab.
  • the SIRP- ⁇ D1 variant has a sequence according to any one of SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159.
  • the antibody is ramucirumab.
  • the SIRP- ⁇ D1 variant has a sequence according to any one of SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159.
  • the antibody is necitumumab.
  • the SIRP- ⁇ D1 variant has a sequence according to any one of SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159.
  • the antibody is nivolumab.
  • the SIRP- ⁇ D1 variant has a sequence according to any one of SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159.
  • the antibody is pembrolizumab.
  • the SIRP- ⁇ D1 variant has a sequence according to any one of SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159.
  • the antibody is avelumab.
  • the SIRP- ⁇ D1 variant has a sequence according to any one of SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159.
  • the antibody is atezolizumab.
  • the SIRP- ⁇ D1 variant has a sequence according to any one of SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159.
  • the antibody is durvalumab.
  • the SIRP- ⁇ D1 variant has a sequence according to any one of SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159.
  • the antibody is MEDI0680.
  • the SIRP- ⁇ D1 variant has a sequence according to any one of SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159.
  • the antibody is pidilizumab.
  • the SIRP- ⁇ D1 variant has a sequence according to any one of SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159.
  • the antibody is BMS-93659.
  • the SIRP- ⁇ D1 variant has a sequence according to any one of SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159.
  • the at least one additional agent is a tumor associated antigen and the tumor associated antigen elicits an immune response.
  • the at least one additional agent is an antibody and the antibody targets a HLA/peptide or MHC/peptide complex.
  • the antibody targets a HLA/peptide or MHC/peptide complex comprising NY-ESO-1/LAGE1, SSX-2, MAGE family (MAGE-A3), gp100/pmel17, Melan-A/MART-1, gp75/TRP1, tyrosinase, TRP2, CEA, PSA, TAG-72, Immature laminin receptor, MOK/RAGE-1, WT-1, Her2/neu, EphA3, SAP-1, BING-4, Ep-CAM, MUC1, PRAME, survivin, Mesothelin, BRCA1/2 (mutated), CDK4, CML66, MART-2, p53 (mutated), Ras (mutated), ⁇ -catenin (mutated), TGF- ⁇ RII (mutated), HPV E6, or E7.
  • the antibody is ESK1,
  • FIG. 1 is an illustration of a SIRP- ⁇ construct including a SIRP- ⁇ D1 domain or variant thereof joined to a first Fc domain monomer, which forms an Fc domain with a second Fc domain monomer;
  • FIG. 2 is an illustration of a SIRP- ⁇ construct including a SIRP- ⁇ D1 domain or variant thereof joined to a first Fc domain monomer and an antibody variable domain joined to a second Fc domain monomer, wherein the first Fc domain monomer and the second Fc domain monomer combine to form an Fc domain;
  • FIG. 3 is an illustration of a SIRP- ⁇ construct including a SIRP- ⁇ D1 domain or variant thereof joined to a first Fc domain monomer and a therapeutic protein joined to a second Fc domain monomer, wherein the first Fc domain monomer and the second Fc domain monomer combine to form an Fc domain;
  • FIG. 4 A is an illustration of a SIRP- ⁇ construct including a SIRP- ⁇ D1 domain or variant thereof joined to a first Fc domain monomer having a knob mutation, which forms an Fc domain with a second Fc domain monomer having a hole mutation
  • FIG. 4 B is an illustration of a SIRP- ⁇ construct including a SIRP- ⁇ D1 domain or variant thereof joined to a first Fc domain monomer having a hole mutation, which forms an Fc domain with a second Fc domain monomer having a knob mutation;
  • FIG. 5 A is an illustration of a SIRP- ⁇ construct including a SIRP- ⁇ D1 domain or variant thereof joined to an Fc domain monomer
  • FIG. 5 B is an illustration of a SIRP- ⁇ construct which is a homodimer of the construct illustrated in FIG. 5 A ;
  • FIG. 6 exemplifies SPR binding data for monofunctional and bifunctional SIRP- ⁇ constructs including a SIRP- ⁇ D1 domain
  • FIG. 7 exemplifies phagocytosis of DLD-1-GFP-Luciferase tumor cells by human monocyte-derived macrophages in the presence of varying concentrations of SIRP- ⁇ polypeptide constructs;
  • FIG. 8 exemplifies phagocytosis of DLD-1-GFP-Luciferase tumor cells by human monocyte-derived macrophages in the presence of varying concentrations of SIRP- ⁇ polypeptide constructs;
  • FIG. 9 exemplifies phagocytosis of DLD-1-GFP-Luciferase tumor cells by human monocyte-derived macrophages in the presence of varying concentrations of SIRP- ⁇ polypeptide constructs;
  • FIG. 10 exemplifies half-life stability of SIRP- ⁇ polypeptides over a defined time period
  • FIG. 11 exemplifies hemagglutination assay data for SIRP- ⁇ polypeptide constructs
  • FIG. 12 exemplifies survival curves of mice syngeneic tumor models treated with SIRP- ⁇ polypeptide constructs and anti-mPD-L1;
  • FIG. 13 exemplifies a tumor volume analysis of mice syngeneic tumor models treated with SIRP- ⁇ polypeptide constructs in combination with anti-mPD-L1;
  • FIG. 14 exemplifies binding of various concentrations of C1q complement to SIRP- ⁇ -Fc fusions
  • FIG. 15 exemplifies phagocytosis of MM1R cells by human monocyte-derived macrophages in the presence of varying concentrations of SIRP- ⁇ polypeptide constructs
  • FIG. 16 exemplifies phagocytosis of MM1R cells by human monocyte-derived macrophages in the presence of varying concentrations of SIRP- ⁇ polypeptide constructs
  • FIG. 17 exemplifies phagocytosis of N87 cells by human monocyte-derived macrophages in the presence of varying concentrations of SIRP- ⁇ polypeptide constructs
  • FIG. 18 exemplifies molecular weight analysis of a SIRP- ⁇ D1 variant having a P83V mutation
  • FIG. 19 A exemplifies tumor growth of human GFP-Luc-Raji lymphoma cells in a NOD scid gamma (NSG) mouse model of cancer treated with various SIRP- ⁇ constructs with or without rituximab;
  • FIG. 19 B exemplifies a scatter plot of tumor volume of the tumors described in FIG. 19 A ;
  • FIG. 19 C exemplifies hemoglobin values of the treated mice described in FIG. 19 A ;
  • FIG. 20 exemplifies red blood cell counts taken from mice treated with either a SIRP- ⁇ wildtype IgG1 Fc construct or a SIRP- ⁇ IgG1 Fc variant construct.
  • the term “about” or “approximately” means within an acceptable error range for the particular value as determined by one of ordinary skill in the art, which will depend in part on how the value is measured or determined, i.e., the limitations of the measurement system. For example, “about” can mean within 1 or more than 1 standard deviation, per the practice in the art. Alternatively, “about” can mean a range of up to 20%, up to 10%, up to 5%, or up to 1% of a given value. Alternatively, particularly with respect to biological systems or processes, the term can mean within an order of magnitude, preferably within 5-fold, and more preferably within 2-fold, of a value. Where particular values are described in the application and claims, unless otherwise stated the term “about” meaning within an acceptable error range for the particular value should be assumed.
  • antibody refers to intact antibodies; antibody fragments, provided that they exhibit the desired biological activity (e.g. epitope binding); monoclonal antibodies; polyclonal antibodies; monospecific antibodies; multi-specific antibodies (e.g., bispecific antibodies); and antibody-like proteins.
  • antibody variable domain refers to the portions of the light and heavy chains of an antibody that include amino acid sequences of complementary determining regions (CDRs, e.g., CDR L1, CDR L2, CDR L3, CDR H1, CDR H2, and CDR H3) and framework regions (FRs).
  • CDRs complementary determining regions
  • FRs framework regions
  • linker refers to a linkage between two elements, e.g., protein domains.
  • a linker can be a covalent bond or a spacer.
  • spacer refers to a moiety (e.g., a polyethylene glycol (PEG) polymer) or an amino acid sequence (e.g., a 1-200 amino acid sequence) occurring between two polypeptides or polypeptide domains to provide space or flexibility (or both space and flexibility) between the two polypeptides or polypeptide domains.
  • an amino acid spacer is part of the primary sequence of a polypeptide (e.g., joined to the spaced polypeptides or polypeptide domains via the polypeptide backbone).
  • the term “therapeutically effective amount” refers to an amount of a polypeptide or a pharmaceutical composition containing a polypeptide described herein, e.g., a polypeptide having a SIRP- ⁇ D1 domain or variant thereof, that is sufficient and effective in achieving a desired therapeutic effect in treating a patient having a disease, such as a cancer, e.g., solid tumor or hematological cancer.
  • a therapeutically effective amount of polypeptide will avoid adverse side effects.
  • the term “pharmaceutical composition” refers to a medicinal or pharmaceutical formulation that includes an active ingredient as well as excipients or diluents (or both excipients and diluents) and enables the active ingredient to be administered by suitable methods of administration.
  • the pharmaceutical compositions disclosed herein include pharmaceutically acceptable components that are compatible with the polypeptide.
  • the pharmaceutical composition is in tablet or capsule form for oral administration or in aqueous form for intravenous or subcutaneous administration, for example by injection.
  • the terms “subject,” “individual,” and “patient” are used interchangeably to refer to a vertebrate, for example, a mammal. Mammals include, but are not limited to, murines, simians, humans, farm animals, sport animals, and pets. Tissues, cells, and their progeny of a biological entity obtained in vivo or cultured in vitro are also encompassed. None of the terms entail supervision of a medical professional.
  • binding affinity refers to the strength of the binding interaction between two molecules.
  • binding affinity refers to the strength of the sum total of non-covalent interactions between a molecule and its binding partner, such as a high affinity SIRP- ⁇ D1 variant and CD47.
  • binding affinity refers to intrinsic binding affinity, which reflects a 1:1 interaction between members of a binding pair.
  • the binding affinity between two molecules is commonly described by the dissociation constant (K D ) or the association constant (K A ). Two molecules that have low binding affinity for each other generally bind slowly, tend to dissociate easily, and exhibit a large K D .
  • K D Two molecules that have high affinity for each other generally bind readily, tend to remain bound longer, and exhibit a small K D .
  • the K D of two interacting molecules is determined using known methods and techniques, e.g., surface plasmon resonance (SPR). K D can be calculated as the ratio of k off /k on .
  • K D less than refers to a numerically smaller K D value and an increasing binding affinity relative to the recited K D value.
  • K D greater than refers to a numerically larger K D value and a decreasing binding affinity relative to the recited K D value.
  • acute anemia refers to a decrease of red blood cell mass or hemoglobin of 30% during the first five days after administration of a compound or treatment.
  • SIRP- ⁇ Signal-Regulatory Protein ⁇
  • polypeptides comprising a signal-regulatory protein ⁇ (SIRP- ⁇ ) D1 variant comprising a SIRP- ⁇ D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP- ⁇ D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP- ⁇ D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92.
  • SIRP- ⁇ signal-regulatory protein ⁇
  • polypeptides comprising an Fc variant, wherein the Fc variant comprises an Fc domain dimer having two Fc domain monomers, wherein each Fc domain monomer independently is selected from (i) a human IgG1 Fc region consisting of mutations L234A, L235A, G237A, and N297A; (ii) a human IgG2 Fc region consisting of mutations A330S, P331S and N297A; or (iii) a human IgG4 Fc region comprising mutations S228P, E233P, F234V, L235A, delG236, and N297A.
  • SIRP- ⁇ Signal-regulatory protein ⁇
  • SIRP- ⁇ is a transmembrane glycoprotein belonging to the Ig superfamily that is widely expressed on the membrane of myeloid cells.
  • SIRP- ⁇ interacts with CD47, a protein broadly expressed on many cell types in the body. The interaction of SIRP- ⁇ with CD47 prevents engulfment of “self” cells, which can otherwise be recognized by the immune system. It has been observed that high CD47 expression on tumor cells can act, in acute myeloid leukemia and several solid tumor cancers, as a negative prognostic factor for survival.
  • SIRP- ⁇ comprises 3 highly homologous immunoglobulin (Ig)-like extracellular domains—D1, D2, and D3.
  • the SIRP- ⁇ D1 domain (“D1 domain”) refers to the membrane distal, extracellular domain of SIRP- ⁇ and mediates binding of SIRP- ⁇ to CD47.
  • SIRP- ⁇ polypeptide refers to any SIRP- ⁇ polypeptide or fragment thereof that is capable of binding to CD47.
  • Table 1 shows the amino acid sequences of the D1 domains of the ten naturally occurring wild-type human SIRP- ⁇ D1 domain variants (SEQ ID NOs: 1-10).
  • a SIRP- ⁇ polypeptide comprises a SIRP- ⁇ D1 domain. In some embodiments, a SIRP- ⁇ polypeptide comprises a wild-type D1 domain, such as those provided in SEQ ID NOs: 1-10. In some embodiments, a SIRP- ⁇ polypeptide includes a D2 or D3 domain (or both a D2 and a D3 domain) (Table 3) of a wild-type human SIRP- ⁇ .
  • high affinity SIRP- ⁇ D1 variant refers to a polypeptide comprising a SIRP- ⁇ D1 domain or a CD47-binding portion of a SIRP- ⁇ polypeptide that has a higher affinity to CD47 than wild-type SIRP- ⁇ .
  • a high affinity SIRP- ⁇ D1 variant comprises at least one amino acid substitution, deletion, or insertion (or a combination thereof) relative to a wild-type SIRP- ⁇ .
  • high affinity SIRP- ⁇ D1 variants disclosed herein comprise a SIRP- ⁇ D1 domain or variant thereof.
  • a high affinity SIRP- ⁇ D1 variant comprises one or more amino acid substitutions, insertions, additions, or deletions relative to a wild-type D1 domain shown in SEQ ID NOs: 1-10.
  • Table 2 lists exemplary amino acid substitutions in each SIRP- ⁇ D1 domain variant (SEQ ID NOs: 13-22).
  • the SIRP- ⁇ D1 domain polypeptide or high affinity SIRP- ⁇ D1 variant comprises a fragment of the D1 domain.
  • the SIRP- ⁇ polypeptide fragment or high affinity SIRP- ⁇ variant fragment comprises an amino acid sequence of less than 10 amino acids in length, about 10 amino acids in length, about 20 amino acids in length, about 30 amino acids in length, about 40 amino acids in length, about 50 amino acids in length, about 60 amino acids in length, about 70 amino acids in length, about 80 amino acids in length, about 90 amino acids in length, about 100 amino acids in length, or more than about 100 amino acids in length.
  • the SIRP- ⁇ D1 domain fragments retain the ability to bind to CD47.
  • a polypeptide of the disclosure comprising a high affinity SIRP- ⁇ D1 variant binds with higher binding affinity to CD47 than a wild-type human SIRP- ⁇ D1 domain.
  • the high affinity SIRP- ⁇ D1 variant binds to human CD47 with at least 1-fold (e.g., at least 1.5-fold, 2-fold, 2.5-fold, 3-fold, 3.5-fold, 4-fold, 5-fold or greater than 5-fold) affinity than the affinity of a naturally occurring D1 domain.
  • the high affinity SIRP- ⁇ D1 variant binds to human CD47 with at least 1-fold (e.g., at least 10-fold, 100-fold, 1000-fold or greater than 1000-fold) affinity than the affinity of a naturally occurring D1 domain.
  • the term “optimized affinity” or “optimized binding affinity” refers to an optimized strength of the binding interaction between a polypeptide disclosed herein, including a high affinity SIRP- ⁇ D1 variant, and CD47.
  • the polypeptide binds primarily or with higher affinity to CD47 on cancer cells and does not substantially bind or binds with lower affinity to CD47 on non-cancer cells.
  • the binding affinity between the polypeptide and CD47 is optimized such that the interaction does not cause clinically relevant toxicity or decreases toxicity compared to a variant which binds with maximal affinity.
  • the polypeptide including a high affinity SIRP- ⁇ D1 variant in order to achieve an optimized binding affinity between a polypeptide provided herein and CD47, the polypeptide including a high affinity SIRP- ⁇ D1 variant is developed to have a lower binding affinity to CD47 than which is maximally achievable.
  • the high affinity SIRP- ⁇ variants disclosed herein cross react with rodent, non-human primate (NHP), and human CD47.
  • immunogenicity refers to the property of a protein (e.g., a therapeutic protein) which causes an immune response in the host as though it is a foreign antigen.
  • the immunogenicity of a protein can be assayed in vitro in a variety of different ways, such as through in vitro T-cell proliferation assays.
  • minimal immunogenicity refers to an immunogenicity of a protein (e.g., a therapeutic protein) that has been modified, e.g., through amino acid substitutions, to be lower (e.g., at least 10%, 25%, 50%, or 100% lower) than the immunogenicity before the amino acid substitutions are introduced (e.g., an unmodified protein).
  • a protein e.g., a therapeutic protein
  • a protein is modified to have minimal immunogenicity and causes no or very little host immune response even though it is a foreign antigen.
  • the high affinity SIRP- ⁇ D1 variant has minimal immunogenicity.
  • a SIRP- ⁇ polypeptide of the disclosure administered to a subject has the same amino acid sequence as that of the SIRP- ⁇ polypeptide in a biological sample of the subject, except for amino acid changes which increase affinity of the SIRP- ⁇ D1 variant.
  • the polypeptide variants disclosed herein lower the risk of side effects compared to anti-CD47 antibodies or wild-type SIRP- ⁇ .
  • the polypeptide variants disclosed herein lower the risk of anemia compared to anti-CD47 antibodies or wild-type SIRP- ⁇ .
  • the polypeptide variants disclosed herein do not cause acute anemia in rodent or non-human primates (NHP) studies.
  • Table 2 lists specific amino acid substitutions in a high affinity SIRP- ⁇ D1 variant relative to each D1 domain sequence.
  • a high affinity SIRP- ⁇ D1 variant includes one or more (e.g., two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen or more) of the substitutions listed in Table 2.
  • a high affinity SIRP- ⁇ D1 variant includes at most fourteen amino acid substitutions relative to a wild-type D1 domain.
  • a high affinity SIRP- ⁇ D1 variant includes at most ten amino acid substitutions relative to a wild-type D1 domain.
  • a high affinity SIRP- ⁇ D1 variant includes at most seven amino acid substitutions relative to a wild-type D1 domain. In some embodiments, a high affinity SIRP- ⁇ D1 variant of the disclosure has at least 90% (e.g., at least 92%, 95%, 97% or greater than 97%) amino acid sequence identity to a sequence of a wild-type D1 domain.
  • a high affinity SIRP- ⁇ D1 variant is a chimeric high affinity SIRP- ⁇ D1 variant that includes a portion of two or more wild-type D1 domains or variants thereof (e.g., a portion of one wild-type D1 domain or variant thereof and a portion of another wild-type D1 domain or variant thereof).
  • a chimeric high affinity SIRP- ⁇ D1 variant includes at least two portions (e.g., three, four, five or more portions) of wild-type D1 domains or variants thereof, wherein each of the portions is from a different wild-type D1 domain.
  • a chimeric high affinity SIRP- ⁇ D1 variant further includes one or more amino acid substitutions listed in Table 2.
  • a polypeptide includes a SIRP- ⁇ D1 variant having a sequence of: EEEX 1 QX 2 IQPDKSVLVAAGETX 3 TLRCTX 4 TSLX 5 PVGPIQWFRGAGPGRX 6 LIYNQX 7 X 8 GX 9 F PRVTTVSDX 10 TX 11 RNNMDFSIRIGNITPADAGTYYCX 12 KX 13 RKGSPDDVEX 14 KSGAGTELS VRAKPS (SEQ ID NO: 13), wherein X 1 is L, I, or V; X 2 is V, L, or, I; X 3 is A or V; X 4 is A, I, or L; X 5 is I, T, S, or F; X 6 is E, V, or L; X 7 is K or R; X 8 is E or Q; X 9 is H, P, or R; X 10 is L, T, or G; X 11 is K or R; X 12 is V or I; X 13 is F, L,
  • a polypeptide includes a SIRP- ⁇ D1 variant having a sequence of: EEGX 1 QX 2 IQPDKSVSVAAGESX 3 ILHCTX 4 TSLX 5 PVGPIQWFRGAGPGRX 6 LIYNQX 7 X 8 GX 9 F PRVTTVSDX 10 TX 11 RNNMDFSIRIGNITPADAGTYYCX 12 KX 13 RKGSPDDVEX 14 KSGAGTELS VRAKPS (SEQ ID NO: 16), wherein X 1 is L, I, or V; X 2 is V, L, or, I; X 3 is A or V; X 4 is A, I, or L; X 5 is I, T, S, or F; X 6 is E, V, or L; X 7 is K or R; X 8 is E or Q; X 9 is H, P, or R; X 10 is L, T, or G; X 11 is K or R; X 12 is V or I; X 13 is F, L
  • a polypeptide includes a SIRP- ⁇ D1 variant having a sequence of: EEEX 1 QX 2 IQPDKFVLVAAGETX 3 TLRCTX 4 TSLX 5 PVGPIQWFRGAGPGRX 6 LIYNQX 7 X 8 GX 9 F PRVTTVSDX 10 TX 11 RNNMDFSIRIGNITPADAGTYYCX 12 KX 13 RKGSPDDVEX 14 KSGAGTELS VRAKPS (SEQ ID NO: 17), wherein X 1 is L, I, or V; X 2 is V, L, or, I; X 3 is A or V; X 4 is A, I, or L; X 5 is I, T, S, or F; X 6 is E, V, or L; X 7 is K or R; X 8 is E or Q; X 9 is H, P, or R; X 10 is L, T, or G; X 11 is K or R; X 12 is V or I; X 13 is F, L
  • a polypeptide includes a SIRP- ⁇ D1 variant having a sequence of: EEEX 1 QX 2 IQPDKSVLVAAGETX 3 TLRCTX 4 TSLX 5 PVGPIQWFRGAGPGRX 6 LIYNQX 7 X 8 GX 9 F PRVTTVSDX 10 TX 11 RNNMDFPIRIGNITPADAGTYYCX 12 KX 13 RKGSPDDVEX 14 KSGAGTELS VRAKPS (SEQ ID NO: 18), wherein X 1 is L, I, or V; X 2 is V, L, or, I; X 3 is A or V; X 4 is A, I, or L; X 5 is I, T, S, or F; X 6 is E, V, or L; X 7 is K or R; X 8 is E or Q; X 9 is H, P, or R; X 10 is L, T, or G; X 11 is K or R; X 12 is V or I; X 13 is F, L,
  • a polypeptide includes a SIRP- ⁇ D1 variant having a sequence of: EEEX 1 QX 2 IQPDKSVLVAAGETX 3 TLRCTX 4 TSLX 5 PVGPIQWFRGAGPGRX 6 LIYNQX 7 X 8 GX 9 F PRVTTVSDX 10 TX 11 RNNMDFSIRISNITPADAGTYYCX 12 KX 13 RKGSPDDVEX 14 KSGAGTELS VRAKPS (SEQ ID NO: 21), wherein X 1 is L, I, or V; X 2 is V, L, or, I; X 3 is A or V; X 4 is A, I, or L; X 5 is I, T, S, or F; X 6 is E, V, or L; X 7 is K or R; X 8 is E or Q; X 9 is H, P, or R; X 10 is L, T, or G; X 11 is K or R; X 12 is V or I; X 13 is F, L,
  • a polypeptide includes a high affinity SIRP- ⁇ D1 variant having a sequence of any one of SEQ ID NOs: 13, 16-18, and 21, wherein X 1 is L, I, or V.
  • X 2 is V, L, or, I.
  • X 3 is A or V.
  • X 4 is A, I, or L.
  • X 5 is I, T, S, or F.
  • X 6 is E, V, or L.
  • X 7 is K or R.
  • X 8 is E or Q.
  • X 9 is H, P, or R.
  • X 10 is L, T, or G.
  • X 11 is K or R.
  • X 12 is V or I.
  • X 13 is F, L, V.
  • X 14 is F or V.
  • the polypeptide of this aspect of the disclosure includes no more than six amino acid substitutions relative to the wild-type SIRP- ⁇ D1 domain having the sequence of any one of SEQ ID NOs: 1, 4-6, and 9.
  • the polypeptide binds CD47 with at least 10-fold greater binding affinity than the wild-type SIRP- ⁇ D1 domain having the sequence of any one of SEQ ID NOs: 1, 4-6, and 9. In some embodiments, the polypeptide binds CD47 with at least 100-fold greater binding affinity than the wild-type SIRP- ⁇ D1 domain having the sequence of any one of SEQ ID NOs: 1, 4-6, and 9. In some embodiments, the polypeptide binds CD47 with at least 1000-fold greater binding affinity than the wild-type SIRP- ⁇ D1 domain having the sequence of any one of SEQ ID NOs: 1, 4-6, and 9.
  • a SIRP- ⁇ D1 variant polypeptide or fragment thereof binds to CD47 with a K D less than 1 ⁇ 10 ⁇ 8 M, less than 5 ⁇ 10 ⁇ 9 M, less than 1 ⁇ 10 ⁇ 9 M, less 5 ⁇ 10 ⁇ 10 M, less than 1 ⁇ 10 ⁇ 10 M or less than 1 ⁇ 10 ⁇ 11 M.
  • a SIRP- ⁇ D1 variant polypeptide or fragment thereof binds to CD47 with a K D between about 500 nM and 100 nM, between about 100 nM and 50 nM, between about 50 nM and 10 nM, between about 10 nM and 5 nM, between about 5 nM and 1 nM, between about 1 nM and 500 pM, between about 500 pM and 100 pM, between about 100 pM and 50 pM, or between about 50 pM and 10 pM.
  • a polypeptide includes a SIRP- ⁇ D1 variant having a sequence of: EEEX 1 QX 2 IQPDKSVSVAAGESX 3 ILHCTX 4 TSLX 5 PVGPIQWFRGAGPARX 6 LIYNQX 7 X 8 GX 9 F PRVTTVSEX 10 TX 11 RENMDFSISISNITPADAGTYYCX 12 KX 13 RKGSPDTEX 14 KSGAGTELSVR AKPS (SEQ ID NO: 14), wherein X 1 is L, I, or V; X 2 is V, L, or, I; X 3 is A or V; X 4 is V, I, or L; X 5 is I, T, S, or F; X 6 is E, V, or L; X 7 is K or R; X 8 is E or Q; X 9 is H, P, or R; X 10 is S, T, or G; X 11 is K or R; X 12 is V or I; X 13 is F, L
  • a polypeptide includes a SIRP- ⁇ D1 variant having a sequence of: EEEX 1 QX 2 IQPDKSVSVAAGESX 3 ILLCTX 4 TSLX 5 PVGPIQWFRGAGPARX 6 LIYNQX 7 X 8 GX 9 FP RVTTVSEX 10 TX 11 RENMDFSISISNITPADAGTYYCX 12 KX 13 RKGSPDTEX 14 KSGAGTELSVRA KPS (SEQ ID NO: 15), wherein X 1 is L, I, or V; X 2 is V, L, or, I; X 3 is A or V; X 4 is V, I, or L; X 5 is I, T, S, or F; X 6 is E, V, or L; X 7 is K or R; X 8 is E or Q; X 9 is H, P, or R; X 10 is S, T, or G; X 11 is K or R; X 12 is V or I; X 13 is F, L
  • a polypeptide includes a SIRP- ⁇ D1 variant having a sequence of: EEEX 1 QX 2 IQPDKSVSVAAGESX 3 ILHCTX 4 TSLX 5 PVGPIQWFRGAGPARX 6 LIYNQX 7 X 8 GX 9 F PRVTTVSEX 10 TX 11 RENMDFSISISNITPADAGTYYCX 12 KX 13 RKGSPDTEX 14 KSGAGTELSVR GKPS (SEQ ID NO: 19), wherein X 1 is L, I, or V; X 2 is V, L, or, I; X 3 is A or V; X 4 is V, I, or L; X 5 is I, T, S, or F; X 6 is E, V, or L; X 7 is K or R; X 8 is E or Q; X 9 is H, P, or R; X 10 is S, T, or G; X 11 is K or R; X 12 is V or I; X 13 is F, L
  • a polypeptide includes a SIRP- ⁇ D1 variant having a sequence of: EEEX 1 QX 2 IQPDKSVSVAAGESX 3 ILHCTX 4 TSLX 5 PVGPIQWFRGAGPARX 6 LIYNQX 7 X 8 GX 9 F PRVTTVSEX 10 TX 11 RENMDFSISISNITPADAGTYYCX 12 KX 13 RKGSPDTEX 14 KSGAGTELSVR AKPS (SEQ ID NO: 22), wherein X 1 is L, I, or V; X 2 is V, L, or, I; X 3 is A or V; X 4 is V, I, or L; X 5 is I, T, S, or F; X 6 is E, V, or L; X 7 is K or R; X 8 is E or Q; X 9 is H, P, or R; X 10 is S, T, or G; X 11 is K or R; X 12 is V or I; X 13 is F, L
  • the polypeptide has the sequence of any one of SEQ ID NOs: 14, 15, 19, and 22, wherein X 1 is L, I, or V.
  • X 2 is V, L, or, I.
  • X 3 is A or V.
  • X 4 is V, I, or L.
  • X 5 is I, T, S, or F.
  • X 6 is E, V, or L.
  • X 7 is K or R.
  • X 8 is E or Q.
  • X 9 is H, P, or R.
  • X 10 is S, T, or G.
  • X 11 is K or R.
  • X 12 is V or I.
  • X 13 is F, L, or V.
  • X 14 is F or V.
  • the polypeptide of this aspect of the disclosure includes no more than six amino acid substitutions relative to the wild-type SIRP- ⁇ D1 domain having the sequence of any one of SEQ ID NOs: 2, 3, 7, and 10.
  • the polypeptide binds CD47 with at least 10-fold greater binding affinity than the wild-type SIRP- ⁇ D1 domain having the sequence of any one of SEQ ID NOs: 2, 3, 7, and 10. In some embodiments, the polypeptide binds CD47 with at least 100-fold greater binding affinity than the wild-type SIRP- ⁇ D1 domain having the sequence of any one of SEQ ID NOs: 2, 3, 7, and 10. In some embodiments, the polypeptide binds CD47 with at least 1000-fold greater binding affinity than the wild-type SIRP- ⁇ D1 domain having the sequence of any one of SEQ ID NOs: 2, 3, 7, and 10.
  • a SIRP- ⁇ D1 variant polypeptide or fragment thereof binds to CD47 with a K D less than 1 ⁇ 10 ⁇ 8 M, less than 5 ⁇ 10 ⁇ 9 M, less than 1 ⁇ 10 ⁇ 9 M, less 5 ⁇ 10 ⁇ 10 M, less than 1 ⁇ 10 ⁇ 10 M or less than 1 ⁇ 10 ⁇ 11 M.
  • a SIRP- ⁇ D1 variant polypeptide or fragment thereof binds to CD47 with a K D between about 500 nM and 100 nM, between about 100 nM and 50 nM, between about 50 nM and 10 nM, between about 10 nM and 5 nM, between about 5 nM and 1 nM, between about 1 nM and 500 pM, between about 500 pM and 100 pM, between about 100 pM and 50 pM, or between about 50 pM and 10 pM.
  • a polypeptide includes a SIRP- ⁇ D1 variant having a sequence of: EEEX 1 QX 2 IQPDKSVLVAAGETX 3 TLRCTX 4 TSLX 5 PVGPIQWFRGAGPARX 6 LIYNQX 7 X 8 GX 9 F PRVTTVSEX 10 TX 11 RENMDFSISISNITPADAGTYYCX 12 KX 13 RKGSPDTEX 14 KSGAGTELSVR AKPS (SEQ ID NO: 20), wherein X 1 is L, I, or V; X 2 is V, L, or, I; X 3 is A or V; X 4 is A, I, or L; X 5 is I, T, S, or F; X 6 is E, V, or L; X 7 is K or R; X 8 is E or Q; X 9 is H, P, or R; X 10 is S, T, or G; X 11 is K or R; X 12 is V or I; X 13 is F, L,
  • the polypeptide has the sequence of SEQ ID NO: 20, wherein X 1 is L, I, or V.
  • X 2 is V, L, or, I.
  • X 3 is A or V.
  • X 4 is A, I, or L.
  • X 5 is I, T, S, or F.
  • X 6 is E, V, or L.
  • X 7 is K or R.
  • X 8 is E or Q.
  • X 9 is H, P, or R.
  • X 10 is S, T, or G.
  • X 11 is K or R.
  • X 12 is V or I.
  • X 13 is F, L, or V.
  • X 14 is F or V.
  • the polypeptide of this aspect of the disclosure includes no more than six amino acid substitutions relative to the wild-type SIRP- ⁇ D1 domain having the sequence of SEQ ID NO: 8.
  • the polypeptide binds CD47 with at least 10-fold greater binding affinity than the wild-type SIRP- ⁇ D1 domain having the sequence of SEQ ID NO: 8. In some embodiments, the polypeptide binds CD47 with at least 100-fold greater binding affinity than the wild-type SIRP- ⁇ D1 domain having the sequence of SEQ ID NO: 8. In some embodiments, the polypeptide binds CD47 with at least 1000-fold greater binding affinity than the wild-type SIRP- ⁇ D1 domain having the sequence of SEQ ID NO: 8.
  • a SIRP- ⁇ D1 variant polypeptide or fragment thereof binds to CD47 with a K D less than 1 ⁇ 10 ⁇ 8 M, less than 5 ⁇ 10 ⁇ 9 M, less than 1 ⁇ 10 ⁇ 9 M, less 5 ⁇ 10 ⁇ 10 M, less than 1 ⁇ 10 ⁇ 10 M or less than 1 ⁇ 10 ⁇ 11 M.
  • a SIRP- ⁇ D1 variant polypeptide or fragment thereof binds to CD47 with a K D between about 500 nM and 100 nM, between about 100 nM and 50 nM, between about 50 nM and 10 nM, between about 10 nM and 5 nM, between about 5 nM and 1 nM, between about 1 nM and 500 pM, between about 500 pM and 100 pM, between about 100 pM and 50 pM, or between about 50 pM and 10 pM.
  • a polypeptide includes a SIRP- ⁇ D1 variant having a sequence of: EEX 1 X 2 QX 3 IQPDKX 4 VX 5 VAAGEX 6 X 7 X 8 LX 9 CTX 10 TSLX 11 PVGPIQWFRGAGPX 12 RX 13 LIYNQ X 14 X 15 GX 16 FPRVTTVSX 17 X 18 TX 19 RX 20 NMDFX 21 IX 22 IX 23 NITPADAGTYYCX 24 KX 25 RKGSPDX 26 X 27 EX 28 KSGAGTELSVRX 29 KPS (SEQ ID NO: 23), wherein X 1 is E or G; X 2 is L, I, or V; X 3 is V, L, or, I; X 4 is S or F; X 5 is L or S; X 6 is S or T; X 7 is A or V; X 8 is I or T; X 9 is H or R; X 10 is A, V, I, or L;
  • X 2 is L, I, or V.
  • X 3 is V, L, or, I.
  • X 4 is S or F.
  • X 5 is L or S.
  • X 6 is S or T.
  • X 7 is A or V.
  • X 8 is I or T.
  • X 9 is H or R.
  • X 10 is A, V, I, or L.
  • X 11 is I, T, S, or F.
  • X 12 is A or G.
  • X 13 is E, V, or L.
  • X 14 is K or R.
  • X 15 is E or Q.
  • X 16 is H, P, or R.
  • X 17 is D or E.
  • X 18 is S, L, T, or G.
  • X 19 is K or R.
  • X 20 is E or D.
  • X 21 is S or P.
  • X 22 is S or R.
  • X 23 is S or G.
  • X 24 is V or I.
  • X 25 is F, L, V.
  • X 26 is D or absent.
  • X 27 is T or V.
  • X 28 is F or V.
  • X 29 is A or G.
  • the polypeptide of this aspect of the disclosure includes no more than six amino acid substitutions relative to the wild-type SIRP- ⁇ D1 domain having the sequence of any one of SEQ ID NOs: 1-10.
  • the polypeptide binds CD47 with at least 10-fold greater binding affinity than the wild-type SIRP- ⁇ D1 domain having the sequence of any one of SEQ ID NOs: 1-10. In some embodiments, the polypeptide binds CD47 with at least 100-fold greater binding affinity than the wild-type SIRP- ⁇ D1 domain having the sequence of any one of SEQ ID NOs: 1-10. In some embodiments, the polypeptide binds CD47 with at least 1000-fold greater binding affinity than the wild-type SIRP- ⁇ D1 domain having the sequence of any one of SEQ ID NOs: 1-10.
  • a SIRP- ⁇ D1 variant polypeptide or fragment thereof binds to CD47 with a K D less than 1 ⁇ 10 ⁇ 8 M, less than 5 ⁇ 10 ⁇ 9 M, less than 1 ⁇ 10 ⁇ 9 M, less 5 ⁇ 10 ⁇ 10 M, less than 1 ⁇ 10 ⁇ 10 M or less than 1 ⁇ 10 ⁇ 11 M.
  • a SIRP- ⁇ D1 variant polypeptide or fragment thereof binds to CD47 with a K D between about 500 nM and 100 nM, between about 100 nM and 50 nM, between about 50 nM and 10 nM, between about 10 nM and 5 nM, between about 5 nM and 1 nM, between about 1 nM and 500 pM, between about 500 pM and 100 pM, between about 100 pM and 50 pM, or between about 50 pM and 10 pM.
  • a polypeptide of the disclosure including a high affinity SIRP- ⁇ D1 variant further comprises a D2 domain having the sequence of SEQ ID NO: 24, a D3 domain having the sequence of SEQ ID NO: 25, or a D2 domain having the sequence of SEQ ID NO: 24 and a D3 domain having the sequence of SEQ ID NO: 25 of a wild-type human SIRP- ⁇ as shown in Table 3.
  • the high affinity SIRP- ⁇ D1 variant further comprises a fragment or variant of a D2 domain or a fragment or variant of a D3 domain.
  • the high affinity SIRP- ⁇ D1 variant further comprises a fragment or variant of a D2 domain and a fragment or variant of a D3 domain.
  • a high affinity SIRP- ⁇ D1 variant is joined to a D2 or D3 domain by way of a linker. In some embodiments, a high affinity SIRP- ⁇ D1 variant is joined to a D2 and D3 domain by way of a linker.
  • a polypeptide of the disclosure including a high affinity SIRP- ⁇ D1 variant is attached to an Fc domain monomer, a human serum albumin (HSA) or variant thereof, a serum-binding protein or peptide, or an organic molecule, e.g., a polymer (e.g., a PEG polymer), in order to improve the pharmacokinetic properties of the polypeptide, e.g., increase serum half-life.
  • a high affinity SIRP- ⁇ D1 variant is attached to an Fc domain monomer that is unable to dimerize.
  • Fc domain monomers, HSA proteins, serum-binding proteins or peptides, and organic molecules such as a PEG serve to increase the serum half-life of the polypeptides described herein.
  • a polypeptide of the disclosure including a high affinity SIRP- ⁇ D1 variant does not include the sequence of any one of SEQ ID NOs: 26-36 shown in Table 4.
  • polypeptides and polypeptide constructs described herein are utilized in vitro for binding assays, such as immune assays.
  • the polypeptides and polypeptide constructs described herein are utilized in liquid phase or bound to a solid phase carrier.
  • polypeptides utilized for immunoassays are detectably labeled in various ways.
  • polypeptides and polypeptide constructs described herein are bound to various carriers and used to detect the presence of specific antigen expressing cells.
  • carriers include glass, polystyrene, polypropylene, polyethylene, dextran, nylon, amylases, natural and modified celluloses, polyacrylamides, agaroses, and magnetite.
  • the nature of the carrier can be either soluble or insoluble.
  • labels include enzymes, radioisotopes, fluorescent compounds, colloidal metals, chemiluminescent compounds, and bio-luminescent compounds.
  • Various techniques for binding labels to polypeptides disclosed herein are available.
  • the polypeptides are coupled to low molecular weight haptens. These haptens are then specifically detected by means of a second reaction.
  • the hapten biotin is used with avidin or the haptens dinitrophenol, pyridoxal, or fluorescein are detected with specific anti-hapten antibodies (e.g., anti-dinitrophenol antibodies, anti-pyridoxal antibodies, and anti-fluorescein antibodies respectively).
  • polypeptides comprising a signal-regulatory protein ⁇ (SIRP- ⁇ ) D1 variant comprising a SIRP- ⁇ D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP- ⁇ D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP- ⁇ D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92.
  • SIRP- ⁇ signal-regulatory protein ⁇
  • polypeptides comprising an Fc variant, wherein the Fc variant comprises an Fc domain dimer having two Fc domain monomers, wherein each Fc domain monomer independently is selected from (i) a human IgG1 Fc region consisting of mutations L234A, L235A, G237A, and N297A; (ii) a human IgG2 Fc region consisting of mutations A330S, P331S and N297A; or (iii) a human IgG4 Fc region comprising mutations S228P, E233P, F234V, L235A, delG236, and N297A.
  • a polypeptide in a composition disclosed herein comprises a high affinity SIRP- ⁇ D1 variant that has reduced or minimal glycosylation.
  • the D1 domain of each of the ten wild-type human SIRP- ⁇ proteins contains a single potential N-linked glycosylation site at amino acid N80 in the sequence N80ITP.
  • Expression of a SIRP- ⁇ D1 domain in Chinese Hamster Ovary (CHO) cells results in a major band of 16 kDa (non-glycosylated) and a minor band of higher molecular weight that was removed by Endo Hf.
  • Endo Hf is a recombinant protein fusion of Endoglycosidase H and maltose binding protein. Endo Hf cleaves within the chitobiose core of high mannose and some hybrid oligosaccharides from N-linked glycoproteins. This implies that a proline at amino acid position 83 can reduce the efficiency of glycosylation, leading to a protein with different degrees of glycosylation and therefore heterogeneity. For drug development, heterogeneity can give rise to challenges in process development. Therefore, to investigate the possibility of generating homogenous, non-glycosylated forms of high affinity SIPR- ⁇ D1 variants, in some embodiments, amino acid N80 of a SIPR- ⁇ D1 variant is mutated to Ala.
  • amino acid N80 in a high affinity SIRP- ⁇ D1 variant is replaced by any amino acid, including any naturally and non-naturally occurring amino acid, e.g., N80A and N80Q.
  • a high affinity SIRP- ⁇ D1 variant comprises an N80A mutation and at least 1 additional mutation (e.g., at least 2, 3, 4, 5, 6, 7, 8, 9, or 10 additional mutations or more).
  • the additional mutation is in the CD47 binding site.
  • the additional mutation is in the hydrophobic core of the D1 domain.
  • a polypeptide in a composition disclosed herein includes a high affinity SIRP- ⁇ D1 variant that has increased glycosylation relative to a wild-type SIRP- ⁇ D1 domain. Another option to increase homogeneity of the final product is to enhance the efficiency of glycosylation at amino acid N80 and generate high affinity SIRP- ⁇ D1 variants with increased glycosylation relative to a wild-type.
  • the amino acid P83 in the sequence NITP83 affects the degree of glycosylation at amino acid N80. In some embodiments, changing P83 to any amino acid increases the efficiency of glycosylation at N80.
  • amino acid P83 in a high affinity SIRP- ⁇ D1 variant is replaced by any amino acid, including naturally and non-naturally amino acids, e.g., P83V, P83A, P83I, and P83L.
  • a polypeptide of the disclosure is expressed in a cell that is optimized not to glycosylate proteins that are expressed by such cell, for example by genetic engineering of the cell line (e.g., genetically engineered yeast or mammalian host) or modifications of cell culture conditions such as addition of kifunensine or by using a naturally non-glycosylating host such as a prokaryote ( E. coli , etc.).
  • a high affinity SIRP- ⁇ D1 variant includes one or more (e.g., two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen or more) of the substitutions listed in Table 5.
  • the SIRP- ⁇ D1 variants are not glycosylated or are minimally glycosylated.
  • the SIRP- ⁇ D1 variants are fully glycosylated or almost fully glycosylated.
  • a high affinity SIRP- ⁇ D1 variant includes at most fourteen amino acid substitutions relative to a wild-type D1 domain.
  • a high affinity SIRP- ⁇ D1 variant includes at most ten amino acid substitutions relative to a wild-type D1 domain. In some embodiments, a high affinity SIRP- ⁇ D1 variant includes at most seven amino acid substitutions relative to a wild-type D1 domain. In some embodiments, a high affinity SIRP- ⁇ D1 variant of the disclosure has at least 90% (e.g., at least 92%, 95%, 97% or greater than 97%) amino acid sequence identity to a sequence of a wild-type D1 domain.
  • a high affinity SIRP- ⁇ D1 variant is a chimeric high affinity SIRP- ⁇ D1 variant that includes a portion of two or more wild-type D1 domains or variants thereof (e.g., a portion of one wild-type D1 domain or variant thereof and a portion of another wild-type D1 domain or variant thereof).
  • a chimeric high affinity SIRP- ⁇ D1 variant includes at least two portions (e.g., three, four, five or more portions) of wild-type D1 domains or variants thereof, wherein each of the portions is from a different wild-type D1 domain.
  • a chimeric high affinity SIRP- ⁇ D1 variant further includes one or more amino acid substitutions listed in Table 5.
  • a polypeptide includes a SIRP- ⁇ D1 variant having a sequence of: EEEX 1 QX 2 IQPDKSVLVAAGETX 3 TLRCTX 4 TSLX 5 PVGPIQWFRGAGPGRX 6 LIYNQX 7 X 8 GX 9 F PRVTTVSDX 10 TX 11 RNNMDFSIRIGX 12 ITX 13 ADAGTYYCX 14 KX 15 RKGSPDDVEX 16 KSGAGTE LSVRAKPS (SEQ ID NO: 37), wherein X 1 is L, I, or V; X 2 is V, L, or, I; X 3 is A or V; X 4 is A, I, or L; X 5 is I, T, S, or F; X 6 is E, V, or L; X 7 is K or R; X 8 is E or Q; X 9 is H, P, or R; X 10 is L, T, or G; X 11 is K or R; X 12 is N, A, C, D,
  • a polypeptide includes a SIRP- ⁇ D1 variant having a sequence of: EEGX 1 QX 2 IQPDKSVSVAAGESX 3 ILHCTX 4 TSLX 5 PVGPIQWFRGAGPGRX 6 LIYNQX 7 X 8 GX 9 F PRVTTVSDX 10 TX 11 RNNMDFSIRIGX 12 ITX 13 ADAGTYYCX 14 KX 15 RKGSPDDVEX 16 KSGAGTE LSVRAKPS (SEQ ID NO: 40), wherein X 1 is L, I, or V; X 2 is V, L, or, I; X 3 is A or V; X 4 is A, I, or L; X 5 is I, T, S, or F; X 6 is E, V, or L; X 7 is K or R; X 8 is E or Q; X 9 is H, P, or R; X 10 is L, T, or G; X 11 is K or R; X 12 is N, A, C, D
  • a polypeptide includes a SIRP- ⁇ D1 variant having a sequence of: EEEX 1 QX 2 IQPDKFVLVAAGETX 3 TLRCTX 4 TSLX 5 PVGPIQWFRGAGPGRX 6 LIYNQX 7 X 8 GX 9 F PRVTTVSDX 10 TX 11 RNNMDFSIRIGX 12 ITX 13 ADAGTYYCX 14 KX 15 RKGSPDDVEX 16 KSGAGTE LSVRAKPS (SEQ ID NO: 41), wherein X 1 is L, I, or V; X 2 is V, L, or, I; X 3 is A or V; X 4 is A, I, or L; X 5 is I, T, S, or F; X 6 is E, V, or L; X 7 is K or R; X 8 is E or Q; X 9 is H, P, or R; X 10 is L, T, or G; X 11 is K or R; X 12 is N, A, C, D
  • a polypeptide includes a SIRP- ⁇ D1 variant having a sequence of: EEEX 1 QX 2 IQPDKSVLVAAGETX 3 TLRCTX 4 TSLX 5 PVGPIQWFRGAGPGRX 6 LIYNQX 7 X 8 GX 9 F PRVTTVSDX 10 TX 11 RNNMDFPIRIGX 12 ITX 13 ADAGTYYCX 14 KX 15 RKGSPDDVEX 16 KSGAGTE LSVRAKPS (SEQ ID NO: 42), and wherein X 1 is L, I, or V; X 2 is V, L, or, I; X 3 is A or V; X 4 is A, I, or L; X 5 is I, T, S, or F; X 6 is E, V, or L; X 7 is K or R; X 8 is E or Q; X 9 is H, P, or R; X 10 is L, T, or G; X 11 is K or R; X 12 is N, A, C, D
  • a polypeptide includes a SIRP- ⁇ D1 variant having a sequence of: EEEX 1 QX 2 IQPDKSVLVAAGETX 3 TLRCTX 4 TSLX 5 PVGPIQWFRGAGPGRX 6 LIYNQX 7 X 8 GX 9 F PRVTTVSDX 10 TX 11 RNNMDFSIRISX 12 ITX 13 ADAGTYYCX 14 KX 15 RKGSPDDVEX 16 KSGAGTE LSVRAKPS (SEQ ID NO: 45), and wherein X 1 is L, I, or V; X 2 is V, L, or, I; X 3 is A or V; X 4 is A, I, or L; X 5 is I, T, S, or F; X 6 is E, V, or L; X 7 is K or R; X 8 is E or Q; X 9 is H, P, or R; X 10 is L, T, or G; X 11 is K or R; X 12 is N, A, C, D
  • a polypeptide includes a SIRP- ⁇ D1 variant having a sequence of any one of SEQ ID NOs: 37, 40-42, and 45, wherein X 1 is L, I, or V.
  • X 2 is V, L, or, I.
  • X 3 is A or V.
  • X 4 is A, I, or L.
  • X 5 is I, T, S, or F.
  • X 6 is E, V, or L.
  • X 7 is K or R.
  • X 8 is E or Q.
  • X 9 is H, P, or R.
  • X 10 is L, T, or G.
  • X 11 is K or R.
  • X 12 is N, A, C, D, E, F, G, H, I, K, L, M, P, Q, R, S, T, V, W, or Y.
  • X 13 is P, A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, or Y.
  • X 14 is V or I.
  • X 15 is F, L, V.
  • X 16 is F or V.
  • a polypeptide provided herein includes no more than ten amino acid substitutions relative to the wild-type SIRP- ⁇ D1 domain having the sequence of any one of SEQ ID NOs: 1, 4-6, and 9. In some embodiments, the polypeptide provided herein includes no more than seven amino acid substitutions relative to the wild-type SIRP- ⁇ D1 domain having the sequence of any one of SEQ ID NOs: 1, 4-6, and 9.
  • the polypeptide binds CD47 with at least 10-fold greater binding affinity than the wild-type SIRP- ⁇ D1 domain having the sequence of any one of SEQ ID NOs: 1, 4-6, and 9. In some embodiments, the polypeptide binds CD47 with at least 100-fold greater binding affinity than the wild-type SIRP- ⁇ D1 domain having the sequence of any one of SEQ ID NOs: 1, 4-6, and 9. In some embodiments, the polypeptide binds CD47 with at least 1000-fold greater binding affinity than the wild-type SIRP- ⁇ D1 domain having the sequence of any one of SEQ ID NOs: 1, 4-6, and 9.
  • a SIRP- ⁇ D1 variant polypeptide or fragment thereof binds to CD47 with a K D less than 1 ⁇ 10 ⁇ 8 M, less than 5 ⁇ 10 ⁇ 9 M, less than 1 ⁇ 10 ⁇ 9 M, less 5 ⁇ 10 ⁇ 10 M, less than 1 ⁇ 10 ⁇ 10 M or less than 1 ⁇ 10 ⁇ 11M .
  • a SIRP- ⁇ D1 variant polypeptide or fragment thereof binds to CD47 with a K D between about 500 nM and 100 nM, between about 100 nM and 50 nM, between about 50 nM and 10 nM, between about 10 nM and 5 nM, between about 5 nM and 1 nM, between about 1 nM and 500 pM, between about 500 pM and 100 pM, between about 100 pM and 50 pM, or between about 50 pM and 10 pM.
  • a polypeptide includes a SIRP- ⁇ D1 variant having a sequence of: EEEX 1 QX 2 IQPDKSVSVAAGESX 3 ILHCTX 4 TSLX 5 PVGPIQWFRGAGPARX 6 LIYNQX 7 X 8 GX 9 F PRVTTVSEX 10 TX 11 RENMDFSISISX 12 ITX 13 ADAGTYYCX 14 KX 15 RKGSPDTEX 16 KSGAGTELS VRAKPS (SEQ ID NO: 38), wherein X 1 is L, I, or V; X 2 is V, L, or, I; X 3 is A or V; X 4 is V, I, or L; X 5 is I, T, S, or F; X 6 is E, V, or L; X 7 is K or R; X 8 is E or Q; X 9 is H, P, or R; X 10 is S, T, or G; X 11 is K or R; X 12 is N, A, C, D, E
  • a polypeptide includes a SIRP- ⁇ D1 variant having a sequence of: EEEX 1 QX 2 IQPDKSVSVAAGESX 3 ILLCTX 4 TSLX 5 PVGPIQWFRGAGPARX 6 LIYNQX 7 X 8 GX 9 FP RVTTVSEX 10 TX 11 RENMDFSISISX 12 ITX 13 ADAGTYYCX 14 KX 15 RKGSPDTEX 16 KSGAGTELSV RAKPS (SEQ ID NO: 39), wherein X 1 is L, I, or V; X 2 is V, L, or, I; X 3 is A or V; X 4 is V, I, or L; X 5 is I, T, S, or F; X 6 is E, V, or L; X 7 is K or R; X 8 is E or Q; X 9 is H, P, or R; X 10 is S, T, or G; X 11 is K or R; X 12 is N, A, C, D,
  • a polypeptide includes a SIRP- ⁇ D1 variant having a sequence of: EEEX 1 QX 2 IQPDKSVSVAAGESX 3 ILHCTX 4 TSLX 5 PVGPIQWFRGAGPARX 6 LIYNQX 7 X 8 GX 9 F PRVTTVSEX 10 TX 11 RENMDFSISISX 12 ITX 13 ADAGTYYCX 14 KX 15 RKGSPDTEX 16 KSGAGTELS VRGKPS (SEQ ID NO: 43), wherein X 1 is L, I, or V; X 2 is V, L, or, I; X 3 is A or V; X 4 is V, I, or L; X 5 is I, T, S, or F; X 6 is E, V, or L; X 7 is K or R; X 8 is E or Q; X 9 is H, P, or R; X 10 is S, T, or G; X 11 is K or R; X 12 is N, A, C, D,
  • a polypeptide includes a SIRP- ⁇ D1 variant having a sequence of: EEEX 1 QX 2 IQPDKSVSVAAGESX 3 ILHCTX 4 TSLX 5 PVGPIQWFRGAGPARX 6 LIYNQX 7 X 8 GX 9 F PRVTTVSEX 10 TX 11 RENMDFSISISX 12 ITX 13 ADAGTYYCX 14 KX 15 RKGSPDTEX 16 KSGAGTELS VRAKPS (SEQ ID NO: 46), wherein X 1 is L, I, or V; X 2 is V, L, or, I; X 3 is A or V; X 4 is V, I, or L; X 5 is I, T, S, or F; X 6 is E, V, or L; X 7 is K or R; X 8 is E or Q; X 9 is H, P, or R; X 10 is S, T, or G; X 11 is K or R; X 12 is N, A, C, D, E
  • a polypeptide includes a SIRP- ⁇ D1 variant having a sequence of any one of SEQ ID NOs: 38, 39, 43, and 46, wherein X 1 is L, I, or V.
  • X 2 is V, L, or, I.
  • X 3 is A or V.
  • X 4 is V, I, or L.
  • X 5 is I, T, S, or F.
  • X 6 is E, V, or L.
  • X 7 is K or R.
  • X 8 is E or Q.
  • X 9 is H, P, or R.
  • X 10 is S, T, or G.
  • X 11 is K or R.
  • X 12 is N, A, C, D, E, F, G, H, I, K, L, M, P, Q, R, S, T, V, W, or Y.
  • X 13 is P, A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, or Y.
  • X 14 is V or I.
  • X 15 is F, L, or V.
  • X 16 is F or V.
  • a polypeptide includes a SIRP- ⁇ D1 variant having no more than ten amino acid substitutions relative to the wild-type SIRP- ⁇ D1 domain having the sequence of any one of SEQ ID NOs: 2, 3, 7, and 10. In some embodiments, a polypeptide includes a SIRP- ⁇ D1 variant having no more than seven amino acid substitutions relative to the wild-type SIRP- ⁇ D1 domain having the sequence of any one of SEQ ID NOs: 2, 3, 7, and 10.
  • the polypeptide binds CD47 with at least 10-fold greater binding affinity than the wild-type SIRP- ⁇ D1 domain having the sequence of any one of SEQ ID NOs: 2, 3, 7, and 10. In some embodiments, the polypeptide binds CD47 with at least 100-fold greater binding affinity than the wild-type SIRP- ⁇ D1 domain having the sequence of any one of SEQ ID NOs: 2, 3, 7, and 10. In some embodiments, the polypeptide binds CD47 with at least 1000-fold greater binding affinity than the wild-type SIRP- ⁇ D1 domain having the sequence of any one of SEQ ID NOs: 2, 3, 7, and 10.
  • a SIRP- ⁇ D1 variant polypeptide or fragment thereof binds to CD47 with a K D less than 1 ⁇ 10 ⁇ 8 M, less than 5 ⁇ 10 ⁇ 9 M, less than 1 ⁇ 10 ⁇ 9 M, less 5 ⁇ 10 ⁇ 10 M, less than 1 ⁇ 10 ⁇ 10 M or less than 1 ⁇ 10 ⁇ 11 M.
  • a SIRP- ⁇ D1 variant polypeptide or fragment thereof binds to CD47 with a K D between about 500 nM and 100 nM, between about 100 nM and 50 nM, between about 50 nM and 10 nM, between about 10 nM and 5 nM, between about 5 nM and 1 nM, between about 1 nM and 500 pM, between about 500 pM and 100 pM, between about 100 pM and 50 pM, or between about 50 pM and 10 pM.
  • a polypeptide includes a SIRP- ⁇ D1 variant having a sequence of: EEEX 1 QX 2 IQPDKSVLVAAGETX 3 TLRCTX 4 TSLX 5 PVGPIQWFRGAGPARX 6 LIYNQX 7 X 8 GX 9 F PRVTTVSEX 10 TX 11 RENMDFSISISX 12 ITX 13 ADAGTYYCX 14 KX 15 RKGSPDTEX 16 KSGAGTELS VRAKPS (SEQ ID NO: 44), wherein X 1 is L, I, or V; X 2 is V, L, or, I; X 3 is A or V; X 4 is A, I, or L; X 5 is I, T, S, or F; X 6 is E, V, or L; X 7 is K or R; X 8 is E or Q; X 9 is H, P, or R; X 10 is S, T, or G; X 11 is K or R; X 12 is N, A, C, D, E,
  • the polypeptide has the sequence of SEQ ID NO: 44, wherein X 1 is L, I, or V.
  • X 2 is V, L, or, I.
  • X 3 is A or V.
  • X 4 is A, I, or L.
  • X 5 is I, T, S, or F.
  • X 6 is E, V, or L.
  • X 7 is K or R.
  • X 8 is E or Q.
  • X 9 is H, P, or R.
  • X 10 is S, T, or G.
  • X 11 is K or R.
  • X 12 is N, A, C, D, E, F, G, H, I, K, L, M, P, Q, R, S, T, V, W, or Y.
  • X 13 is P, A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, or Y.
  • X 14 is V or I.
  • X 15 is F, L, or V.
  • X 16 is F or V.
  • a polypeptide includes a SIRP- ⁇ D1 variant having no more than ten amino acid substitutions relative to the wild-type SIRP- ⁇ D1 domain having the sequence of SEQ ID NO: 8. In some embodiments, a polypeptide includes a SIRP- ⁇ D1 variant having no more than seven amino acid substitutions relative to the wild-type SIRP- ⁇ D1 domain having the sequence of SEQ ID NO: 8.
  • the polypeptide binds CD47 with at least 10-fold greater binding affinity than the wild-type SIRP- ⁇ D1 domain having the sequence of SEQ ID NO: 8. In some embodiments, the polypeptide binds CD47 with at least 100-fold greater binding affinity than the wild-type SIRP- ⁇ D1 domain having the sequence of SEQ ID NO: 8. In some embodiments, the polypeptide binds CD47 with at least 1000-fold greater binding affinity than the wild-type SIRP- ⁇ D1 domain having the sequence of SEQ ID NO: 8.
  • a SIRP- ⁇ D1 variant polypeptide or fragment thereof binds to CD47 with a K D less than 1 ⁇ 10 ⁇ 8 M, less than 5 ⁇ 10 ⁇ 9 M, less than 1 ⁇ 10 ⁇ 9 M, less 5 ⁇ 10 ⁇ 10 M, less than 1 ⁇ 10 ⁇ 10 M or less than 1 ⁇ 10 ⁇ 11 M.
  • a SIRP- ⁇ D1 variant polypeptide or fragment thereof binds to CD47 with a K D between about 500 nM and 100 nM, between about 100 nM and 50 nM, between about 50 nM and 10 nM, between about 10 nM and 5 nM, between about 5 nM and 1 nM, between about 1 nM and 500 pM, between about 500 pM and 100 pM, between about 100 pM and 50 pM, or between about 50 pM and 10 pM.
  • the disclosure features a polypeptide including a SIRP- ⁇ D1 variant having a sequence of: EEX 1 X 2 QX 3 IQPDKX 4 VX 5 VAAGEX 6 X 7 X 8 LX 9 CTX 10 TSLX 11 PVGPIQWFRGAGPX 12 RX 13 LIYNQ X 14 X 15 GX 16 FPRVTTVSX 17 X 18 TX 19 RX 20 NMDFX 21 IX 22 IX 23 X 24 ITX 25 ADAGTYYCX 26 KX 27 RKGS PDX 28 X 29 EX 30 KSGAGTELSVRX 31 KPS (SEQ ID NO: 47), wherein X 1 is E or G; X 2 is L, I, or V; X 3 is V, L, or, I; X 4 is S or F; X 5 is L or S; X 6 is S or T; X 7 is A or V; X 8 is I or T; X 9 is H or R; X 10 is A, V,
  • the polypeptide has the sequence of SEQ ID NO: 47, wherein X 1 is E or G.
  • X 2 is L, I, or V.
  • X 3 is V, L, or, I.
  • X 4 is S or F.
  • X 5 is L or S.
  • X 6 is S or T.
  • X 7 is A or V.
  • X 8 is I or T.
  • X 9 is H or R.
  • X 10 is A, V, I, or L.
  • X 11 is I, T, S, or F.
  • X 12 is A or G.
  • X 13 is E, V, or L.
  • X 14 is K or R.
  • X 15 is E or Q.
  • X 16 is H, P, or R.
  • X 17 is D or E.
  • X 18 is S, L, T, or G.
  • X 19 is K or R.
  • X 20 is E or N.
  • X 21 is S or P.
  • X 22 is S or R.
  • X 23 is S or G.
  • X 24 is N, A, C, D, E, F, G, H, I, K, L, M, P, Q, R, S, T, V, W, or Y.
  • X 25 is P, A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, or Y.
  • X 26 is V or I.
  • X 27 is F, L, V.
  • X 28 is D or absent.
  • X 29 is T or V.
  • X 30 is F or V.
  • X 31 is A or G.
  • the polypeptide of this aspect of the disclosure includes no more than ten amino acid substitutions relative to the wild-type SIRP- ⁇ D1 domain having the sequence of any one of SEQ ID NOs: 1-10. In some embodiments, the polypeptide of this aspect of the disclosure includes no more than seven amino acid substitutions relative to the wild-type SIRP- ⁇ D1 domain having the sequence of any one of SEQ ID NOs: 1-10.
  • the polypeptide binds CD47 with at least 10-fold greater binding affinity than the wild-type SIRP- ⁇ D1 domain having the sequence of any one of SEQ ID NOs: 1-10. In some embodiments, the polypeptide binds CD47 with at least 100-fold greater binding affinity than the wild-type SIRP- ⁇ D1 domain having the sequence of any one of SEQ ID NOs: 1-10. In some embodiments, the polypeptide binds CD47 with at least 1000-fold greater binding affinity than the wild-type SIRP- ⁇ D1 domain having the sequence of any one of SEQ ID NOs: 1-10.
  • a SIRP- ⁇ D1 variant polypeptide or fragment thereof binds to CD47 with a K D less than 1 ⁇ 10 ⁇ 8 M, less than 5 ⁇ 10 ⁇ 9 M, less than 1 ⁇ 10 ⁇ 9 M, less 5 ⁇ 10 ⁇ 10 M, less than 1 ⁇ 10 ⁇ 10 M or less than 1 ⁇ 10 ⁇ 11 M.
  • a SIRP- ⁇ D1 variant polypeptide or fragment thereof binds to CD47 with a K D between about 500 nM and 100 nM, between about 100 nM and 50 nM, between about 50 nM and 10 nM, between about 10 nM and 5 nM, between about 5 nM and 1 nM, between about 1 nM and 500 pM, between about 500 pM and 100 pM, between about 100 pM and 50 pM, or between about 50 pM and 10 pM.
  • a polypeptide includes a SIRP- ⁇ D1 variant having a sequence of:
  • EEELQX 1 IQPDKSVX 2 VAAGEX 3 AX 4 LX 5 CTX 6 TSLX 7 PVGPIQWFRGAGPX 8 RX 9 LIY NQX 10 X 11 GX 12 FPRVTTVSX 13 X 14 TKRX 15 NMDFSIX 16 IX 17 X 18 ITPADAGTYYCX 19 KFRKGX 20 X 21 X 22 DX 23 EFKSGAGTELSVRAKPS (SEQ ID NO: 48), wherein X 1 is V or I; X 2 is L or S; X 3 is T or S; X 4 is T or I; X 5 is R or H; X 6 is A, V, or I; X 7 is I, R, Y, K or F; X 8 is G or A; X 9 is E or V; X 10 is K or R; X 11 is E, D or Q; X 12 is H or P; X 13 is D or E; X 14 is S, L or T; X 15
  • the disclosure features a polypeptide including a SIRP- ⁇ D1 variant having a sequence of: EEELQX 1 IQPDKSVLVAAGETATLRCTX 2 TSLX 3 PVGPIQWFRGAGPGRX 4 LIYNQX 5 X 6 GX 7 FP RVTTVSDX 8 TKRNNMDFSIRIGX 9 ITPADAGTYYCX 10 KFRKGSPDDVEFKSGAGTELSVRAK PS (SEQ ID NO: 49), wherein X 1 is V, L, or I; X 2 is A, I, V, or L; X 3 is I, F, S, or T; X 4 is E, V, or L; X 5 is K or R; X 6 is E or Q; X 7 is H, P, or R; X 8 is L, T, S, or G; X 9 is A; and X 10 is V or I; and wherein the variant has at least one amino acid substitution relative to a wild-type SIRP- ⁇ D1 domain having
  • the polypeptide has the sequence of SEQ ID NO: 49, wherein X 1 is V, L or I.
  • X 2 is A, I, V, or L.
  • X 3 is I, F, S, or T.
  • X 4 is E, V, or L.
  • X 5 is K or R.
  • X 6 is E or Q.
  • X 7 is H, P, or R.
  • X 8 is L, T, S or G.
  • X 9 is A.
  • X 10 is V or I.
  • the polypeptide has a high affinity SIRP- ⁇ D1 domain having at least 85% sequence identity (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity) to SEQ ID NO: 49, wherein each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , and X 10 are not a wild-type amino acid.
  • sequence identity e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity
  • the polypeptide of this aspect of the disclosure includes no more than ten amino acid substitutions relative to the wild-type SIRP- ⁇ D1 domain having the sequence of any one of SEQ ID NO: 1. In some embodiments, the polypeptide of this aspect of the disclosure includes no more than seven amino acid substitutions relative to the wild-type SIRP- ⁇ D1 domain having the sequence of any one of SEQ ID NO: 1.
  • the polypeptide binds CD47 with at least 10-fold greater binding affinity than the wild-type SIRP- ⁇ D1 domain having the sequence of any one of SEQ ID NO: 1. In some embodiments, the polypeptide binds CD47 with at least 100-fold greater binding affinity than the wild-type SIRP- ⁇ D1 domain having the sequence of any one of SEQ ID NO: 1. In some embodiments, the polypeptide binds CD47 with at least 1000-fold greater binding affinity than the wild-type SIRP- ⁇ D1 domain having the sequence of any one of SEQ ID NO: 1.
  • a SIRP- ⁇ D1 variant polypeptide or fragment thereof binds to CD47 with a K D less than 1 ⁇ 10 ⁇ 8 M, less than 5 ⁇ 10 ⁇ 9 M, less than 1 ⁇ 10 ⁇ 9 M, less 5 ⁇ 10 ⁇ 10 M, less than 1 ⁇ 10 ⁇ 10 M or less than 1 ⁇ 10 ⁇ 11 M.
  • a SIRP- ⁇ D1 variant polypeptide or fragment thereof binds to CD47 with a K D between about 500 nM and 100 nM, between about 100 nM and 50 nM, between about 50 nM and 10 nM, between about 10 nM and 5 nM, between about 5 nM and 1 nM, between about 1 nM and 500 pM, between about 500 pM and 100 pM, between about 100 pM and 50 pM, or between about 50 pM and 10 pM.
  • the disclosure features a polypeptide including a SIRP- ⁇ D1 variant having a sequence of:
  • the polypeptide has the sequence of SEQ ID NO: 50, wherein X 1 is V or I.
  • X 2 is V or I.
  • X 3 is I or F.
  • X 4 is E or V.
  • X 5 is K or R.
  • X 6 is E or Q.
  • X 7 is H or P.
  • X 8 is S or R.
  • X 9 is N or A.
  • X 10 is V or I.
  • the polypeptide has a high affinity SIRP- ⁇ D1 domain having at least 85% sequence identity (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity) to SEQ ID NO: 50, wherein each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , and X 10 is not a wild-type amino acid.
  • sequence identity e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity
  • the polypeptide of this aspect of the disclosure includes no more than ten amino acid substitutions relative to the wild-type SIRP- ⁇ D1 domain having the sequence of any one of SEQ ID NO: 2. In some embodiments, the polypeptide of this aspect of the disclosure includes no more than seven amino acid substitutions relative to the wild-type SIRP- ⁇ D1 domain having the sequence of any one of SEQ ID NO: 2.
  • the polypeptide binds CD47 with at least 10-fold greater binding affinity than the wild-type SIRP- ⁇ D1 domain having the sequence of any one of SEQ ID NO: 2. In some embodiments, the polypeptide binds CD47 with at least 100-fold greater binding affinity than the wild-type SIRP- ⁇ D1 domain having the sequence of any one of SEQ ID NO: 2. In some embodiments, the polypeptide binds CD47 with at least 1000-fold greater binding affinity than the wild-type SIRP- ⁇ D1 domain having the sequence of any one of SEQ ID NO: 2.
  • a SIRP- ⁇ D1 variant polypeptide or fragment thereof binds to CD47 with a K D less than 1 ⁇ 10 ⁇ 8 M, less than 5 ⁇ 10 ⁇ 9 M, less than 1 ⁇ 10 ⁇ 9 M, less 5 ⁇ 10 ⁇ 10 M, less than 1 ⁇ 10 ⁇ 10 M or less than 1 ⁇ 10 ⁇ 11 M.
  • a SIRP- ⁇ D1 variant polypeptide or fragment thereof binds to CD47 with a K D between about 500 nM and 100 nM, between about 100 nM and 50 nM, between about 50 nM and 10 nM, between about 10 nM and 5 nM, between about 5 nM and 1 nM, between about 1 nM and 500 pM, between about 500 pM and 100 pM, between about 100 pM and 50 pM, or between about 50 pM and 10 pM.
  • the disclosure features a polypeptide including a SIRP- ⁇ D1 variant having a sequence of:
  • EEELQX 1 IQPDKSVLVAAGETATLRCTX 2 TSLX 3 PVGPIQWFRGAGPGRX 4 LIYNQX 5 EGX 6 FPR VTTVSDX 7 TKRNNMDFSIRIGX 8 ITPADAGTYYCX 9 KFRKGSPDDVEFKSGAGTELSVRAKPS (SEQ ID NO: 51), wherein X 1 is V or I; X 2 is A or I; X 3 is I or F; X 4 is E or V; X 5 is K or R; X 6 is H or P; X 7 is L or T; X 8 is N or A; and X 9 is V or I; and wherein the variant has at least one amino acid substitution relative to a wild-type SIRP- ⁇ D1 domain having the sequence of any one of SEQ ID NO: 1.
  • the polypeptide has the sequence of SEQ ID NO: 51, wherein X 1 is V or I.
  • X 2 is A or I.
  • X 3 is I or F.
  • X 4 is E or V.
  • X 5 is K or R.
  • X 6 is H or P.
  • X 7 is L or T.
  • X 8 is N or A.
  • X 9 is V or I.
  • X 4 is not V.
  • the polypeptide has the sequence of SEQ ID NO: 51, wherein X 8 is A.
  • X 8 is A and X 1 is V or I.
  • X 8 is A and X 2 is A or I.
  • X 8 is A and X 3 is I or F.
  • X 8 is A and X 4 is E or V. In some embodiments, X 4 is not V.
  • X 8 is A and X 5 is K or R.
  • X 8 is A and X 6 is H or P. In any of the aforementioned embodiments, X 8 is A and X 7 is A or V. In any of the aforementioned embodiments, X 8 is A and X 9 is V or I.
  • the polypeptide has the sequence of SEQ ID NO: 51, wherein X 8 is A.
  • X 8 is A and X 1 is I.
  • X 8 is A and X 2 is I.
  • X 8 is A and X 3 is F.
  • X 8 is A and X 4 is V.
  • X 8 is A and X 5 is R.
  • X 8 is A and X 6 is P.
  • X 8 is A and X 7 is T.
  • X 8 is A and X 9 is I.
  • the polypeptide has a high affinity SIRP- ⁇ D1 domain having at least 85% sequence identity (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity) to SEQ ID NO: 51, wherein each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , and X 9 is not a wild-type amino acid.
  • the polypeptide of this aspect of the disclosure includes no more than ten amino acid substitutions relative to the wild-type SIRP- ⁇ D1 domain having the sequence of any one of SEQ ID NO: 1. In some embodiments, the polypeptide of this aspect of the disclosure includes no more than seven amino acid substitutions relative to the wild-type SIRP- ⁇ D1 domain having the sequence of any one of SEQ ID NO: 1.
  • the polypeptide binds CD47 with at least 10-fold greater binding affinity than the wild-type SIRP- ⁇ D1 domain having the sequence of any one of SEQ ID NO: 1. In some embodiments, the polypeptide binds CD47 with at least 100-fold greater binding affinity than the wild-type SIRP- ⁇ D1 domain having the sequence of any one of SEQ ID NOs: 1. In some embodiments, the polypeptide binds CD47 with at least 1000-fold greater binding affinity than the wild-type SIRP- ⁇ D1 domain having the sequence of any one of SEQ ID NO: 1.
  • a SIRP- ⁇ D1 variant polypeptide or fragment thereof binds to CD47 with a K D less than 1 ⁇ 10 ⁇ 8 M, less than 5 ⁇ 10 ⁇ 9 M, less than 1 ⁇ 10 ⁇ 9 M, less 5 ⁇ 10 ⁇ 10 M, less than 1 ⁇ 10 ⁇ 10 M or less than 1 ⁇ 10 ⁇ 11 M.
  • a SIRP- ⁇ D1 variant polypeptide or fragment thereof binds to CD47 with a K D between about 500 nM and 100 nM, between about 100 nM and 50 nM, between about 50 nM and 10 nM, between about 10 nM and 5 nM, between about 5 nM and 1 nM, between about 1 nM and 500 pM, between about 500 pM and 100 pM, between about 100 pM and 50 pM, or between about 50 pM and 10 pM.
  • EEELQX 1 IQPDKSVLVAAGETATLRCTX 2 TSLX 3 PVGPIQWFRGAGPGRELIYNQX 4 EGX 5 FPRV TTVSDX 6 TKRNNMDFSIRIGX 7 ITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSVRAKPS (SEQ ID NO: 222), wherein X 1 is V, L, or I; X 2 is A, I, or L; X 3 is I, T, S, or F; X 4 is K or R; X 5 is H or P; X 6 is L, T, or G; X 7 is N or A; and wherein the variant has at least one amino acid substitution relative to a wild-type SIRP- ⁇ D1 domain having a sequence according to SEQ ID NO: 1.
  • the polypeptide has the sequence of SEQ ID NO: 222, wherein X 1 is V, L, or I.
  • X 2 is A, I, or L.
  • X 3 is I, T, S, or F.
  • X 4 is K or R.
  • X 5 is H or P.
  • X 6 is L, T, or G.
  • X 7 is N or A.
  • the polypeptide has the sequence of SEQ ID NO: 222, wherein X 1 is V or I.
  • X 2 is A or I.
  • X 3 is I or F.
  • X 4 is K or R.
  • X 5 is H or P.
  • X 6 is L or T.
  • X 7 is N or A.
  • the polypeptide has the sequence of SEQ ID NO: 222, wherein X 7 is A.
  • X 7 is A and X 1 is V or I.
  • X 7 is A and X 2 is A or I.
  • X 7 is A and X 3 is I or F.
  • X 7 is A and X 4 is K or R.
  • X 7 is A and X 5 is H or P.
  • X 7 is A and X 6 is L or T.
  • the polypeptide has the sequence of SEQ ID NO: 222, wherein X 7 is A.
  • X 7 is A and X 1 is I.
  • X 7 is A and X 2 is I.
  • X 7 is A and X 3 is F.
  • X 7 is A and X 4 is R.
  • X 7 is A and X 5 is P.
  • X 7 is A and X 6 is T.
  • the polypeptide has a high affinity SIRP- ⁇ D1 domain having at least 85% sequence identity (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity) to SEQ ID NO: 222, wherein each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , and X 7 is not a wild-type amino acid.
  • sequence identity e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity
  • the polypeptide of this aspect of the disclosure includes no more than ten amino acid substitutions relative to the wild-type SIRP- ⁇ D1 domain having the sequence of any one of SEQ ID NO: 1. In some embodiments, the polypeptide of this aspect of the disclosure includes no more than seven amino acid substitutions relative to the wild-type SIRP- ⁇ D1 domain having the sequence of any one of SEQ ID NO: 1.
  • the polypeptide binds CD47 with at least 10-fold greater binding affinity than the wild-type SIRP- ⁇ D1 domain having the sequence of any one of SEQ ID NO: 1. In some embodiments, the polypeptide binds CD47 with at least 100-fold greater binding affinity than the wild-type SIRP- ⁇ D1 domain having the sequence of any one of SEQ ID NO: 1. In some embodiments, the polypeptide binds CD47 with at least 1000-fold greater binding affinity than the wild-type SIRP- ⁇ D1 domain having the sequence of any one of SEQ ID NO: 1.
  • fragments include polypeptides of less than 10 amino acids in length, about 10 amino acids in length, about 20 amino acids in length, about 30 amino acids in length, about 40 amino acids in length, about 50 amino acids in length, about 60 amino acids in length, about 70 amino acids in length, about 80 amino acids in length, about 90 amino acids in length, about 100 amino acids in length, or more than about 100 amino acids in length. Fragments retain the ability to bind to CD47.
  • SIRP- ⁇ D1 variant polypeptides and fragments thereof bind to CD47 with a higher affinity than a SIRP- ⁇ polypeptide binds to CD47.
  • a SIRP- ⁇ D1 variant polypeptide or fragment thereof binds to CD47 with a K D less than 1 ⁇ 10 ⁇ 8 M, less than 5 ⁇ 10 ⁇ 9 M, less than 1 ⁇ 10 ⁇ 9 M, less 5 ⁇ 10 ⁇ 10 M, less than 1 ⁇ 10 ⁇ 10 M or less than 1 ⁇ 10 ⁇ 11 M.
  • a SIRP- ⁇ D1 variant polypeptide or fragment thereof binds to CD47 with a K D between about 500 nM and 100 nM, between about 100 nM and 50 nM, between about 50 nM and 10 nM, between about 10 nM and 5 nM, between about 5 nM and 1 nM, between about 1 nM and 500 pM, between about 500 pM and 100 pM, between about 100 pM and 50 pM, or between about 50 pM and 10 pM.
  • the disclosure features a polypeptide including a SIRP- ⁇ D1 variant having a sequence of:
  • the polypeptide has the sequence of SEQ ID NO: 212, wherein X 1 is V, L, or I.
  • X 2 is V, I, or L.
  • X 3 is I, T, S, or F.
  • X 4 is K or R.
  • X 5 is H or P.
  • X 6 is S, T, or G.
  • X 7 is N or A.
  • the polypeptide has the sequence of SEQ ID NO: 212, wherein X 1 is V or I. In any of the aforementioned embodiments in this aspect of the disclosure, X 2 is V or I. In any of the aforementioned embodiments, X 3 is I or F. In any of the aforementioned embodiments, X 4 is K or R. In any of the aforementioned embodiments, X 5 is H or P. In any of the aforementioned embodiments, X 6 is S or T. In any of the aforementioned embodiments, X 7 is N or A.
  • the polypeptide has the sequence of SEQ ID NO: 212, wherein X 7 is A.
  • X 7 is A and X 1 is V or I.
  • X 7 is A and X 2 is V or I.
  • X 7 is A and X 3 is I or F.
  • X 7 is A and X 4 is K or R.
  • X 7 is A and X 5 is H or P.
  • X 7 is A and X 6 is S or T.
  • the polypeptide has the sequence of SEQ ID NO: 212, wherein X 7 is A.
  • X 7 is A and X 1 is I.
  • X 7 is A and X 2 is I.
  • X 7 is A and X 3 is F.
  • X 7 is A and X 4 is R.
  • X 7 is A and X 5 is P.
  • X 7 is A and X 6 is T.
  • the polypeptide has a high affinity SIRP- ⁇ D1 domain having at least 85% sequence identity (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity) to SEQ ID NO: 212, wherein each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , and X 7 is not a wild-type amino acid.
  • sequence identity e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity
  • the polypeptide of this aspect of the disclosure includes no more than ten amino acid substitutions relative to the wild-type SIRP- ⁇ D1 domain having the sequence of any one of SEQ ID NO: 2. In some embodiments, the polypeptide of this aspect of the disclosure includes no more than seven amino acid substitutions relative to the wild-type SIRP- ⁇ D1 domain having the sequence of any one of SEQ ID NO: 2.
  • the polypeptide binds CD47 with at least 10-fold greater binding affinity than the wild-type SIRP- ⁇ D1 domain having the sequence of any one of SEQ ID NO: 2. In some embodiments, the polypeptide binds CD47 with at least 100-fold greater binding affinity than the wild-type SIRP- ⁇ D1 domain having the sequence of any one of SEQ ID NO: 2. In some embodiments, the polypeptide binds CD47 with at least 1000-fold greater binding affinity than the wild-type SIRP- ⁇ D1 domain having the sequence of any one of SEQ ID NO: 2.
  • fragments include polypeptides of less than 10 amino acids in length, about 10 amino acids in length, about 20 amino acids in length, about 30 amino acids in length, about 40 amino acids in length, about 50 amino acids in length, about 60 amino acids in length, about 70 amino acids in length, about 80 amino acids in length, about 90 amino acids in length, about 100 amino acids in length, or more than about 100 amino acids in length. Fragments retain the ability to bind to CD47.
  • SIRP- ⁇ D1 variant polypeptides and fragments thereof bind to CD47 with a higher affinity than a SIRP- ⁇ polypeptide binds to CD47.
  • a SIRP- ⁇ D1 variant polypeptide or fragment thereof binds to CD47 with a K D less than 1 ⁇ 10 ⁇ 8 M, less than 5 ⁇ 10 ⁇ 9 M, less than 1 ⁇ 10 ⁇ 9 M, less 5 ⁇ 10 ⁇ 10 M, less than 1 ⁇ 10 ⁇ 10 M or less than 1 ⁇ 10 ⁇ 11 M.
  • a SIRP- ⁇ D1 variant polypeptide or fragment thereof binds to CD47 with a K D between about 500 nM and 100 nM, between about 100 nM and 50 nM, between about 50 nM and 10 nM, between about 10 nM and 5 nM, between about 5 nM and 1 nM, between about 1 nM and 500 pM, between about 500 pM and 100 pM, between about 100 pM and 50 pM, or between about 50 pM and 10 pM.
  • Described herein, in some embodiments, is a polypeptide comprising a SIRP- ⁇ D1 variant having a sequence according to:
  • X 1 is V, L, or I
  • X 2 is A, V, L, or I
  • X 3 is I, S, T, or F
  • X 4 is E, L, or V
  • X 5 is K or R
  • X 6 is E or Q
  • X 7 is H, R, or P
  • X 8 is S, G, L, or T
  • X 9 is any amino acid
  • X 10 is any amino acid
  • X 11 is any amino acid
  • X 12 is any amino acid
  • X 13 is V or I
  • the SIRP- ⁇ D1 variant has at least two amino acid substitutions relative to
  • the polypeptide has the sequence of SEQ ID NO: 212, wherein X 1 , wherein X 9 is A.
  • X 9 is N.
  • X 10 is I.
  • X 9 is N and X 10 is P.
  • X 9 is N and X 11 is any amino acid other than S, T, or C.
  • X 11 is T.
  • X 11 is an amino acid other than T.
  • X 12 is P.
  • X 9 is N and X 12 is any amino acid other than P.
  • Described herein, in some embodiments, is a polypeptide comprising a SIRP- ⁇ D1 variant having a sequence according to:
  • EEELQX 1 IQPDKSVLVAAGETATLRCTX 2 TSLX 3 PVGPIQWFRGAGPGRX 4 LIYNQX 5 X 6 GX 7 FP RVTTVSDX 8 TKRNNMDFSIRIGX 9 ITX 10 ADAGTYYCX 11 KFRKGSPDDVEFKSGAGTELSVRA KPS (SEQ ID NO: 219), wherein X 1 is V, L, or I; X 2 is A, V, L, or I; X 3 is I, S, T, or F; X 4 is E, L, or V; X 5 is K or R; X 6 is E or Q; X 7 is H, R, or P; X 8 is S, G, L, or T; X 9 is N; X 10 is any amino acid other than P; and X 11 is V or I; and wherein the SIRP- ⁇ D1 variant has at least two amino acid substitutions relative to a wild-type SIRP- ⁇ D1 domain having a sequence according to SEQ
  • compositions which include a SIRP- ⁇ D1 variant polypeptide having the amino acid sequence of SEQ ID NO: 48, or a fragment thereof.
  • the SIRP- ⁇ D1 variant polypeptide or fragment thereof binds to CD47 with a higher affinity compared to the affinity that a SIRP- ⁇ polypeptide binds to the CD47.
  • the SIRP- ⁇ D1 variant polypeptide binds to CD47 with a K D less than 1 ⁇ 10 ⁇ 8 M, or less than 1 ⁇ 10 ⁇ 9 M, less than 1 ⁇ 10 ⁇ 10 M or less than 1 ⁇ 10 ⁇ 11 M.
  • the above-mentioned SIRP- ⁇ D1 variant polypeptides are attached or fused to a second polypeptide.
  • the second polypeptide includes, without limitation, an Fc polypeptide, an Fc variant, an HSA polypeptide, an albumin peptide, a PEG polymer or a fragment of the foregoing.
  • a SIRP- ⁇ D1 variant polypeptide is selected from any one of SEQ ID NOs: 53-87 and 213 shown in Table 6.
  • the polypeptide includes a high affinity SIRP- ⁇ D1 domain that has at least 85% sequence identity (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity) to any variant provided in Table 6.
  • the polypeptide includes a high affinity SIRP- ⁇ D1 domain that has at least 85% sequence identity (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity) to SEQ ID NOs: 80, 81, or 85 in Table 6.
  • sequence identity e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity
  • polypeptides comprising a signal-regulatory protein ⁇ (SIRP- ⁇ ) D1 variant comprising a SIRP- ⁇ D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP- ⁇ D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP- ⁇ D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92.
  • SIRP- ⁇ signal-regulatory protein ⁇
  • polypeptides comprising an Fc variant, wherein the Fc variant comprises an Fc domain dimer having two Fc domain monomers, wherein each Fc domain monomer independently is selected from (i) a human IgG1 Fc region consisting of mutations L234A, L235A, G237A, and N297A; (ii) a human IgG2 Fc region consisting of mutations A330S, P331S and N297A; or (iii) a human IgG4 Fc region comprising mutations S228P, E233P, F234V, L235A, delG236, and N297A.
  • Antibodies that target cell surface antigens can trigger immunostimulatory and effector functions that are associated with Fc receptor (FcR) engagement on immune cells.
  • Fc receptor Fc receptor
  • Binding of the Fc region to Fc receptors on cell surfaces can trigger a number of biological responses including phagocytosis of antibody-coated particles (antibody-dependent cell-mediated phagocytosis, or ADCP), clearance of immune complexes, lysis of antibody-coated cells by killer cells (antibody-dependent cell-mediated cytotoxicity, or ADCC) and, release of inflammatory mediators, placental transfer, and control of immunoglobulin production. Additionally, binding of the C1 component of complement to antibodies can activate the complement system. Activation of complement can be important for the lysis of cellular pathogens. However, the activation of complement can also stimulate the inflammatory response and can also be involved in autoimmune hypersensitivity or other immunological disorders. Variant Fc regions with reduced or ablated ability to bind certain Fc receptors are useful for developing therapeutic antibodies and Fc-fusion polypeptide constructs which act by targeting, activating, or neutralizing ligand functions while not damaging or destroying local cells or tissues.
  • a SIRP- ⁇ D1 polypeptide construct comprises a non-naturally occurring high affinity SIRP- ⁇ D1 variant linked to an Fc domain monomer which forms an Fc domain having ablated or reduced effector function.
  • a Fc domain monomer refers to a polypeptide chain that includes second and third antibody constant domains (e.g., CH2 and CH3).
  • an Fc domain monomer also includes a hinge domain.
  • the Fc domain monomer is of any immunoglobulin antibody isotype, including IgG, IgE, IgM, IgA, and IgD. Additionally, in some embodiments, an Fc domain monomer is of any IgG subtype (e.g., IgG1, IgG2, IgG2a, IgG2b, IgG2c, IgG3, and IgG4).
  • Fc domain monomers include as many as ten changes from a wild-type Fc domain monomer sequence (e.g., 1-10, 1-8, 1-6, 1-4 amino acid substitutions, additions or insertions, deletions, or combinations thereof) that alter the interaction between an Fc domain and an Fc receptor.
  • a wild-type Fc domain monomer sequence e.g., 1-10, 1-8, 1-6, 1-4 amino acid substitutions, additions or insertions, deletions, or combinations thereof
  • Fc domain refers to a dimer of two Fc domain monomers.
  • two Fc domain monomers dimerize by the interaction between the two CH3 antibody constant domains, as well as one or more disulfide bonds that form between the hinge domains of the two dimerized Fc domain monomers.
  • an Fc domain is mutated to lack effector functions, for example a “dead Fc domain.”
  • each of the Fc domain monomers in an Fc domain includes amino acid substitutions in the CH2 antibody constant domain to reduce the interaction or binding between the Fc domain and an Fc receptor, such as an Fc ⁇ receptor (Fc ⁇ R), an Fc ⁇ receptor (Fc ⁇ R), or an Fc ⁇ (Fc ⁇ R).
  • a high affinity SIRP- ⁇ D1 variant (e.g., any of the variants described in Tables 2, 5, and 6) is fused to an Fc domain monomer of an immunoglobulin or a fragment of an Fc domain monomer.
  • an Fc domain monomer of an immunoglobulin or a fragment of an Fc domain monomer is capable of forming an Fc domain with another Fc domain monomer.
  • an Fc domain monomer of an immunoglobulin or a fragment of an Fc domain monomer is not capable of forming an Fc domain with another Fc domain monomer.
  • an Fc domain monomer or a fragment of an Fc domain is fused to a polypeptide of the disclosure to increase serum half-life of the polypeptide.
  • an Fc domain monomer or a fragment of an Fc domain monomer fused to a polypeptide of the disclosure dimerizes with a second Fc domain monomer to form an Fc domain which binds an Fc receptor, or alternatively, an Fc domain monomer binds to an Fc receptor.
  • an Fc domain or a fragment of the Fc domain fused to a polypeptide to increase serum half-life of the polypeptide does not induce any immune system-related response.
  • a SIRP- ⁇ polypeptide or construct provided herein includes a SIRP- ⁇ D1 domain or variant thereof joined to a first Fc domain monomer and an antibody variable domain joined to a second Fc domain monomer, in which the first and second Fc domain monomers combine to form an Fc domain (e.g., a heterodimeric Fc domain).
  • An Fc domain is the protein structure that is found at the C-terminus of an immunoglobulin.
  • An Fc domain includes two Fc domain monomers that are dimerized by the interaction between the CH3 antibody constant domains.
  • a wild-type Fc domain forms the minimum structure that binds to an Fc receptor, e.g., Fc ⁇ RI, Fc ⁇ RIIa, Fc ⁇ RIIb, Fc ⁇ RIIIa, Fc ⁇ RIIIb, and Fc ⁇ RIV.
  • the Fc domain is not involved directly in binding an antibody to its target, but can be involved in various effector functions, such as participation of the antibody in antibody-dependent cellular toxicity.
  • the Fc domain in a SIRP- ⁇ polypeptide or construct of the disclosure comprise amino acid substitutions, additions or insertions, deletions, or any combinations thereof that lead to decreased effector function such as decreased antibody-dependent cell-mediated cytotoxicity (ADCC), decreased complement-dependent cytolysis (CDC), decreased antibody-dependent cell-mediated phagocytosis (ADCP), or any combinations thereof.
  • the SIRP- ⁇ polypeptides or constructs of the disclosure are characterized by decreased binding (e.g., minimal binding or absence of binding) to a human Fc receptor and decreased binding (e.g., minimal binding or absence of binding) to complement protein C1q.
  • the SIRP- ⁇ constructs of the disclosure are characterized by decreased binding (e.g., minimal binding or absence of binding) to human Fc ⁇ RI, Fc ⁇ RIIA, Fc ⁇ RIIB, Fc ⁇ RIIIB, or any combinations thereof, and C1q.
  • the Fc domains in SIRP- ⁇ constructs of the disclosure are of the IgG class and comprise one or more amino acid substitutions at E233, L234, L235, G236, G237, D265, D270, N297, E318, K320, K322, A327, A330, P331, or P329 (numbering according to the EU index of Kabat (Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991))).
  • polypeptide constructs comprising a non-native Fc region described herein exhibit reduced or ablated binding to at least one of Fc ⁇ receptors CD16a, CD32a, CD32b, CD32c, and CD64 as compared to a polypeptide construct comprising a native Fc region.
  • the polypeptide constructs described herein exhibit reduced or ablated binding to CD16a, CD32a, CD32b, CD32c, and CD64 Fc ⁇ receptors.
  • CDC refers to a form of cytotoxicity in which the complement cascade is activated by the complement component C1q binding to antibody Fc.
  • polypeptide constructs comprising a non-native Fc region described herein exhibit at least a 5%, 10%, 15%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or greater reduction in C1q binding compared to a polypeptide construct comprising a wild-type Fc region.
  • polypeptide constructs comprising a non-native Fc region as described herein exhibit reduced CDC as compared to a polypeptide construct comprising a wild-type Fc region.
  • polypeptide constructs comprising a non-native Fc region as described herein exhibit at least a 5%, 10%, 15%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or greater reduction in CDC compared to a polypeptide construct comprising a wild-type Fc region.
  • polypeptide constructs comprising a non-natural Fc variant as described herein exhibit negligible CDC as compared to a polypeptide construct comprising a wild-type Fc region.
  • the Fc variants herein are minimally glycosylated or have reduced glycosylation relative to a wild-type sequence.
  • deglycosylation is accomplished with a mutation of N297A, or by mutating N297 to any amino acid which is not N.
  • the N-Xaa1-Xaa2-Xaa3 motif refers to residues 297-300 as designated according to Kabat et al., 1991.
  • a mutation to any one or more of N, Xaa1, Xaa2, or Xaa3 results in deglycosylation of the Fc variant.
  • variants of antibody IgG constant regions possess a reduced capacity to specifically bind Fc ⁇ receptors or have a reduced capacity to induce phagocytosis.
  • variants of antibody IgG constant regions possess a reduced capacity to specifically bind Fc ⁇ receptors and have a reduced capacity to induce phagocytosis.
  • an Fc domain is mutated to lack effector functions, typical of a “dead” Fc domain.
  • an Fc domain includes specific amino acid substitutions that are known to minimize the interaction between the Fc domain and an Fc ⁇ receptor.
  • an Fc domain monomer is from an IgG1 antibody and includes one or more of amino acid substitutions L234A, L235A, G237A, and N297A (as designated according to the EU numbering system per Kabat et al., 1991).
  • one or more additional mutations are included in such IgG1 Fc variant.
  • additional mutations for human IgG1 Fc variants include E318A and K322A.
  • a human IgG1 Fc variant has up to 12, 11, 10, 9, 8, 7, 6, 5 or 4 or fewer mutations in total as compared to wild-type human IgG1 sequence.
  • one or more additional deletions are included in such IgG1 Fc variant.
  • the C-terminal lysine of the Fc IgG1 heavy chain constant region provided in SEQ ID NO: 88 in Table 7 is deleted, for example to increase the homogeneity of the polypeptide when the polypeptide is produced in bacterial or mammalian cells.
  • a human IgG1 Fc variant has up to 12, 11, 10, 9, 8, 7, 6, 5 or 4 or fewer deletions in total as compared to wild-type human IgG1 sequence.
  • a IgG1 Fc variant has a sequence according to any one of SEQ ID NO: 135, SEQ ID NO: 136, or SEQ ID NO: 137.
  • an Fc domain monomer is from an IgG2 or IgG4 antibody and includes amino acid substitutions A330S, P331S, or both A330S and P331S.
  • the aforementioned amino acid positions are defined according to Kabat, et al. (1991).
  • the Kabat numbering of amino acid residues can be determined for a given antibody by alignment at regions of homology of the sequence of the antibody with a “standard” Kabat numbered sequence.
  • the Fc variant comprises a human IgG2 Fc sequence comprising one or more of A330S, P331S and N297A amino acid substitutions (as designated according to the EU numbering system per Kabat, et al. (1991).
  • one or more additional mutations are included in such IgG2 Fc variants.
  • additional mutations for human IgG2 Fc variant include V234A, G237A, P238S, V309L and H268A (as designated according to the EU numbering system per Kabat et al. (1991)).
  • a human IgG2 Fc variant has up to 12, 11, 10, 9, 8, 7, 6, 5, 4, 3 or fewer mutations in total as compared to wild-type human IgG2 sequence.
  • one or more additional deletions are included in such IgG2 Fc variant.
  • the C-terminal lysine of the Fc IgG2 heavy chain constant region provided in SEQ ID NO: 89 in Table 7 is deleted, for example to increase the homogeneity of the polypeptide when the polypeptide is produced in bacterial or mammalian cells.
  • a human IgG2 Fc variant has up to 12, 11, 10, 9, 8, 7, 6, 5 or 4 or fewer deletions in total as compared to wild-type human IgG2 sequence.
  • such Fc variant comprises a S228P mutation (as designated according to Kabat, et al. (1991)).
  • a human IgG4 Fc variant has up to 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2 or 1 mutation(s) in total as compared to wild-type human IgG4 sequence.
  • the Fc variant includes at least one of the mutations L234A, L235A, G237A or N297A of an IgG1 Fc region or at least one of the mutations A330S, P331S or N297A of an IgG2 Fc region. In some embodiments, the Fc variant includes at least two of the mutations L234A, L235A, G237A or N297A of an IgG1 Fc region or at least two of the mutations A330S, P331S or N297A of an IgG2 Fc region.
  • the Fc variant includes at least three of the mutations L234A, L235A, G237A or N297A of an IgG1 Fc region or consists of the mutations A330S, P331S and N297A of an IgG2 Fc region. In some embodiments, the Fc variant consists of the mutations L234A, L235A, G237A and N297A.
  • the Fc variant exhibits reduced binding to an Fc receptor of the subject compared to the wild-type human IgG Fc region. In some embodiments, the Fc variant exhibits ablated binding to an Fc receptor of the subject compared to the wild-type human IgG Fc region. In some embodiments, the Fc variant exhibits a reduction of phagocytosis compared to the wild-type human IgG Fc region. In some embodiments, the Fc variant exhibits ablated phagocytosis compared to the wild-type human IgG Fc region.
  • SEQ ID NO: 88 and SEQ ID NO: 89 provide amino acid sequences of Fc IgG1 and IgG2 heavy chain constant regions.
  • an Fc variant is any variant of SEQ ID NOs: 90-95 as shown in Table 7.
  • Antibody-dependent cell-mediated cytotoxicity which is also referred to herein as ADCC, refers to a form of cytotoxicity in which secreted Ig bound onto Fc receptors (FcRs) present on certain cytotoxic cells (e.g., Natural Killer (NK) cells and neutrophils) enabling these cytotoxic effector cells to bind specifically to an antigen-bearing target cell and subsequently kill the target cell.
  • FcRs Fc receptors
  • Antibody-dependent cell-mediated phagocytosis which is also referred to herein as ADCP, refers to a form of cytotoxicity in which secreted Ig bound onto Fc receptors (FcRs) present on certain phagocytic cells (e.g., macrophages) enabling these phagocytic effector cells to bind specifically to an antigen-bearing target cell and subsequently engulf and digest the target cell.
  • FcRs Fc receptors
  • Ligand-specific high-affinity IgG antibodies directed to the surface of target cells can stimulate the cytotoxic or phagocytic cells and can be used for such killing.
  • polypeptide constructs comprising an Fc variant as described herein exhibit reduced ADCC or ADCP as compared to a polypeptide construct comprising a wild-type Fc region.
  • polypeptide constructs comprising an Fc variant as described herein exhibit at least a 5%, 10%, 15%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or greater reduction in ADCC or ADCP compared to a polypeptide construct comprising a wild-type Fc region.
  • polypeptide constructs comprising an Fc variant as described herein exhibit ablated ADCC or ADCP as compared to a polypeptide construct comprising a wild-type Fc region.
  • Complement-directed cytotoxicity which is also referred to herein as CDC, refers to a form of cytotoxicity in which the complement cascade is activated by the complement component C1q binding to antibody Fc.
  • polypeptide constructs comprising an Fc variant as described herein exhibit at least a 5%, 10%, 15%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or greater reduction in C1q binding compared to a polypeptide construct comprising a wild-type Fc region.
  • polypeptide constructs comprising an Fc variant as described herein exhibit reduced CDC as compared to a polypeptide construct comprising a wild-type Fc region.
  • polypeptide constructs comprising an Fc variant as described herein exhibit at least a 5%, 10%, 15%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or greater reduction in CDC compared to a polypeptide construct comprising a wild-type Fc region. In some cases, polypeptide constructs comprising an Fc variant as described herein exhibit negligible CDC as compared to a polypeptide construct comprising a wild-type Fc region.
  • Fc variants herein include those that exhibit reduced binding to an Fc ⁇ receptor compared to the wild-type human IgG Fc region.
  • an Fc variant exhibits binding to an Fc ⁇ receptor that is less than the binding exhibited by a wild-type human IgG Fc region to an Fc ⁇ receptor, as described in the Examples.
  • an Fc variant has reduced binding to an Fc ⁇ receptor by a factor of 10%, 20% 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, 99% or 100% (fully ablated effector function).
  • the reduced binding is for any one or more Fc ⁇ receptor, e.g., CD16a, CD32a, CD32b, CD32c, or CD64.
  • the Fc variants disclosed herein exhibit a reduction of phagocytosis compared to its wild-type human IgG Fc region.
  • Such Fc variants exhibit a reduction in phagocytosis compared to its wild-type human IgG Fc region, wherein the reduction of phagocytosis activity is e.g., by a factor of 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, 99% or 100%.
  • an Fc variant exhibits ablated phagocytosis compared to its wild-type human IgG Fc region.
  • the Fc variants disclosed herein are coupled to one or more fusion partners.
  • the fusion partner is a therapeutic moiety.
  • the fusion partner is selected to enable targeting of an expressed protein, purification, screening, display, and the like.
  • the fusion partner also affects the degree of binding to Fc receptors or the degree of phagocytosis reduction.
  • an Fc variant when coupled to a fusion partner, it forms a polypeptide construct as described below.
  • fusion partners are linked to the Fc variant sequence via a linker sequence.
  • the linker sequence generally comprises a small number of amino acids, such as less than ten amino acids, although longer linkers are also utilized.
  • the linker has a length less than 10, 9, 8, 7, 6, or 5 amino acids or shorter.
  • the linker has a length of at least 10, 11, 12, 13, 14, 15, 20, 25, 30, or 35 amino acids or longer.
  • a cleavable linker is employed.
  • a fusion partner is a targeting or signal sequence that directs an Fc variant protein and any associated fusion partners to a desired cellular location or to the extracellular media.
  • certain signaling sequences target a protein to be either secreted into the growth media, or into the periplasmic space, located between the inner and outer membrane of the cell.
  • a fusion partner is a sequence that encodes a peptide or protein that enables purification or screening.
  • Such fusion partners include, but are not limited to, polyhistidine tags (His-tags) (for example His6 (SEQ ID NO: 223) and His10 (SEQ ID NO: 224)) or other tags for use with Immobilized Metal Affinity Chromatography (IMAC) systems (e.g., Ni+2 affinity columns), GST fusions, MBP fusions, Strep-tag, the BSP biotinylation target sequence of the bacterial enzyme BirA, and epitope tags which are targeted by antibodies (for example c-myc tags, flag-tags, and the like).
  • His-tags polyhistidine tags
  • IMAC Immobilized Metal Affinity Chromatography
  • such tags are useful for purification, for screening, or both.
  • an Fc variant is purified using a His-tag by immobilizing it to a Ni+2 affinity column, and then after purification the same His-tag is used to immobilize the antibody to a Ni+2 coated plate to perform an ELISA or other binding assay as described elsewhere herein.
  • a fusion partner enables the use of a selection method to screen Fc variants as described herein.
  • fusion partners that enable a variety of selection methods are available. For example, by fusing the members of an Fc variant library to the gene III protein, phage display can be employed. In some embodiments, fusion partners enable Fc variants to be labeled. Alternatively, in some embodiments, a fusion partner binds to a specific sequence on the expression vector, enabling the fusion partner and associated Fc variant to be linked covalently or noncovalently with the nucleic acid that encodes them.
  • the therapeutic moiety is, e.g., a peptide, a protein, an antibody, a siRNA, or a small molecule.
  • therapeutic antibodies that are coupled to the Fc variants of the present disclosure include, but are not limited to antibodies that recognize CD47.
  • therapeutic polypeptides that are coupled to the Fc variants of the present disclosure include, but are not limited to, CD47 binding polypeptides, including SIRP- ⁇ polypeptides. In such instances, the CD47 binding polypeptide is attached or fused to an Fc variant of the disclosure.
  • CD47 binding polypeptides include, but are not limited to, anti-CD47 antibodies or fragments thereof, and ligands of CD47 such as SIRP- ⁇ or a fragment thereof. Additional examples of CD47 binding polypeptides include, but are not limited to naturally-occurring forms of SIRP- ⁇ as well as mutants thereof.
  • a polypeptide comprising an Fc variant, wherein the Fc variant comprises an Fc domain dimer having two Fc domain monomers, wherein each Fc domain monomer independently is selected from (i) a human IgG1 Fc region consisting of mutations L234A, L235A, G237A, and N297A; (ii) a human IgG2 Fc region consisting of mutations A330S, P331S and N297A; or (iii) a human IgG4 Fc region comprising mutations S228P, E233P, F234V, L235A, delG236, and N297A.
  • the Fc domain monomers are identical (i.e., homodimer). In some embodiments, the Fc domain monomers are different (i.e., heterodimer). In some embodiments, at least one of the Fc domain monomers in an Fc domain dimer is a human IgG1 Fc region consisting of mutations L234A, L235A, G237A, and N297A. In some embodiments, at least one of the Fc domain monomers in an Fc domain dimer is a human IgG2 Fc region consisting of mutations A330S, P331S and N297A.
  • the Fc variant exhibits ablated or reduced binding to an Fc ⁇ receptor compared to the wild-type version of the human IgG Fc region. In some embodiments, the Fc variant exhibits ablated or reduced binding to CD16a, CD32a, CD32b, CD32c, and CD64 Fc ⁇ receptors compared to the wild-type version of the human IgG Fc region. In some embodiments, the Fc variant exhibits ablated or reduced binding to C1q compared to the wild-type version of the human IgG Fc fusion.
  • At least one of the Fc domain monomers in an Fc domain dimer is a human IgG4 Fc region comprising mutations S228P, E233P, F234V, L235A, delG236, and N297A.
  • the Fc variant exhibits ablated or reduced binding to a Fc ⁇ receptor compared to the wild-type human IgG4 Fc region.
  • the Fc variant exhibits ablated or reduced binding to CD16a and CD32b Fc ⁇ receptors compared to the wild-type version of its human IgG4 Fc region.
  • the Fc variant binds to an Fc ⁇ receptor with a K D greater than about 55 ⁇ 10 ⁇ 6 M.
  • the Fc variant further comprises a CD47 binding polypeptide.
  • the Fc variant exhibits ablated or reduced binding to an Fc ⁇ receptor compared to a wild-type version of a human IgG Fc region.
  • the CD47 binding polypeptide does not cause acute anemia in rodents and non-human primates. In some embodiments, the CD47 binding polypeptide does not cause acute anemia in humans.
  • the CD47 binding polypeptide is a signal-regulatory protein ⁇ (SIRP- ⁇ ) polypeptide or a fragment thereof.
  • SIRP- ⁇ polypeptide comprises a SIRP- ⁇ D1 variant comprising the amino acid sequence, EEELQX 1 IQPDKSVLVAAGETATLRCTX 2 TSLX 3 PVGPIQWFRGAGPGRX 4 LIYNQX 5 EGX 6 FPR VTTVSDX 7 TKRNNMDFSIRIGX 8 ITPADAGTYYCX 9 KFRKGSPDDVEFKSGAGTELSVRAKPS (SEQ ID NO: 221), wherein X 1 is V or I; X 2 is A or I; X 3 is I or F; X 4 is E or V; X 5 is K or R; X 6 is H or P; X 7 is L or T; X 8 is any amino acid other than N; and X 9 is V or I.
  • the SIRP- ⁇ polypeptide comprises a SIRP- ⁇ D1 variant wherein X 1 is V or I; X 2 is A or I; X 3 is I or F; X 4 is E; X 5 is K or R; X 6 is H or P; X 7 is L or T; X 8 is not N; and X 9 is V.
  • a polypeptide comprising: a SIRP- ⁇ D1 variant, wherein the SIRP- ⁇ D1 variant is a non-naturally occurring high affinity SIRP- ⁇ D1 domain, wherein the SIRP- ⁇ D1 variant binds to human CD47 with an affinity that is at least 10-fold greater than the affinity of a naturally occurring D1 domain; and an Fc domain monomer, wherein the Fc domain monomer is linked to a second polypeptide comprising a second Fc domain monomer to form an Fc domain, wherein the Fc domain has ablated or reduced effector function.
  • the non-naturally occurring high affinity SIRP- ⁇ D1 domain comprises an amino acid mutation at residue 80.
  • a SIRP- ⁇ D1 variant wherein the SIRP- ⁇ D1 variant binds CD47 from a first species with a K D less than 250 nM; and wherein the SIRP- ⁇ D1 variant binds CD47 from a second species with a K D less than 250 nM; and the K D for CD47 from the first species and the K D for CD47 from the second species are within 100 fold of each other; wherein the first species and the second species are selected from the group consisting of: human, rodent, and non-human primate.
  • the SIRP- ⁇ D1 variant binds CD47 from at least 3 different species.
  • the non-human primate is cynomolgus monkey.
  • a polypeptide comprising (a) a SIRP- ⁇ D1 domain that binds human CD47 with a K D less than 250 nM; and (b) an Fc domain monomer linked to the N-terminus or the C-terminus of the SIRP- ⁇ D1 domain, wherein the polypeptide does not cause acute anemia in rodents and non-human primates.
  • the polypeptide is a non-naturally occurring variant of a human SIRP- ⁇ .
  • administration of the polypeptide in vivo results in hemoglobin reduction by less than 50% during the first week after administration.
  • the polypeptide further comprises at least one Fc variant, wherein the Fc variant comprises an Fc domain monomer selected from (i) a human IgG1 Fc region consisting of mutations L234A, L235A, G237A, and N297A; (ii) a human IgG2 Fc region consisting of mutations A330S, P331S and N297A; or (iii) a human IgG4 Fc region comprising mutations S228P, E233P, F234V, L235A, delG236, and N297A.
  • Fc variant comprises an Fc domain monomer selected from (i) a human IgG1 Fc region consisting of mutations L234A, L235A, G237A, and N297A; (ii) a human IgG2 Fc region consisting of mutations A330S, P331S and N297A; or (iii) a human IgG4 Fc region comprising mutations S
  • the Fc domain monomer is a human IgG1 Fc region consisting of mutations L234A, L235A, G237A, and N297A. In some embodiments, the Fc domain monomer is a human IgG2 Fc region consisting of mutations A330S, P331S and N297A.
  • the SIRP- ⁇ constructs of the disclosure include a SIRP- ⁇ domain or variant thereof that has its C-terminus joined to the N-terminus of an Fc domain monomer by way of a linker using conventional genetic or chemical means, e.g., chemical conjugation.
  • a linker e.g., a spacer
  • a polypeptide of the disclosure including a high affinity SIRP- ⁇ D1 variant is fused to an Fc domain monomer that is incapable of forming a dimer.
  • a polypeptide of the disclosure is fused to an Fc domain monomer that is capable of forming a dimer, e.g., a heterodimer, with another Fc domain monomer.
  • a polypeptide of the invention is fused to an Fc domain monomer and this fusion protein forms a homodimer.
  • a polypeptide of the disclosure is fused to a first Fc domain monomer and a different protein or peptide (e.g., an antibody variable region) is fused to a second Fc domain monomer.
  • a SIRP- ⁇ D1 domain or variant thereof is joined to a first Fc domain monomer and a therapeutic protein (e.g., a cytokine, an interleukin, an antigen, a steroid, an anti-inflammatory agent, or an immunomodulatory agent) is joined to a second Fc domain monomer.
  • a therapeutic protein e.g., a cytokine, an interleukin, an antigen, a steroid, an anti-inflammatory agent, or an immunomodulatory agent
  • the first and second Fc domain monomers form a heterodimer.
  • a SIRP- ⁇ D1 variant polypeptide (e.g., any of the variants described in Tables 2, 5, and 6) is fused to an Fc polypeptide or Fc variant polypeptide, such as an Fc domain monomer.
  • Fc polypeptide or Fc variant polypeptide such as an Fc domain monomer.
  • polypeptides comprising a SIRP- ⁇ D1 variant polypeptide and a fused Fc variant polypeptide include, but are not limited to, SEQ ID NOS: 96-137, 214, and 216 shown in Table 8.
  • the polypeptide comprises a high affinity SIRP- ⁇ D1 domain that has at least 85% sequence identity (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity) to any variant provided in Table 8.
  • sequence identity e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity
  • the polypeptide comprises a high affinity SIRP- ⁇ D1 domain that has at least 85% sequence identity (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity) to SEQ ID NOs: 98-104, 107-113, 116-122, or 135-137 in Table 8.
  • the polypeptide comprises (a) a signal-regulatory protein ⁇ (SIRP- ⁇ ) D1 variant, wherein the SIRP- ⁇ D1 variant comprises the amino acid sequence, EEX 1 X 2 QX 3 IQPDKX 4 VX 5 VAAGEX 6 X 7 X 8 LX 9 CTX 10 TSLX 11 PVGPIQWFRGAGPX 12 RX 13 LIYNQ X 14 X 15 GX 16 FPRVTTVSX 17 X 18 TX 19 RX 20 NMDFX 21 IX 22 IX 23 X 24 ITX 25 ADAGTYYCX 26 KX 27 RKGS PDX 28 X 29 EX 30 KSGAGTELSVRX 31 KPS (SEQ ID NO: 47), wherein X 1 is E, or G; X 2 is L, I, or V; X 3 is V, L, or I; X 4 is S, or F; X 5 is L, or S; X 6 is S, or T; X 7 is A, or
  • the polypeptide comprises a SIRP- ⁇ D1 variant wherein the SIRP- ⁇ D1 variant comprises an amino acid sequence according to SEQ ID NO: 47; an Fc variant comprising an Fc domain dimer having two Fc domain monomers, wherein one of the Fc domain monomers in the Fc domain dimer comprises a human IgG1 Fc region comprising L234A, L235A, G237A, and N297A mutations.
  • a SIRP- ⁇ D1 variant polypeptide (e.g., any of the variants described in Tables 2, 5, and 6) is fused to a first Fc domain monomer either at the N-terminus or at the C-terminus.
  • the first Fc domain monomer is incapable of forming an Fc domain or a dimer.
  • the first Fc domain monomer combines with a second Fc domain monomer to form an Fc domain or a dimer.
  • the first and second Fc domain monomers include amino acid substitutions that promote heterodimerization between the first and second domain monomers.
  • each of the two Fc domain monomers in an Fc domain includes amino acid substitutions that promote the heterodimerization of the two monomers.
  • a SIRP- ⁇ construct is formed, for example, from a first subunit including a SIRP- ⁇ D1 variant polypeptide fused to a first Fc domain monomer and a second subunit including a second Fc domain monomer (e.g., without a SIRP- ⁇ D1 variant polypeptide or any other polypeptide).
  • a construct has a single SIRP- ⁇ D1 variant polypeptide linked to an Fc domain (e.g., single arm).
  • a construct has two SIRP- ⁇ D1 variant polypeptides linked to an Fc domain (e.g., double arm).
  • a SIRP- ⁇ D1 variant having a K D of about 500 nM is particularly useful in a double arm construct.
  • a SIRP- ⁇ D1 variant having a K D of about 50 nM is particularly useful in a double arm construct.
  • a SIRP- ⁇ D1 variant having a K D of about 5 nM is useful in a double arm construct and a single arm construct.
  • a SIRP- ⁇ D1 variant having a K D of about 500 pM is useful in a double arm construct and a single arm construct.
  • a SIRP- ⁇ D1 variant having a K D of about 100 pM is useful in a double arm construct and a single arm construct. In some embodiments, a SIRP- ⁇ D1 variant having a K D of about 50 pM is useful in a double arm construct and a single arm construct. In some embodiments, a SIRP- ⁇ D1 variant having a K D of about 10 pM is useful in a double arm construct and a single arm construct.
  • heterodimerization of Fc domain monomers is promoted by introducing different, but compatible, substitutions in the two Fc domain monomers, such as “knob-into-hole” residue pairs and charge residue pairs.
  • the knob and hole interaction favors heterodimer formation, whereas the knob-knob and the hole-hole interaction hinder homodimer formation due to steric clash and deletion of favorable interactions.
  • a hole refers to a void that is created when an original amino acid in a protein is replaced with a different amino acid having a smaller side-chain volume.
  • a knob refers to a bump that is created when an original amino acid in a protein is replaced with a different amino acid having a larger side-chain volume.
  • an amino acid being replaced is in the CH3 antibody constant domain of an Fc domain monomer and involved in the dimerization of two Fc domain monomers.
  • a hole in one CH3 antibody constant domain is created to accommodate a knob in another CH3 antibody constant domain, such that the knob and hole amino acids act to promote or favor the heterodimerization of the two Fc domain monomers.
  • a hole in one CH3 antibody constant domain is created to better accommodate an original amino acid in another CH3 antibody constant domain.
  • a knob in one CH3 antibody constant domain is created to form additional interactions with original amino acids in another CH3 antibody constant domain.
  • a hole is constructed by replacing amino acids having larger side chains such as tyrosine or tryptophan with amino acids having smaller side chains such as alanine, valine, or threonine, for example a Y407V mutation in the CH3 antibody constant domain.
  • a knob is constructed by replacing amino acids having smaller side chains with amino acids having larger side chains, for example a T366W mutation in the CH3 antibody constant domain.
  • one Fc domain monomer includes the knob mutation T366W and the other Fc domain monomer includes hole mutations T366S, L358A, and Y407V.
  • a polypeptide of the disclosure including a high affinity SIRP- ⁇ D1 variant is fused to an Fc domain monomer including the knob mutation T366W to limit unwanted knob-knob homodimer formation.
  • knob-into-hole amino acid pairs are included, without limitation, in Table 9 and examples of knob-into-hole Fc variants and SIRP- ⁇ -Fc fusions are provided in Table 10.
  • electrostatic steering is also used to control the dimerization of Fc domain monomers.
  • Electrostatic steering refers to the utilization of favorable electrostatic interactions between oppositely charged amino acids in peptides, protein domains, and proteins to control the formation of higher ordered protein molecules.
  • one or more amino acid residues that make up the CH3-CH3 interface are replaced with positively- or negatively-charged amino acid residues such that the interaction becomes electrostatically favorable or unfavorable depending on the specific charged amino acids introduced.
  • a positively-charged amino acid in the interface such as lysine, arginine, or histidine, is replaced with a negatively-charged amino acid such as aspartic acid or glutamic acid.
  • a negatively-charged amino acid in the interface is replaced with a positively-charged amino acid.
  • the charged amino acids are introduced to one of the interacting CH3 antibody constant domains, or both.
  • introducing charged amino acids to the interacting CH3 antibody constant domains of the two Fc domain monomers promotes the selective formation of heterodimers of Fc domain monomers as controlled by the electrostatic steering effects resulting from the interaction between charged amino acids. Examples of electrostatic steering amino acid pairs are included, without limitation, in Table 11.
  • a first Fc domain monomer and a second Fc domain monomer each includes one or more of the following amino acid substitutions: T366W, T366S, L368A, Y407V, T366Y, T394W, F405W, Y349T, Y349E, Y349V, L351T, L351H, L351N, L351K, P353S, S354D, D356K, D356R, D356S, E357K, E357R, E357Q, S364A, T366E, L368T, L368Y, L368E, K370E, K370D, K370Q, K392E, K392D, T394N, P395N, P396T, V397T, V397Q, L398T, D399K, D399R, D399N, F405T, F405H, F405R
  • an Fc domain monomer comprises: (a) one of the following amino acid substitutions relative to wild type human IgG1: T366W, T366S, L368A, Y407V, T366Y, T394W, F405W, Y349T, Y349E, Y349V, L351T, L351H, L351N, L351K, P353S, S354D, D356K, D356R, D356S, E357K, E357R, E357Q, S364A, T366E, L368T, L368Y, L368E, K370E, K370D, K370Q, K392E, K392D, T394N, P395N, P396T, V397T, V397Q, L398T, D399K, D399R, D399N, F405T, F405H, F405R,
  • an Fc domain monomer comprises: (a) one of the following amino acid substitutions relative to wild type human IgG1: T366W, T366S, L368A, Y407V, T366Y, T394W, F405W, Y349T, Y349E, Y349V, L351T, L351H, L351N, L351K, P353S, S354D, D356K, D356R, D356S, E357K, E357R, E357Q, S364A, T366E, L368T, L368Y, L368E, K370E, K370D, K370Q, K392E, K392D, T394N, P395N, P396T, V397T, V397Q, L398T, D399K, D399R, D399N, F405T, F405H, F405R,
  • the first and second Fc domain monomers include different amino acid substitutions.
  • the first Fc domain monomer includes T366W.
  • the second Fc domain monomer includes T366S, L368A, and Y407V.
  • the first Fc domain monomer includes D399K.
  • the second Fc domain monomer includes K409D.
  • polypeptides comprising a signal-regulatory protein ⁇ (SIRP- ⁇ ) D1 variant comprising a SIRP- ⁇ D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP- ⁇ D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP- ⁇ D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92.
  • SIRP- ⁇ signal-regulatory protein ⁇
  • polypeptides comprising an Fc variant, wherein the Fc variant comprises an Fc domain dimer having two Fc domain monomers, wherein each Fc domain monomer independently is selected from (i) a human IgG1 Fc region consisting of mutations L234A, L235A, G237A, and N297A; (ii) a human IgG2 Fc region consisting of mutations A330S, P331S and N297A; or (iii) a human IgG4 Fc region comprising mutations S228P, E233P, F234V, L235A, delG236, and N297A.
  • Fusion to serum albumins can improve the pharmacokinetics of protein pharmaceuticals, and in some embodiments, polypeptides of the disclosure, including a high affinity SIRP- ⁇ D1 variant described herein, is joined with a serum albumin.
  • Serum albumin is a globular protein that is abundant in blood in mammals. Serum albumin is produced in the liver and can constitute about half of the blood serum proteins. It is monomeric and soluble in the blood. Some of the most crucial functions of serum albumin include transporting hormones, fatty acids, and other proteins in the body, buffering pH, and maintaining osmotic pressure needed for proper distribution of bodily fluids between blood vessels and body tissues.
  • serum albumin is human serum albumin (HSA).
  • HSA human serum albumin
  • an HSA is joined to the C-terminus of the polypeptide of the disclosure to increase the serum half-life of the polypeptide.
  • the N-terminus of an HSA is joined to the C-terminus of the polypeptide of the disclosure.
  • a HSA is joined, either directly or through a linker, to the C-terminus of the polypeptide. In some embodiments, an HSA is joined, either directly or through a linker, to the N-terminus of the polypeptide.
  • a human serum albumin comprises the sequence of amino acids (aa) 25-609 of UniProt ID NO: P02768 (SEQ ID NO: 12) as shown in Table 12.
  • the HSA joined to a high affinity SIRP- ⁇ D1 variant e.g., any SIRP- ⁇ D1 variant described in Tables 2, 5, and 6) includes amino acids 25-609 (SEQ ID NO: 12) of the sequence of UniProt ID NO: P02768.
  • the HSA includes C34S or K573P substitutions, relative to SEQ ID NO: 12.
  • the HSA includes C34S and K573P substitutions, relative to SEQ ID NO: 12.
  • a serum albumin is fused genetically to a polypeptide of the disclosure or joined to the polypeptide through chemical means, e.g., chemical conjugation.
  • a spacer is inserted between the polypeptide and the HSA. Some examples of spacers are described in detail elsewhere herein.
  • a spacer is A or AAAL SEQ ID NO: 178).
  • the fusion of an HSA in a polypeptide of the disclosure leads to prolonged retention of the polypeptide as well as increases in half-life.
  • Polypeptides comprising a SIRP- ⁇ D1 variant polypeptide and a fused HSA include, but are not limited to, SEQ ID NOS: 150-159 provided in Table 13.
  • the polypeptide includes a high affinity SIRP- ⁇ D1 domain that has at least 85% sequence identity (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity) to any variant provided in Table 13.
  • sequence identity e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity
  • the polypeptide includes a high affinity SIRP- ⁇ D1 domain that has at least 85% sequence identity (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity) to SEQ ID NO: 154, 155, and 159 in Table 13.
  • sequence identity e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity
  • polypeptides comprising a signal-regulatory protein ⁇ (SIRP- ⁇ ) D1 variant comprising a SIRP- ⁇ D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP- ⁇ D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP- ⁇ D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92.
  • SIRP- ⁇ signal-regulatory protein ⁇
  • polypeptides comprising an Fc variant, wherein the Fc variant comprises an Fc domain dimer having two Fc domain monomers, wherein each Fc domain monomer independently is selected from (i) a human IgG1 Fc region consisting of mutations L234A, L235A, G237A, and N297A; (ii) a human IgG2 Fc region consisting of mutations A330S, P331S and N297A; or (iii) a human IgG4 Fc region comprising mutations S228P, E233P, F234V, L235A, delG236, and N297A.
  • Binding to serum proteins can improve the pharmacokinetics of protein pharmaceuticals, and in particular, in some embodiments, the polypeptides described herein are fused with serum protein-binding peptides or proteins.
  • albumin-binding peptide refers to an amino acid sequence of about 12 to 16 amino acids that has affinity for and functions to bind a serum albumin protein.
  • an albumin-binding peptide originates from human, mouse, or rat.
  • a polypeptide of the disclosure including a high affinity SIRP- ⁇ D1 variant is fused to an albumin-binding peptide that displays binding activity to serum albumin to increase the half-life of the polypeptide.
  • an albumin-binding peptide that can be used in the methods and compositions described here are available.
  • the albumin binding peptide includes the sequence DICLPRWGCLW (SEQ ID NO: 160).
  • an albumin-binding peptide is fused genetically to a polypeptide of the disclosure or attached to the polypeptide through chemical means, e.g., chemical conjugation.
  • a linker e.g., a spacer
  • a linker is inserted between the polypeptide and the albumin-binding peptide to allow for additional structural and spatial flexibility of the fusion protein.
  • linkers e.g., a spacer
  • an albumin-binding peptide is fused to the N- or C-terminus of a polypeptide of the disclosure.
  • the N-terminus of the albumin-binding peptide is directly fused to the C-terminus of a polypeptide of the disclosure through a peptide bond.
  • the C-terminus of the albumin-binding peptide is directly fused to the N-terminus of a polypeptide of the disclosure through a peptide bond.
  • the fusion of an albumin-binding peptide to a polypeptide of the disclosure leads to prolonged retention of the polypeptide through its binding to serum albumin.
  • polypeptides comprising a signal-regulatory protein ⁇ (SIRP- ⁇ ) D1 variant comprising a SIRP- ⁇ D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP- ⁇ D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP- ⁇ D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92.
  • SIRP- ⁇ signal-regulatory protein ⁇
  • polypeptides comprising an Fc variant, wherein the Fc variant comprises an Fc domain dimer having two Fc domain monomers, wherein each Fc domain monomer independently is selected from (i) a human IgG1 Fc region consisting of mutations L234A, L235A, G237A, and N297A; (ii) a human IgG2 Fc region consisting of mutations A330S, P331S and N297A; or (iii) a human IgG4 Fc region comprising mutations S228P, E233P, F234V, L235A, delG236, and N297A.
  • a polypeptide including a high affinity SIRP- ⁇ D1 domain is fused to a polymer (e.g., polyethylene glycol, PEG).
  • a polymer e.g., polyethylene glycol, PEG
  • the attachment of a polymer to a protein pharmaceutical “masks” the protein pharmaceutical from the host's immune system.
  • certain polymers such as hydrophilic polymers, provide water solubility to hydrophobic proteins and drugs.
  • such polymers include PEG, polysialic acid chain, and PAS chain molecules.
  • a polymer such as PEG is covalently attached to a cysteine substitution or addition in the polypeptide.
  • the cysteine substitution in the polypeptide is I7C, A16C, S20C, T20C, A45C, G45C, G79C, S79C, or A84C, relative to the sequence of any one of the sequences provided in Tables 2, 5, and 6.
  • the addition of a cysteine residue in the polypeptide is introduced using peptide synthesis, genetic modification, molecular cloning, or any combinations thereof.
  • the polymer for example PEG, is attached to the cysteine residue using cysteine-maleimide conjugation.
  • a polymer such as PEG is covalently attached to the polypeptide including a high affinity SIRP- ⁇ D1 variant either at the N- or C-terminus or at an internal location, using conventional chemical methods such as chemical conjugation.
  • polypeptides comprising a signal-regulatory protein ⁇ (SIRP- ⁇ ) D1 variant comprising a SIRP- ⁇ D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP- ⁇ D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP- ⁇ D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92.
  • SIRP- ⁇ signal-regulatory protein ⁇
  • polypeptides comprising an Fc variant, wherein the Fc variant comprises an Fc domain dimer having two Fc domain monomers, wherein each Fc domain monomer independently is selected from (i) a human IgG1 Fc region consisting of mutations L234A, L235A, G237A, and N297A; (ii) a human IgG2 Fc region consisting of mutations A330S, P331S and N297A; or (iii) a human IgG4 Fc region comprising mutations S228P, E233P, F234V, L235A, delG236, and N297A.
  • a polypeptide having a high affinity SIRP- ⁇ D1 variant comprises a bispecific construct.
  • a bispecific construct refers to a construct that has two target-interacting domains.
  • a bispecific construct includes an Fc domain and two target-interacting domains: (1) a SIRP- ⁇ D1 domain or variant thereof (e.g., any of the variants provided in Tables 2, 5, and 6) and (2) an antibody variable domain.
  • a bispecific construct includes a first polypeptide and a second polypeptide.
  • the first polypeptide has the formula A-L-B, wherein A includes a SIRP- ⁇ D1 domain or variant thereof, L is a linker, and B includes a first Fc domain monomer.
  • the second polypeptide has the formula A′-L′-B′, wherein A′ includes an antibody variable domain, L′ is a linker; and B′ includes a second Fc domain monomer.
  • the orientation of the first and second polypeptides is B-L-A and B′-L′-A′, respectively.
  • the first and second Fc domain monomers combine to form the Fc domain in the bispecific construct.
  • a bispecific construct is of any immunoglobulin antibody isotypes (e.g., IgG, IgE, IgM, IgA, and IgD).
  • a variant of a SIRP- ⁇ D1 domain includes the D domain of a wild-type human SIRP- ⁇ and one or more amino acid substitutions relative to the wild-type D1 domains (e.g., any SIRP- ⁇ D1 variant as described in Tables 2, 5, and 6).
  • a SIRP- ⁇ D1 variant binds with higher binding affinity to CD47 than does a wild-type human SIRP- ⁇ D1 domain.
  • the antibody variable domain in a bispecific construct targets a cell antigen (e.g., a cell antigen on a cancer cell).
  • An antibody variable domain refers to the portions of the light and heavy chains of an antibody that include amino acid sequences of complementary determining regions (CDRs, e.g., CDR L1, CDR L2, CDR L3, CDR H1, CDR H2, and CDR H3) and framework regions (FRs).
  • CDRs complementary determining regions
  • FRs framework regions
  • the variable domain of the antibody can confer on the antibody the ability to bind to specific antigens.
  • Many different antibody variable domain molecules can be constructed.
  • the antibody variable domain molecules used includes, but is not limited to, single-chain Fv.
  • the antibody variable domain in a bispecific construct targets a cell antigen (e.g., a cell antigen on a cancer cell or on an immune cell).
  • a cell antigen e.g., a cell antigen on a cancer cell or on an immune cell.
  • Some proteins are expressed at higher levels in cancer cells than in non-cancer cells.
  • a cancer antigen is a protein that is expressed preferentially by cancer cells (e.g., it is expressed at higher levels on cancer cells than on non-cancer cells) and in some instances it is expressed solely by cancer cells.
  • proteins e.g., proteins expressed by cancer cells, that are targeted by an antibody variable domain forming an Fc domain with a high affinity SIRP- ⁇ domain or variant thereof include, but are not limited to: 5T4, AGS-16, ALK1, ANG-2, B7-H3, B7-H4, c-fms, c-Met, CA6, CD123, CD19, CD20, CD22, EpCAM, CD30, CD32b, CD33, CD37, CD38, CD40, CD52, CD70, CD74, CD79b, CD98, CEA, CEACAM5, CLDN18.2, CLDN6, CS1, CXCR4, DLL-4, EGFR, EGP-1, ENPP3, EphA3, ETBR, FGFR2, fibronectin, FR-alpha, GCC, GD2, glypican-3, GPNMB, HER-2, HER3, HLA-DR, ICAM-1, IGF-1R, IL-3R, LIV-1, mesothelin,
  • each of the first and second Fc domain monomers in the Fc domain of the bispecific construct includes one or more amino acid substitutions that promote the heterodimerization of the first and second Fc domain monomers.
  • Methods of promoting heterodimerization of Fc domain monomers are described in detail further herein, see, e.g., knob-into-hole strategy and electrostatic steering strategy.
  • the Fc domain of the bispecific construct is mutated to lack one or more effector functions, typical of a “dead Fc domain.”
  • the Fc domain of the bispecific construct is from an IgG1 antibody and includes amino acid substitutions L14A, L15A, and G17A, relative to the sequence of SEQ ID NO: 161 (Table 14) to reduce the interaction or binding between the Fc domain and an Fc ⁇ receptor.
  • an Fc domain monomer is from an IgG1 antibody and includes one or more of amino acid substitutions L234A, L235A, G237A, and N297A (as designated according to the EU numbering system per Kabat et al., 1991.
  • the Fc variants described herein are minimally glycosylated or have reduced glycosylation.
  • deglycosylation is accomplished with a mutation of N297A, or by mutating N297 to any amino acid which is not N (as designated according to the EU numbering system per Kabat, et al. (1991)).
  • the bispecific construct is designed such that it has preferential binding to proteins (e.g., receptors such as Fc receptors) expressed by different cell types.
  • IgG2 having amino acid substitutions A111S and P112S (relative to SEQ ID NO: 162, Table 14) display significantly reduced binding to Fc ⁇ RIIIa 131 H compared to wild-type IgG2.
  • the Fc variants herein are minimally glycosylated or have reduced glycosylation.
  • deglycosylation is accomplished with a mutation of N297A, or by mutating N297 to any amino acid which is not N (as designated according to the EU numbering system per Kabat, et al. (1991)).
  • a bispecific construct includes an Fc domain of the IgG2 or IgG4 subclass.
  • a bispecific construct including an Fc domain of an IgG2 subclass includes amino acid substitutions A111S and P112S, relative to SEQ ID NO: 162 (Table 14).
  • the Fc variant comprises a human IgG2 Fc sequence comprising one or more of A330S, P331S and N297A amino acid substitutions (as designated according to the EU numbering system per Kabat, et al. (1991)).
  • Amino Acid Sequence 161 DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLH QDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR EEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDS DGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSP G 162 ERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVV DVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVV HQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPS REEMTKNQV
  • a SIRP- ⁇ construct comprising a SIRP- ⁇ D1 domain or variant thereof joined to a first Fc domain monomer by way of a linker and a second Fc domain monomer, in which the first and second Fc domain monomers combine to form an Fc domain is shown in FIG. 1 .
  • a SIRP- ⁇ construct includes a SIRP- ⁇ D1 domain or variant thereof joined to a first Fc domain monomer by way of a linker and an antibody variable domain joined to a second Fc domain monomer by way of a linker, in which the first and second Fc domain monomers combine to form an Fc domain (as shown in FIG. 2 ).
  • a SIRP- ⁇ construct includes a SIRP- ⁇ D1 domain or variant thereof joined to a first Fc domain monomer by way of a linker and a therapeutic protein (e.g., a cytokine, an interleukin, an antigen, a steroid, an anti-inflammatory agent, or an immunomodulatory agent) joined to a second Fc domain monomer by way of a linker, in which the first and second Fc domain monomers combine to form an Fc domain (as shown in FIG. 3 ).
  • a therapeutic protein e.g., a cytokine, an interleukin, an antigen, a steroid, an anti-inflammatory agent, or an immunomodulatory agent
  • FIG. 4 A illustrates a SIRP- ⁇ construct having a SIRP- ⁇ D1 domain or variant thereof joined to an Fc domain monomer including a knob mutation, e.g., T366W, to limit unwanted knob-knob homodimer formation.
  • FIG. 4 A illustrates a SIRP- ⁇ construct having a SIRP- ⁇ D1 domain or variant thereof joined to an Fc domain monomer including a knob mutation, e.g., T366W, to limit unwanted knob-knob homodimer formation.
  • a SIRP- ⁇ construct having a having a SIRP- ⁇ D1 domain or variant thereof joined to an Fc domain monomer including hole mutations, e.g., T366S, L358A, and Y407V.
  • hole mutations e.g., T366S, L358A, and Y407V.
  • similar Fc domain heterodimerization strategies are applied to the Fc domains in the constructs described in FIGS. 2 and 3 .
  • a SIRP- ⁇ construct includes a fusion protein of a SIRP- ⁇ D1 domain or variant thereof joined to an Fc domain monomer (as shown in FIG. 5 A ). In some embodiments, this fusion protein forms a homodimer (as shown in FIG. 5 B ).
  • Fc variants of the disclosure coupled with a fusion partner preferably exhibit reduced or ablated binding to at least one of Fc ⁇ receptors CD16a, CD32a, CD32b, CD32c, and CD64 as compared to a similar polypeptide construct comprising the native or wild-type (non-mutated) antibody Fc region.
  • the Fc variant or fusion partner described herein exhibits reduced or ablated binding to the CD16a, CD32a, CD32b, CD32c, and CD64 Fc ⁇ receptors.
  • Fc variants of the disclosure coupled with a fusion partner exhibit reduced binding to complement component C1q and CDC compared to a similar polypeptide construct comprising the native or wild-type (non-mutated) Fc region.
  • the Fc variant exhibits at least a 5%, 10%, 15%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or greater reduction in C1q binding compared to a polypeptide construct comprising a wild-type Fc region.
  • the Fc variant exhibits reduced CDC compared to a polypeptide construct comprising the native or wild-type (non-mutated) Fc region.
  • the Fc variant exhibits at least a 5%, 10%, 15%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or greater reduction in CDC compared to a polypeptide construct comprising a wild-type Fc region.
  • polypeptides comprising a signal-regulatory protein ⁇ (SIRP- ⁇ ) D1 variant comprising a SIRP- ⁇ D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP- ⁇ D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP- ⁇ D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92.
  • SIRP- ⁇ signal-regulatory protein ⁇
  • polypeptides comprising an Fc variant, wherein the Fc variant comprises an Fc domain dimer having two Fc domain monomers, wherein each Fc domain monomer independently is selected from (i) a human IgG1 Fc region consisting of mutations L234A, L235A, G237A, and N297A; (ii) a human IgG2 Fc region consisting of mutations A330S, P331S and N297A; or (iii) a human IgG4 Fc region comprising mutations S228P, E233P, F234V, L235A, delG236, and N297A.
  • a linker is used to describe a linkage or connection between polypeptides or protein domains or associated non-protein moieties.
  • a linker is a linkage or connection between an Fc domain monomer, an albumin-binding peptide, or an HSA, and a high affinity SIRP- ⁇ D1 variant.
  • the linker connects the C-terminus of the SIRP- ⁇ D1 variant and the N-terminus of the Fc domain monomer, the albumin-binding peptide, or the HSA, such that the two polypeptides are joined to each other in tandem series.
  • a linker is a simple covalent bond, e.g., a peptide bond, a synthetic polymer such as a polyethylene glycol (PEG) polymer, or any kind of bond created from a chemical reaction, e.g. chemical conjugation.
  • a linker is a peptide bond
  • the carboxylic acid group at the C-terminus of one protein domain reacts with the amino group at the N-terminus of another protein domain in a condensation reaction to form a peptide bond.
  • the peptide bond is formed from synthetic means through a conventional organic chemistry reaction, or by natural production from a host cell, wherein a nucleic acid molecule encoding the DNA sequences of both proteins (e.g., an Fc domain monomer and a high affinity SIRP- ⁇ D1 variant) in tandem series can be directly transcribed and translated into a contiguous polypeptide encoding both proteins by the necessary molecular machineries (e.g., DNA polymerase and ribosome) in the host cell.
  • a nucleic acid molecule encoding the DNA sequences of both proteins e.g., an Fc domain monomer and a high affinity SIRP- ⁇ D1 variant
  • the necessary molecular machineries e.g., DNA polymerase and ribosome
  • a linker is a synthetic polymer (e.g., a PEG polymer)
  • the polymer is functionalized with reactive chemical functional groups at each end to react with the terminal amino acids at the connecting ends of two proteins.
  • a linker except peptide bond mentioned above
  • chemical functional groups e.g., amine, carboxylic acid, ester, azide, or other functional groups
  • the two functional groups then react through synthetic chemistry means to form a chemical bond, thus connecting the two proteins together.
  • a linker between an Fc domain monomer, an albumin-binding peptide, or an HSA, and a polypeptide of the disclosure is an amino acid spacer including about 1-200 amino acids.
  • Suitable peptide spacers include peptide linkers containing flexible amino acid residues such as glycine and serine. Examples of linker sequences are provided in Table 15.
  • a spacer contains motifs, e.g., multiple or repeating motifs, of GS, GG, GGS, GGG, GGGGS (SEQ ID NO: 163), GGSG (SEQ ID NO: 164), or SGGG (SEQ ID NO: 165).
  • a spacer contains 2 to 12 amino acids including motifs of GS, e.g., GS, GSGS (SEQ ID NO: 166), GSGSGS (SEQ ID NO: 167), GSGSGSGS (SEQ ID NO: 168), GSGSGSGSGS (SEQ ID NO: 169), or GSGSGSGSGSGSGS (SEQ ID NO: 170).
  • a spacer contains 3 to 12 amino acids including motifs of GGS, e.g., GGS, GGSGGS (SEQ ID NO: 171), GGSGGSGGS (SEQ ID NO: 172), and GGSGGSGGSGGS (SEQ ID NO: 173).
  • a spacer contains 4 to 12 amino acids including motifs of GGSG (SEQ ID NO: 164), e.g., GGSG (SEQ ID NO: 164), GGSGGGSG (SEQ ID NO: 174), or GGSGGGSGGGSG (SEQ ID NO: 175).
  • a spacer contains motifs of GGGGS (SEQ ID NO: 163), e.g., GGGGSGGGGSGGGGS (SEQ ID NO: 176).
  • a spacer contains amino acids other than glycine and serine, e.g., AAS (SEQ ID NO: 177), AAAL (SEQ ID NO: 178), AAAK (SEQ ID NO: 179), AAAR (SEQ ID NO: 180), EGKSSGSGSESKST (SEQ ID NO: 181), GSAGSAAGSGEF (SEQ ID NO: 182), AEAAAKEAAAKA (SEQ ID NO: 183), KESGSVSSEQLAQFRSLD (SEQ ID NO: 184), GGGGAGGGG (SEQ ID NO: 185), GENLYFQSGG (SEQ ID NO: 186), SACYCELS (SEQ ID NO: 187), RSIAT (SEQ ID NO: 188), RPACKIPNDLKQKVMNH (SEQ ID NO: 189), GGSAGGSGSGSSGGSSGASGTGTAGGTGSGSGTGSG (SEQ ID NO: 190), AAANSSIDLISVPVDSR (SEQ ID NO: 189
  • a spacer contains motifs, e.g., multiple or repeating motifs, of EAAAK (SEQ ID NO: 193).
  • a spacer contains motifs, e.g., multiple or repeating motifs, of proline-rich sequences such as (XP)n, in which X is any amino acid (e.g., A, K, or E) and n is from 1-5, and PAPAP (SEQ ID NO: 194).
  • the length of the peptide spacer and the amino acids used is adjusted depending on the two proteins involved and the degree of flexibility desired in the final protein fusion polypeptide. In some embodiments, the length of the spacer is adjusted to ensure proper protein folding and avoid aggregate formation.
  • a spacer such as a spacer between an HSA and a polypeptide disclosed herein, is A or AAAL (SEQ ID NO: 178).
  • polypeptides comprising a signal-regulatory protein ⁇ (SIRP- ⁇ ) D1 variant comprising a SIRP- ⁇ D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP- ⁇ D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP- ⁇ D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92.
  • SIRP- ⁇ signal-regulatory protein ⁇
  • polypeptides comprising an Fc variant, wherein the Fc variant comprises an Fc domain dimer having two Fc domain monomers, wherein each Fc domain monomer independently is selected from (i) a human IgG1 Fc region consisting of mutations L234A, L235A, G237A, and N297A; (ii) a human IgG2 Fc region consisting of mutations A330S, P331S and N297A; or (iii) a human IgG4 Fc region comprising mutations S228P, E233P, F234V, L235A, delG236, and N297A.
  • the polypeptides of the disclosure are produced from a host cell.
  • a host cell refers to a vehicle that includes the necessary cellular components, e.g., organelles, needed to express the polypeptides and fusion polypeptides described herein from their corresponding nucleic acids.
  • the nucleic acids are included in nucleic acid vectors introduced into the host cell by transformation, transfection, electroporation, calcium phosphate precipitation, direct microinjection, infection, etc.
  • the choice of nucleic acid vectors depend on the host cell to be used.
  • host cells are of either prokaryotic (e.g., bacterial) or eukaryotic (e.g., mammalian) origin.
  • a polypeptide for example a polypeptide construct comprising a SIRP- ⁇ D1 variant (e.g., any variant provided in Tables 2, 5, and 6) and a fusion partner such as an Fc variant, HSA, and an albumin binding peptide, are produced by culturing a host cell transformed with a nucleic acid, preferably an expression vector, containing a nucleic acid encoding the polypeptide construct (e.g., Fc variant, linker, and fusion partner) under the appropriate conditions to induce or cause expression of the polypeptide construct.
  • the conditions appropriate for expression varies with the expression vector and the host cell chosen.
  • a wide variety of appropriate host cells are used, including, but not limited to, mammalian cells, bacteria, insect cells, and yeast.
  • mammalian cells including, but not limited to, mammalian cells, bacteria, insect cells, and yeast.
  • a variety of cell lines that find use in the present disclosure are described in the ATCC® cell line catalog, available from the American Type Culture Collection.
  • Fc variants of this disclosure are expressed in a cell that is optimized not to glycosylate proteins that are expressed by such cell, either by genetic engineering of the cell line or modifications of cell culture conditions such as addition of kifunensine or by using a naturally non-glycosylating host such as a prokaryote ( E. coli , etc.), and in some cases, modification of the glycosylation sequence in the Fc is not be needed.
  • a nucleic acid sequence encoding the amino acid sequence of a polypeptide of the disclosure can be prepared by a variety of methods. These methods include, but are not limited to, oligonucleotide-mediated (or site-directed) mutagenesis and PCR mutagenesis.
  • a nucleic acid molecule encoding a polypeptide of the disclosure is obtained using standard techniques, e.g., gene synthesis.
  • a nucleic acid molecule encoding a wild-type SIRP- ⁇ D1 domain is mutated to include specific amino acid substitutions using standard techniques, e.g., QuikChangeTM mutagenesis.
  • nucleic acid molecules are synthesized using a nucleotide synthesizer or PCR techniques.
  • the nucleic acids that encode a polypeptide construct are incorporated into an expression vector in order to express the protein.
  • a polypeptide construct comprising a SIRP- ⁇ D1 variant (e.g., any variant provided in Tables 2, 5, and 6) and a fusion partner such as an Fc variant, HSA, and an albumin binding peptide
  • a variety of expression vectors can be utilized for protein expression.
  • Expression vectors can comprise self-replicating, extra-chromosomal vectors or vectors which integrate into a host genome.
  • a vector can also include various components or elements.
  • the vector components include, but are not limited to, transcriptional and translational regulatory sequences such as a promoter sequence, a ribosomal binding site, a signal sequence, transcriptional start and stop sequences, translational start and stop sequences, 3′ and 5′ untranslated regions (UTRs), and enhancer or activator sequences; an origin of replication; a selection marker gene; and the nucleic acid sequence encoding the polypeptide of interest, and a transcription termination sequence.
  • expression vectors comprise a protein operably linked with control or regulatory sequences, selectable markers, any fusion partners, additional elements, or any combinations thereof.
  • operably linked means that the nucleic acid is placed into a functional relationship with another nucleic acid sequence.
  • these expression vectors include transcriptional and translational regulatory nucleic acid operably linked to the nucleic acid encoding the Fc variant, and are typically appropriate to the host cell used to express the protein.
  • a selection gene or marker such as, but not limited to, an antibiotic resistance gene or fluorescent protein gene, can be used to select for host cells containing the expression vector, for example by antibiotic or fluorescence expression. Various selection genes are available.
  • the components or elements of a vector are optimized such that expression vectors are compatible with the host cell type.
  • Expression vectors which find use in the present disclosure include, but are not limited to, those which enable protein expression in mammalian cells, bacteria, insect cells, yeast, and in in vitro systems.
  • mammalian cells are used as host cells to produce polypeptides of the disclosure.
  • mammalian cell types include, but are not limited to, human embryonic kidney (HEK) (e.g., HEK293, HEK293F), Chinese hamster ovary (CHO), HeLa, COS, PC3, Vero, MC3T3, NS0, Sp2/0, VERY, BHK, MDCK, W138, BT483, Hs578T, HTB2, BT20, T47D, NS0 (a murine myeloma cell line that does not endogenously produce any immunoglobulin chains), CRL7O30, and HsS78Bst cells.
  • HEK human embryonic kidney
  • CHO Chinese hamster ovary
  • E. coli cells are used as host cells to produce polypeptides of the disclosure.
  • E. coli strains include, but are not limited to, E. coli 294 (ATCC® 31,446), E. coli ⁇ 1776 (ATCC® 31,537, E. coli BL21 (DE3) (ATCC® BAA-1025), and E. coli RV308 (ATCC® 31,608).
  • Different host cells have characteristic and specific mechanisms for the posttranslational processing and modification of protein products (e.g., glycosylation).
  • appropriate cell lines or host systems are chosen to ensure the correct modification and processing of the polypeptide expressed.
  • a polypeptide construct for example a polypeptide construct comprising a SIRP- ⁇ D1 variant (e.g., any variant provided in Tables 2, 5, and 6) and a fusion partner such as an Fc variant, HSA, and an albumin binding peptide, are expressed in mammalian expression systems, including systems in which the expression constructs are introduced into the mammalian cells using virus such as retrovirus or adenovirus.
  • virus such as retrovirus or adenovirus.
  • human, mouse, rat, hamster, or primate cells are utilized. Suitable cells also include known research cells, including but not limited to Jurkat T cells, NIH3T3, CHO, COS, and 293 cells. Alternately, in some embodiments, proteins are expressed in bacterial cells.
  • Bacterial expression systems are well known in the art, and include Escherichia coli ( E. coli ), Bacillus subtilis, Streptococcus cremoris , and Streptococcus lividans .
  • polypeptide constructs comprising Fc variants are produced in insect cells such as but not limited to Sf9 and Sf21 cells or yeast cells such as but not limited to organisms from the genera Saccharomyces, Pichia, Kluyveromyces, Hansenula and Yarrowia .
  • polypeptide constructs comprising Fc variants are expressed in vitro using cell free translation systems. In vitro translation systems derived from both prokaryotic (e.g., E.
  • the Fc variants are produced by chemical synthesis methods such as, but not limited to, liquid-phase peptide synthesis and solid-phase peptide synthesis. In the case of in vitro transcription using a non-glycosylating system such as bacterial extracts, the Fc will not be glycosylated even in presence of the natural glycosylation site and therefore inactivation of the Fc will be equivalently obtained.
  • a polypeptide construct includes non-natural amino acids, amino acid analogues, amino acid mimetics, or any combinations thereof that function in a manner similar to the naturally occurring amino acids.
  • Naturally encoded amino acids generally refer to the 20 common amino acids (alanine, arginine, asparagine, aspartic acid, cysteine, glutamine, glutamic acid, glycine, histidine, isoleucine, leucine, lysine, methionine, phenylalanine, proline, serine, threonine, tryptophan, tyrosine, and valine) and pyrrolysine and selenocysteine.
  • Amino acid analogs refers to compounds that have the same basic chemical structure as a naturally occurring amino acid, e.g., a carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, such as, homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium.
  • such analogs have modified R groups (such as, norleucine) or modified peptide backbones, but generally retain the same basic chemical structure as a naturally occurring amino acid.
  • host cells used to produce polypeptides of the disclosure are grown in media suitable for culturing of the selected host cells.
  • suitable media for mammalian host cells include Minimal Essential Medium (MEM), Dulbecco's Modified Eagle's Medium (DMEM), Expi293TM Expression Medium, DMEM with supplemented fetal bovine serum (FBS), and RPMI-1640.
  • suitable media for bacterial host cells include Luria broth (LB) plus necessary supplements, such as a selection agent, e.g., ampicillin.
  • host cells are cultured at suitable temperatures, such as from about 20° C. to about 39° C., e.g., from about 25° C.
  • the pH of the medium is from about pH 6.8 to pH 7.4, e.g., pH 7.0, depending mainly on the host organism. If an inducible promoter is used in the expression vector, protein expression can be induced under conditions suitable for the activation of the promoter.
  • protein recovery involves disrupting the host cell, for example by osmotic shock, sonication, or lysis. Once the cells are disrupted, cell debris is removed by centrifugation or filtration. The proteins can then be further purified.
  • a polypeptide of the disclosure is purified by various methods of protein purification, for example, by chromatography (e.g., ion exchange chromatography, affinity chromatography, and size-exclusion column chromatography), centrifugation, differential solubility, or by any other standard technique for the purification of proteins.
  • the protein is isolated and purified by appropriately selecting and combining affinity columns such as Protein A column (e.g., POROS Protein A chromatography) with chromatography columns (e.g., POROS HS-50 cation exchange chromatography), filtration, ultra-filtration, de-salting and dialysis procedures.
  • a polypeptide is conjugated to marker sequences, such as a peptide to facilitate purification.
  • marker amino acid sequence is a hexa-histidine peptide (His6-tag (SEQ ID NO: 223)), which can bind to a nickel-functionalized agarose affinity column with micromolar affinity.
  • a hemagglutinin “HA” tag which corresponds to an epitope derived from the influenza hemagglutinin protein can be used.
  • polypeptides of the disclosure for example a polypeptide construct comprising a SIRP- ⁇ D1 variant (e.g., any variant provided in Tables 2, 5, and 6) and a fusion partner such as an Fc variant, HSA, and an albumin binding peptide, are produced by the cells of a subject (e.g., a human), e.g., in the context of gene therapy, by administrating a vector such as a viral vector (e.g., a retroviral vector, adenoviral vector, poxviral vector (e.g., vaccinia viral vector, such as Modified Vaccinia Ankara (MVA)), adeno-associated viral vector, and alphaviral vector) containing a nucleic acid molecule encoding a polypeptide of the disclosure.
  • a viral vector e.g., a retroviral vector, adenoviral vector, poxviral vector (e.g., vaccinia viral vector, such as Modified Vaccin
  • the vector once inside a cell of the subject (e.g., by transformation, transfection, electroporation, calcium phosphate precipitation, direct microinjection, infection, etc) can be used for the expression of a polypeptide disclosed herein.
  • the polypeptide is secreted from the cell.
  • treatment of a disease or disorder is the desired outcome, no further action is required.
  • collection of the protein is desired, blood is collected from the subject and the protein purified from the blood by various methods.
  • polypeptides comprising a signal-regulatory protein ⁇ (SIRP- ⁇ ) D1 variant comprising a SIRP- ⁇ D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP- ⁇ D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP- ⁇ D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92.
  • SIRP- ⁇ signal-regulatory protein ⁇
  • polypeptides comprising an Fc variant, wherein the Fc variant comprises an Fc domain dimer having two Fc domain monomers, wherein each Fc domain monomer independently is selected from (i) a human IgG1 Fc region consisting of mutations L234A, L235A, G237A, and N297A; (ii) a human IgG2 Fc region consisting of mutations A330S, P331S and N297A; or (iii) a human IgG4 Fc region comprising mutations S228P, E233P, F234V, L235A, delG236, and N297A.
  • compositions that include polypeptides described herein, such as polypeptides having a high affinity SIRP- ⁇ D1 variant.
  • a pharmaceutical composition of the disclosure includes a polypeptide of the disclosure as the therapeutic protein.
  • a pharmaceutical composition of the disclosure including a polypeptide described herein is used in combination with other agents or compositions (e.g., therapeutic agents, biologics, small molecules, or any combinations thereof) in a therapy.
  • one or more additional therapeutically active agents such as for example a small molecule, chemical compound or a biological compound such as polynucleotides and polypeptides including, but not limited to, siRNA, short polypeptides, and antibodies with therapeutic activity, are optionally formulated in pharmaceutical compositions of polypeptides described herein.
  • formulations of polypeptide constructs described herein are prepared for storage by mixing a polypeptide construct described herein having the desired degree of purity with optional, pharmaceutically acceptable carriers, excipients or stabilizers in the form of lyophilized formulations or aqueous solutions.
  • a pharmaceutical composition of the disclosure includes a nucleic acid molecule (DNA or RNA, e.g., mRNA) encoding a polypeptide of the disclosure, or a vector containing such a nucleic acid molecule.
  • a nucleic acid molecule DNA or RNA, e.g., mRNA
  • acceptable carriers, excipients, or stabilizers in a pharmaceutical composition are preferably nontoxic to recipients at the dosages and concentrations administered.
  • acceptable carriers, excipients, and stabilizers include buffers such as phosphate, citrate, HEPES, TAE, and other organic acids; antioxidants such as ascorbic acid and methionine; preservatives (e.g., hexamethonium chloride; octadecyldimethylbenzyl ammonium chloride; benzalkonium chloride, benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (e.g., less than about 10 residues) polypeptides; proteins such as human serum albumin, gelatin, dextran, and immunoglobul
  • compositions that comprise polypeptides described herein are in a water-soluble form, such as being present as pharmaceutically acceptable salts, which is meant to include both acid and base addition salts.
  • pharmaceutically acceptable acid addition salt refers to those salts that retain the biological effectiveness of the free bases and that are not otherwise undesirable, formed with inorganic acids such as hydrochloric acid, hydrobromic acid, sulfuric acid, nitric acid, phosphoric acid and the like, and organic acids such as acetic acid, propionic acid, glycolic acid, pyruvic acid, oxalic acid, maleic acid, malonic acid, succinic acid, fumaric acid, tartaric acid, citric acid, benzoic acid, cinnamic acid, mandelic acid, methanesulfonic acid, ethanesulfonic acid, p-toluenesulfonic acid, salicylic acid and the like.
  • salts derived from pharmaceutically acceptable organic non-toxic bases include salts of primary, secondary, and tertiary amines, substituted amines including naturally occurring substituted amines, cyclic amines and basic ion exchange resins, such as isopropylamine, trimethylamine, diethylamine, triethylamine, tripropylamine, and ethanolamine.
  • the formulations to be used for in vivo administration are preferably sterile. This can be accomplished by filtration through sterile filtration membranes or other methods.
  • compositions of the disclosure are administered parenterally in the form of an injectable formulation.
  • pharmaceutical compositions for injection are formulated using a sterile solution or any pharmaceutically acceptable liquid as a vehicle.
  • Pharmaceutically acceptable vehicles include, but are not limited to, sterile water, physiological saline, and cell culture media (e.g., Dulbecco's Modified Eagle Medium (DMEM), ⁇ -Modified Eagles Medium ( ⁇ -MEM), and F-12 medium).
  • DMEM Dulbecco's Modified Eagle Medium
  • ⁇ -MEM ⁇ -Modified Eagles Medium
  • F-12 medium e.g., F-12 medium.
  • the polypeptides described herein are formulated as immunoliposomes.
  • a liposome is a small vesicle comprising various types of lipids, phospholipids or surfactants that is useful for delivery of a therapeutic agent to a mammal.
  • Liposomes containing the antibody or Fc fusion can be prepared by various methods known in the art.
  • the components of the liposome are arranged in a bilayer formation, similar to the lipid arrangement of biological membranes.
  • liposomes are generated by the reverse phase evaporation method with a lipid composition comprising phosphatidylcholine, cholesterol and PEG-derivatized phosphatidylethanolamine (PEG-PE).
  • PEG-PE PEG-derivatized phosphatidylethanolamine
  • liposomes are extruded through filters of defined pore size to yield liposomes with the desired diameter.
  • a chemotherapeutic agent or other therapeutically active agent is optionally contained within the lipo
  • polypeptide constructs described herein and other therapeutically active agents are entrapped in microcapsules prepared by methods including, but not limited to, coacervation techniques, interfacial polymerization (for example using hydroxymethylcellulose or gelatin-microcapsules, or poly-(methylmethacylate) microcapsules), colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules), and macroemulsions.
  • sustained-release preparations are prepared.
  • suitable examples of sustained-release preparations include semipermeable matrices of solid hydrophobic polymer, which matrices are in the form of shaped articles, e.g., films, or microcapsules.
  • sustained-release matrices include polyesters, hydrogels (for example poly(2-hydroxyethyl-methacrylate), or poly(vinylalcohol)), polylactides, copolymers of L-glutamic acid and gamma ethyl-L-glutamate, non-degradable ethylene-vinyl acetate, degradable lactic acid-glycolic acid copolymers such as the LUPRON DEPOTTM (which are injectable microspheres composed of lactic acid-glycolic acid copolymer and leuprolide acetate), poly-D-( ⁇ )-3-hydroxybutyric acid, and ProLease® (commercially available from Alkermes), which is a microsphere-based delivery system composed of the desired bioactive molecule incorporated into a matrix of poly-DL-lactide-co-glycolide (PLG).
  • Some sustained-release formulations enable release of molecules over a few months, e.g., one to six months, while other formulations release
  • the concentration of the polypeptide described herein in a pharmaceutical formulation varies from about 0.1 to 100 weight %. In some cases, the concentration of the polypeptide described herein is in the range of 0.003 to 1.0 molar. In some cases, the concentration of the polypeptide in a pharmaceutical formulation varies from about 5 mg/mL to about 50 mg/mL (e.g., from about 10 mg/mL to about 40 mg/mL or from about 20 mg/mL to about 30 mg/mL). In some embodiments, in order to treat a patient, a therapeutically effective dose of a polypeptide described herein is administered.
  • the term “therapeutically effective dose” refers to a dose that produces the effects for which it is administered.
  • dosages range from 0.01 to 100 mg/kg of body weight or greater, for example 0.1, 1, 5, 10, 15, 20, 25, 30, 35, 40, 45 or 50 mg/kg of body weight.
  • adjustments for polypeptide construct degradation, systemic versus localized delivery, and rate of new protease synthesis, as well as the age, body weight, general health, sex, diet, time of administration, drug interaction and the severity of the condition is necessary.
  • compositions and formulations described herein are administered to a subject in need thereof. In some embodiments, such administration is carried out in vivo. In some embodiments, such administration is carried out ex vivo. In some embodiments, administration of the pharmaceutical composition comprising a polypeptide described herein, is done in a variety of ways, including, but not limited to orally, subcutaneously, intravenously, intranasally, intraotically, transdermally, topically (e.g., gels, salves, lotions, creams, etc.), intraperitoneally, intramuscularly, intrapulmonary (e.g., AERx® inhalable technology commercially available from Aradigm, or InhanceTM pulmonary delivery system commercially available from Inhale Therapeutics), vaginally, parenterally, rectally, or intraocularly. In some embodiments, the pharmaceutical composition is formulated accordingly depending upon the manner of introduction.
  • the pharmaceutical composition for gene therapy is in an acceptable diluent, or includes a slow release matrix in which the gene delivery vehicle is imbedded.
  • vectors used as in vivo gene delivery vehicles include, but are not limited to, retroviral vectors, adenoviral vectors, poxviral vectors (e.g., vaccinia viral vectors, such as Modified Vaccinia Ankara), adeno-associated viral vectors, and alphaviral vectors.
  • polypeptides comprising a signal-regulatory protein ⁇ (SIRP- ⁇ ) D1 variant comprising a SIRP- ⁇ D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP- ⁇ D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP- ⁇ D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92.
  • SIRP- ⁇ signal-regulatory protein ⁇
  • polypeptides comprising an Fc variant, wherein the Fc variant comprises an Fc domain dimer having two Fc domain monomers, wherein each Fc domain monomer independently is selected from (i) a human IgG1 Fc region consisting of mutations L234A, L235A, G237A, and N297A; (ii) a human IgG2 Fc region consisting of mutations A330S, P331S and N297A; or (iii) a human IgG4 Fc region comprising mutations S228P, E233P, F234V, L235A, delG236, and N297A.
  • compositions that include polypeptides of the disclosure as the therapeutic proteins are formulated for, e.g., intravenous administration, parenteral administration, subcutaneous administration, intramuscular administration, intra-arterial administration, intrathecal administration, or intraperitoneal administration.
  • the pharmaceutical composition is formulated for, or administered via, oral, nasal, spray, aerosol, rectal, or vaginal administration.
  • various effective pharmaceutical carriers are available for injectable formulations.
  • a pharmaceutical composition that includes a nucleic acid molecule encoding a polypeptide of the disclosure or a vector containing such nucleic acid molecule is administered by way of gene delivery.
  • vectors used for in vivo gene delivery and expression include, but are not limited to, retroviral vectors, adenoviral vectors, poxviral vectors (e.g., vaccinia viral vectors, such as Modified Vaccinia Ankara (MVA)), adeno-associated viral vectors, and alphaviral vectors.
  • mRNA molecules encoding polypeptides of the disclosure are administered directly to a subject.
  • the dosage of the pharmaceutical compositions of the disclosure depends on factors including the route of administration, the disease to be treated, and physical characteristics, e.g., age, weight, general health, of the subject.
  • the amount of a polypeptide of the disclosure contained within a single dose is an amount that effectively prevents, delays, or treats the disease without inducing significant toxicity.
  • a pharmaceutical composition of the disclosure includes a dosage of a polypeptide of the disclosure ranging from 0.01 to 500 mg/kg (e.g., 0.01, 0.1, 0.2, 0.3, 0.4, 0.5, 1, 2, 3, 4, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 100, 150, 200, 250, 300, 350, 400, 450, or 500 mg/kg) and, in a more specific embodiment, about 0.1 to about 50 mg/kg and, in a more specific embodiment, about 1 to about 30 mg/kg.
  • the dosage is adapted by a physician in accordance with the extent of the disease and different parameters of the subject.
  • toxicity of therapeutic agents and polypeptides described herein is determined by standard pharmaceutical procedures in cell cultures or experimental animals, e.g., by determining the LD 50 (the dose lethal to 50% of the population) or the LD 100 (the dose lethal to 100% of the population).
  • the data obtained from these cell culture assays and animal studies is used in formulating a dosage range that is not toxic for use in human.
  • the dosage of the proteins described herein lies preferably within a range of circulating concentrations that include the effective dose with little or no toxicity.
  • the dosage is varied within this range depending upon the dosage form employed and the route of administration utilized.
  • the exact formulation, route of administration and dosage is chosen by an individual physician in view of the patient's condition.
  • the pharmaceutical compositions are administered in a manner compatible with the dosage formulation and in such amount as is therapeutically effective to result in an improvement or remediation of symptoms of a disease or disorder.
  • the pharmaceutical compositions are administered in a variety of dosage forms, e.g., intravenous dosage forms, subcutaneous dosage forms, and oral dosage forms (e.g., ingestible solutions, drug release capsules).
  • dosage forms e.g., intravenous dosage forms, subcutaneous dosage forms, and oral dosage forms (e.g., ingestible solutions, drug release capsules).
  • therapeutic proteins are dosed at 0.1-100 mg/kg, e.g., 1-50 mg/kg.
  • compositions that include a polypeptide of the disclosure are administered to a subject in need thereof, for example, one or more times (e.g., 1-10 times or more) daily, weekly, monthly, biannually, annually, or as medically necessary. Dosages can be provided in either a single or multiple dosage regimens. In some embodiments, the timing between administrations is decreased as the medical condition improves or increased as the health of the patient declines.
  • polypeptides comprising a signal-regulatory protein ⁇ (SIRP- ⁇ ) D1 variant comprising a SIRP- ⁇ D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP- ⁇ D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP- ⁇ D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92.
  • SIRP- ⁇ signal-regulatory protein ⁇
  • polypeptides comprising an Fc variant, wherein the Fc variant comprises an Fc domain dimer having two Fc domain monomers, wherein each Fc domain monomer independently is selected from (i) a human IgG1 Fc region consisting of mutations L234A, L235A, G237A, and N297A; (ii) a human IgG2 Fc region consisting of mutations A330S, P331S and N297A; or (iii) a human IgG4 Fc region comprising mutations S228P, E233P, F234V, L235A, delG236, and N297A.
  • methods of treatment comprising administering polypeptides comprising a signal-regulatory protein ⁇ (SIRP- ⁇ ) D1 variant comprising a SIRP- ⁇ D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP- ⁇ D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP- ⁇ D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92.
  • SIRP- ⁇ signal-regulatory protein ⁇
  • the disclosure provides pharmaceutical compositions and methods of treatment that are used to treat patients who are suffering from diseases and disorders associated with SIRP- ⁇ or CD47 activity, such as cancers and immunological diseases (e.g., autoimmune diseases and inflammatory diseases).
  • diseases and disorders associated with SIRP- ⁇ or CD47 activity such as cancers and immunological diseases (e.g., autoimmune diseases and inflammatory diseases).
  • the polypeptides described herein are administered to a subject in a method of increasing phagocytosis of a target cell (e.g., a cancer cell) in the subject.
  • the polypeptides are administered to a subject in a method to kill cancer cells in the subject.
  • the polypeptides are administered to a subject in a method of eliminating regulatory T-cells in the subject.
  • the polypeptides described herein are administered to a subject in a method of increasing hematopoietic stem cell engraftment in the subject, wherein the method includes modulating the interaction between SIRP- ⁇ and CD47 in the subject.
  • the polypeptides described herein are administered to a subject in a method of altering an immune response (e.g., suppressing the immune response) in the subject.
  • the foregoing methods are coupled with other methods for treating a disease.
  • disclosed herein are a combination of a polypeptide (e.g., a SIRP- ⁇ D1 variant) and a second therapeutic agent.
  • the combination comprises a polypeptide (e.g., a SIRP- ⁇ D1 variant) and a second therapeutic agent, wherein the second therapeutic agent is an antibody.
  • the combination comprises a SIRP- ⁇ D1 variant comprising a SIRP- ⁇ D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP- ⁇ D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP- ⁇ D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92; and an antibody.
  • the combination comprises a polypeptide having a sequence according to any one of SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159; and an antibody.
  • the foregoing methods are employed with strategies for treating a disease wherein administration of a polypeptide is a therapeutic option.
  • Non-limiting examples of the foregoing include use of an antibody or a protein fragment.
  • an antibody or protein fragment is administered in combination with the Fc variant polypeptides disclosed herein.
  • the polypeptide constructs disclosed herein are used to improve the phagocytosis of other agents.
  • Methods of treatment include administering to a subject having a disease (e.g., cancer) (i) a polypeptide including a SIRP- ⁇ D1 variant and optionally (ii) an antibody.
  • a disease e.g., cancer
  • the amino acid sequence(s) of SIRP- ⁇ in the subject are determined, for example, from each of the two alleles encoding the SIRP- ⁇ gene.
  • the amino acid sequence(s) of SIRP- ⁇ polypeptides in a biological sample from the subject are first determined. The subject is then administered a therapeutically effective amount of a polypeptide of the disclosure.
  • the high affinity SIRP- ⁇ D1 variant administered has the same amino acid sequence as that of SIRP- ⁇ polypeptides in the biological sample of the subject, except for the introduction of amino acids changes which increase the affinity of the SIRP- ⁇ polypeptide to CD47.
  • the high affinity SIRP- ⁇ D1 variant in the polypeptide preferably has minimal immunogenicity in the subject after the polypeptide is administered.
  • an antibody is administered in addition to the polypeptides disclosed herein.
  • the antibody is co-administered with the polypeptide.
  • the antibody is administered simultaneously, for example in a pharmaceutical composition having both the polypeptide and the antibody.
  • the antibody is administered either before or after the administration of the polypeptide.
  • the polypeptide and the antibody are administered substantially simultaneously (e.g., within one week, 6, 5, 4, 3, 2, 1 days, 12, 6, 3, 2, 1 hours of each other, or substantially simultaneously), followed by administering the antibody alone.
  • the antibody is administered first, followed by administering of the polypeptide and the antibody substantially simultaneously (i.e., within one week, 6, 5, 4, 3, 2, 1 days, 12, 6, 3, 2, 1 hours of each other, or substantially simultaneously).
  • An antibody co-administered or provided in a composition or method disclosed herein refers to an antibody that targets a cell, such as a cancer cell or a cell of the immune system, such as a T-cell (e.g., a regulatory T-cell).
  • An antibody can be of any immunoglobulin antibody isotypes, e.g., IgG, IgE, IgM, IgA, or IgD.
  • the antibody is a human IgG1 isotype antibody.
  • the antibody is a human IgG2 isotype antibody.
  • the antibody is a human IgG4 isotype antibody.
  • antibody herein is used in the broadest sense and encompasses various antibody structures, including but not limited to monoclonal antibodies, polyclonal antibodies, multi-specific antibodies (e.g., bispecific antibodies), antibody fragments, and antibody-like proteins so long as they exhibit the desired activity.
  • Antibody fragments include a portion of an intact antibody, preferably the antigen binding or variable region of the intact antibody. Examples of antibody fragments include Fab, Fab′, F(ab′)2, and Fv fragments, diabodies, linear antibodies, single-chain antibody molecules, and multi-specific antibodies.
  • Monoclonal antibody refers to an antibody obtained from a population of substantially homogeneous antibodies, e.g., individual antibodies in the population have the same primary sequence except for possible naturally occurring mutations that can be present in minor amounts.
  • Monoclonal antibodies can be highly specific and directed against a single antigenic site (e.g., an epitope on a cancer antigen).
  • each monoclonal antibody is generally directed against a single epitope on the antigen.
  • the modifier “monoclonal” indicates the character of the antibody as being obtained from a substantially homogenous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method.
  • an antibody in a composition of the present disclosure causes antibody-dependent cellular phagocytosis (ADCP) or antibody-dependent cellular cytotoxicity (ADCC).
  • ADCP antibody-dependent cellular phagocytosis
  • ADCC antibody-dependent cellular cytotoxicity
  • diseases that are treated using such strategies include cancers such hematological cancers, for example leukemias (e.g., acute myeloid leukemia); immune disorders (e.g., to enhance a subject's impaired or diminished immune response, or alternately to limit a subject's over-active immune response); and pathogenic infections.
  • the methods disclosed herein comprise administering a polypeptide described herein (e.g., a SIRP- ⁇ D1 variant) and an antibody that targets a cancer antigen.
  • a cancer antigen targeted by an antibody or antibody-like protein are exposed peptides derived from intracellular tumor-associated antigens (TAAs) in complex with human leukocyte antigen (HLA) class I molecules on the surface (also known as MHC/peptide complex).
  • TAAs tumor-associated antigens
  • HLA human leukocyte antigen class I molecules on the surface
  • peptides in complex with HLA molecules exposed on the surface of cancer cells that are targeted by an antibody or anti-body-like proteins in a composition of the disclosure include: NY-ESO-1/LAGE1, SSX-2, MAGE family (MAGE-A3), gp100/pmel17, Melan-A/MART-1, gp75/TRP1, tyrosinase, TRP2, CEA, PSA, TAG-72, Immature laminin receptor, MOK/RAGE-1, WT-1, Her2/neu, EphA3, SAP-1, BING-4, Ep-CAM, MUC1, PRAME, survivin, Mesothelin, BRCA1/2 (mutated), CDK4, CML66, MART-2, p53 (mutated), Ras (mutated), ⁇ -catenin (mutated), TGF- ⁇ RII (mutated), HPV E6, E7.
  • examples of such antibodies include ESK1 (WT-1), RL1B (Her2-E75), Pr20 (PRAME
  • the methods disclosed herein comprise administering a polypeptide comprising a SIRP- ⁇ D1 variant comprising a SIRP- ⁇ D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP- ⁇ D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP- ⁇ D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92; and an antibody that targets a cancer antigen.
  • the methods disclosed herein comprise administering a polypeptide comprising a SIRP- ⁇ D1 variant comprising a SIRP- ⁇ D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP- ⁇ D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP- ⁇ D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92; and an antibody that targets NY-ESO-1/LAGE1, SSX-2, MAGE family (MAGE-A3), gp100/pmel17, Melan-A/MART-1, gp75/TRP1, tyrosinase, TRP2, CEA, PSA, TAG-72, Immature laminin receptor, MOK/RAGE-1, WT-1, Her2/neu, EphA3, SAP-1, BING-4, Ep-CAM, MUC1, PRAME, sur
  • the methods disclosed herein comprise administering a polypeptide comprising a SIRP- ⁇ D1 variant comprising a SIRP- ⁇ D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP- ⁇ D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP- ⁇ D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92; and an antibody, wherein the antibody is ESK1 (WT-1), RL1B (Her2-E75), Pr20 (PRAME), and 3.2G1 (hCG ⁇ ).
  • the methods disclosed herein comprise administering a polypeptide having a sequence according to SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159. and an antibody that targets a cancer antigen.
  • the methods disclosed herein comprise administering a polypeptide having a sequence according to any one of SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159; and an antibody that targets NY-ESO-1/LAGE1, SSX-2, MAGE family (MAGE-A3), gp100/pmel17, Melan-A/MART-1, gp75/TRP1, tyrosinase, TRP2, CEA, PSA, TAG-72, Immature laminin receptor, MOK/RAGE-1, WT-1, Her2/neu, EphA3, SAP-1, BING-4, Ep-CAM, MUC1, PRAME, survivin, Mesothelin, BRCA1/2 (mutated), CDK4, CML66, MART-2, p53 (mutated), Ras (mutated), ⁇ -catenin (mutated), TGF- ⁇ RII (mutated), HPV E6, E7.
  • the methods disclosed herein comprise administering a polypeptide having a sequence according to any one of SEQ ID NOs: SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159; and an antibody, wherein the antibody is ESK1 (WT-1), RL1B (Her2-E75), Pr20 (PRAME), and 3.2G1 (hCG ⁇ ).
  • an antibody targets cancer cells, for example, by binding to proteins expressed by cancer cells.
  • Some proteins are expressed at higher levels in cancer cells than in non-cancer cells.
  • a cancer antigen is a protein that is expressed preferentially by cancer cells (e.g., it is expressed at higher levels in cancer cells than on non-cancer cells) and in some instances it is expressed solely by cancer cells.
  • Non-limiting examples of proteins e.g., proteins expressed by cancer cells, that are be targeted by an antibody in a composition of the disclosure include: 4-1BB, 5T4, AGS-16, ALK1, ANG-2, B7-H3, B7-H4, c-fms, c-Met, CA6, CCR4, CD123, CD19, CD20, CD22, CD27, EpCAM, CD30, CD32b, CD33, CD37, CD38, CD40, CD52, CD70, CD74, CD79b, CD98, CEA, CEACAM5, CLDN18.2, CLDN6, CS1, CTLA-4, CXCR4, DLL-4, EGFR, EGP-1, ENPP3, EphA3, ETBR, FGFR2, fibronectin, FR-alpha, Frizzled receptor, GCC, GD2, glypican-3, GPNMB, HER-2, HER3, HLA-DR, ICAM-1, IGF-1R, IL-3R, LAG-3, LIV-1, meso
  • the polypeptides described herein are administered in combination with a checkpoint inhibitor, such as an antibody inhibitor of CTLA-4 (e.g., ipilimumab, tremelimumab), PD-1 (e.g., nivolumab, Pidilizumab, MK3475 also known as pembrolizumab, BMS936559, and MPDL3280A), and LAG-3 (e.g., BMS986016).
  • a checkpoint inhibitor such as an antibody inhibitor of CTLA-4 (e.g., ipilimumab, tremelimumab), PD-1 (e.g., nivolumab, Pidilizumab, MK3475 also known as pembrolizumab, BMS936559, and MPDL3280A), and LAG-3 (e.g., BMS986016).
  • CTLA-4 e.g., ipilimumab, tremelimumab
  • the methods disclosed herein comprise administering a polypeptide comprising a SIRP- ⁇ D1 variant comprising a SIRP- ⁇ D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP- ⁇ D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP- ⁇ D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92; and an antibody that targets a protein expressed a by a cancer cell.
  • the methods disclosed herein comprise administering a polypeptide comprising a SIRP- ⁇ D1 variant comprising a SIRP- ⁇ D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP- ⁇ D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP- ⁇ D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92; and an antibody that targets 4-1BB, 5T4, AGS-16, ALK1, ANG-2, B7-H3, B7-H4, c-fms, c-Met, CA6, CCR4, CD123, CD19, CD20, CD22, CD27, EpCAM, CD30, CD32b, CD33, CD37, CD38, CD40, CD52, CD70, CD74, CD79b, CD98, CEA, CEACAM5, CLDN18.2, CLDN6, CS1, CTLA-4
  • the methods disclosed herein comprise administering a polypeptide comprising a SIRP- ⁇ D1 variant comprising a SIRP- ⁇ D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP- ⁇ D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP- ⁇ D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92; and an antibody, wherein the antibody is an antibody inhibitor of CTLA-4 (e.g., ipilimumab, tremelimumab), PD-1 (e.g., nivolumab, Pidilizumab, MK3475 also known as pembrolizumab, BMS936559, and MPDL3280A), or LAG-3 (e.g., BMS986016).
  • CTLA-4 e.g., ipilimumab,
  • the methods disclosed herein comprise administering a polypeptide having a sequence according to any one of SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159; and an antibody that targets a protein expressed a by a cancer cell.
  • the methods disclosed herein comprise administering a polypeptide having a sequence according to any one of SEQ ID NOs: SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159; and an antibody that targets 4-1BB, 5T4, AGS-16, ALK1, ANG-2, B7-H3, B7-H4, c-fms, c-Met, CA6, CCR4, CD123, CD19, CD20, CD22, CD27, EpCAM, CD30, CD32b, CD33, CD37, CD38, CD40, CD52, CD70, CD74, CD79b, CD98, CEA, CEACAM5, CLDN18.2, CLDN6, CS1, CTLA-4, CXCR4, DLL-4, EGFR, EGP-1, ENPP3, EphA3, ETBR, FGFR2, fibronectin, FR-alpha, Frizzled receptor, GCC, GD2, glypican-3, GPN
  • the methods disclosed herein comprise administering a polypeptide having a sequence according to any one of SEQ ID NOs: SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159; and an antibody, wherein the antibody is an antibody inhibitor of CTLA-4 (e.g., ipilimumab, tremelimumab), PD-1 (e.g., nivolumab, pidilizumab, MK3475 also known as pembrolizumab, BMS936559, and MPDL3280A), or LAG-3 (e.g., BMS986016).
  • CTLA-4 e.g., ipilimumab, tremelimumab
  • PD-1 e.g., nivolumab, pidilizumab, MK3475 also known as pembrolizumab, BMS936559, and MPDL3280A
  • the methods disclosed herein comprise administering a polypeptide described herein (e.g., a SIRP- ⁇ D1 variant) and an immuno-oncology antibody.
  • antibodies that are used in compositions of the disclosure include, but are not limited to: cetuximab, necitumumab, pembrolizumab, nivolumab, pidilizumab, MEDI0680, MED16469, atezolizumab, avelumab, durvalumab, MEDI6383, RG7888, ipilimumab, tremelimumab, urelumab, PF-05082566, enoblituzumab, vantictumab, varlilumab, mogamalizumab, SAR650984, daratumumab, trastuzumab, trastuzumab emtansine, pertuzumab, elotuzumab
  • the methods disclosed herein comprise administering a polypeptide comprising a SIRP- ⁇ D1 variant comprising a SIRP- ⁇ D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP- ⁇ D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP- ⁇ D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92; and an antibody, wherein the antibody is, an anti-HER2 antibody, anti-CD20 antibody, anti-CD19 antibody, anti-CS1 antibody, anti-CD38 antibody, anti-EGFR antibody, anti-PD1 antibody, anti-RANKL antibody, anti-OX40 antibody, anti-PD-1 antibody, anti-PD-L1 antibody, anti-CD274 antibody, anti-CTLA-4 antibody, anti-CD137 antibody, anti-4-1BB antibody, anti-B7-H3 antibody, anti-FZD7 antibody,
  • the methods disclosed herein comprise administering a polypeptide comprising a SIRP- ⁇ D1 variant comprising a SIRP- ⁇ D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP- ⁇ D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP- ⁇ D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92; and an antibody, wherein the antibody is cetuximab, necitumumab, pembrolizumab, nivolumab, pidilizumab, MEDI0680, MED16469, atezolizumab, avelumab, durvalumab, MEDI6383, RG7888, ipilimumab, tremelimumab, urelumab, PF-05082566, enoblituzum
  • the methods disclosed herein comprise administering a polypeptide comprising a SIRP- ⁇ D1 variant comprising a SIRP- ⁇ D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP- ⁇ D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP- ⁇ D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92; and an antibody, wherein the antibody is trastuzumab.
  • the methods disclosed herein comprise administering a polypeptide comprising a SIRP- ⁇ D1 variant comprising a SIRP- ⁇ D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP- ⁇ D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP- ⁇ D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92; and an antibody, wherein the antibody is rituximab.
  • the methods disclosed herein comprise administering a polypeptide comprising a SIRP- ⁇ D1 variant comprising a SIRP- ⁇ D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP- ⁇ D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP- ⁇ D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92; and an antibody, wherein the antibody is cetuximab.
  • the methods disclosed herein comprise administering a polypeptide comprising a SIRP- ⁇ D1 variant comprising a SIRP- ⁇ D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP- ⁇ D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP- ⁇ D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92; and an antibody, wherein the antibody is daratumumab.
  • the methods disclosed herein comprise administering a polypeptide comprising a SIRP- ⁇ D1 variant comprising a SIRP- ⁇ D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP- ⁇ D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP- ⁇ D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92; and an antibody, wherein the antibody is belimumab.
  • the methods disclosed herein comprise administering a polypeptide comprising a SIRP- ⁇ D1 variant comprising a SIRP- ⁇ D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP- ⁇ D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP- ⁇ D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92; and an antibody, wherein the antibody is bevacizumab.
  • the methods disclosed herein comprise administering a polypeptide comprising a SIRP- ⁇ D1 variant comprising a SIRP- ⁇ D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP- ⁇ D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP- ⁇ D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92; and an antibody, wherein the antibody is denosumab.
  • the methods disclosed herein comprise administering a polypeptide comprising a SIRP- ⁇ D1 variant comprising a SIRP- ⁇ D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP- ⁇ D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP- ⁇ D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92; and an antibody, wherein the antibody is pantimumab.
  • the methods disclosed herein comprise administering a polypeptide comprising a SIRP- ⁇ D1 variant comprising a SIRP- ⁇ D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP- ⁇ D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP- ⁇ D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92; and an antibody, wherein the antibody is ramucirumab.
  • the methods disclosed herein comprise administering a polypeptide comprising a SIRP- ⁇ D1 variant comprising a SIRP- ⁇ D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP- ⁇ D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP- ⁇ D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92; and an antibody, wherein the antibody is necitumumab.
  • the methods disclosed herein comprise administering a polypeptide comprising a SIRP- ⁇ D1 variant comprising a SIRP- ⁇ D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP- ⁇ D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP- ⁇ D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92; and an antibody, wherein the antibody is nivolumab.
  • the methods disclosed herein comprise administering a polypeptide comprising a SIRP- ⁇ D1 variant comprising a SIRP- ⁇ D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP- ⁇ D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP- ⁇ D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92; and an antibody, wherein the antibody is pembrolizumab.
  • the methods disclosed herein comprise administering a polypeptide comprising a SIRP- ⁇ D1 variant comprising a SIRP- ⁇ D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP- ⁇ D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP- ⁇ D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92; and an antibody, wherein the antibody is avelumab.
  • the methods disclosed herein comprise administering a polypeptide comprising a SIRP- ⁇ D1 variant comprising a SIRP- ⁇ D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP- ⁇ D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP- ⁇ D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92; and an antibody, wherein the antibody is atezolizumab.
  • the methods disclosed herein comprise administering a polypeptide comprising a SIRP- ⁇ D1 variant comprising a SIRP- ⁇ D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP- ⁇ D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP- ⁇ D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92; and an antibody, wherein the antibody is durvalumab.
  • the methods disclosed herein comprise administering a polypeptide comprising a SIRP- ⁇ D1 variant comprising a SIRP- ⁇ D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP- ⁇ D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP- ⁇ D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92; and an antibody, wherein the antibody is MEDI0680.
  • the methods disclosed herein comprise administering a polypeptide comprising a SIRP- ⁇ D1 variant comprising a SIRP- ⁇ D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP- ⁇ D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP- ⁇ D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92; and an antibody, wherein the antibody is pidilizumab.
  • the methods disclosed herein comprise administering a polypeptide comprising a SIRP- ⁇ D1 variant comprising a SIRP- ⁇ D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP- ⁇ D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP- ⁇ D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92; and an antibody, wherein the antibody is BMS-93659.
  • the methods disclosed herein comprise administering a polypeptide having a sequence according to any one of SEQ ID NOs: SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159; and an antibody, wherein the antibody is, an anti-HER2 antibody, anti-CD20 antibody, anti-CD19 antibody, anti-CS1 antibody, anti-CD38 antibody, anti-EGFR antibody, anti-PD1 antibody, anti-RANKL antibody, anti-OX40 antibody, anti-PD-1 antibody, anti-PD-L1 antibody, anti-CD274 antibody, anti-CTLA-4 antibody, anti-CD137 antibody, anti-4-1BB antibody, anti-B7-H3 antibody, anti-FZD7 antibody, anti-CD27 antibody, anti-CCR4 antibody, anti-CD38 antibody, anti-CSF1R antibody, anti-CSF antibody, anti-CD30 antibody, anti-BAFF antibody, anti-VEGF antibody, or anti-VEGFR2 antibody.
  • the antibody is,
  • the methods disclosed herein comprise administering a polypeptide having a sequence according to SEQ ID NOs: SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159; and an antibody, wherein the antibody is cetuximab, necitumumab, pembrolizumab, nivolumab, pidilizumab, MEDI0680, MED16469, atezolizumab, avelumab, durvalumab, MEDI6383, RG7888, ipilimumab, tremelimumab, urelumab, PF-05082566, enoblituzumab, vantictumab, varlilumab, mogamalizumab, SAR650984, daratumumab, trastuzumab, trastuzumab emtansine, pertuzumab,
  • the methods disclosed herein comprise administering a polypeptide having a sequence according to any one of SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159; and an antibody, wherein the antibody is trastuzumab.
  • the methods disclosed herein comprise administering a polypeptide having a sequence according to any one of SEQ ID NOs: 7 SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159; and an antibody, wherein the antibody is rituximab.
  • the methods disclosed herein comprise administering a polypeptide having a sequence according to any one of SEQ ID NOs: SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159; and an antibody, wherein the antibody is cetuximab.
  • the methods disclosed herein comprise administering a polypeptide having a sequence according to any one of SEQ ID NOs: SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159; and an antibody, wherein the antibody is daratumumab.
  • the methods disclosed herein comprise administering a polypeptide having a sequence according to any one of SEQ ID NOs: SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159; and an antibody, wherein the antibody is belimumab.
  • the methods disclosed herein comprise administering a polypeptide having a sequence according to any one of SEQ ID NOs: SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159; and an antibody, wherein the antibody is bevacizumab.
  • the methods disclosed herein comprise administering a polypeptide having a sequence according to any one of SEQ ID NOs: SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159; and an antibody, wherein the antibody is denosumab.
  • the methods disclosed herein comprise administering a polypeptide having a sequence according to any one of SEQ ID NOs: SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159; and an antibody, wherein the antibody is pantimumab.
  • the methods disclosed herein comprise administering a polypeptide having a sequence according to any one of SEQ ID NOs: SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159; and an antibody, wherein the antibody is ramucirumab.
  • the methods disclosed herein comprise administering a polypeptide having a sequence according to any one of SEQ ID NOs: SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159; and an antibody, wherein the antibody is necitumumab.
  • the methods disclosed herein comprise a polypeptide having a sequence according to any one of SEQ ID NOs: SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159; and an antibody, wherein the antibody is nivolumab.
  • the methods disclosed herein comprise administering a polypeptide having a sequence according to any one of SEQ ID NOs: SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159; and an antibody, wherein the antibody is pembrolizumab.
  • the methods disclosed herein comprise administering a polypeptide having a sequence according to any one of SEQ ID NOs: SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159; and an antibody, wherein the antibody is avelumab.
  • the methods disclosed herein comprise administering a polypeptide having a sequence according to any one of SEQ ID NOs: SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159; and an antibody, wherein the antibody is atezolizumab.
  • the methods disclosed herein comprise administering a polypeptide having a sequence according to any one of SEQ ID NOs: SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159; and an antibody, wherein the antibody is durvalumab.
  • the methods disclosed herein comprise administering a polypeptide having a sequence according to any one of SEQ ID NOs: SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159; and an antibody, wherein the antibody is MEDI0680.
  • the methods disclosed herein comprise a polypeptide having a sequence according to any one of SEQ ID NOs: SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159; and an antibody, wherein the antibody is pidilizumab.
  • the methods disclosed herein comprise administering a polypeptide having a sequence according to any one of SEQ ID NOs: SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159; and an antibody, wherein the antibody is BMS-93659.
  • the polypeptides disclosed herein enhance the anti-tumor activity of rituximab. In some embodiments, the polypeptides disclosed herein enhance the anti-tumor activity of rituximab in the Raji-NSG xenograft model. In some embodiments, the polypeptides disclosed herein enhance rituximab-mediated B-cell depletion in non-human primates (NHP).
  • NEP non-human primates
  • the polypeptides and pharmaceutical compositions of the disclosure are used in various cancer therapies.
  • the cancers amenable to treatment according to the disclosure include, but are not limited to, solid tumor cancer, hematological cancer, acute myeloid leukemia, chronic lymphocytic leukemia, chronic myeloid leukemia, acute lymphoblastic leukemia, non-Hodgkin lymphoma, Hodgkin lymphoma, multiple myeloma, bladder cancer, pancreatic cancer, cervical cancer, endometrial cancer, lung cancer, bronchus cancer, liver cancer, ovarian cancer, colon and rectal cancer, stomach cancer, gastric cancer, gallbladder cancer, gastrointestinal stromal tumor cancer, thyroid cancer, head and neck cancer, oropharyngeal cancer, esophageal cancer, melanoma, non-melanoma skin cancer, Merkel cell carcinoma, virally induced cancer, neuroblastoma, breast cancer, prostate cancer, renal cancer, renal cell cancer, renal pelvis cancer, leukemia,
  • an antibody targets cells of the immune system, such as T-cells, e.g., regulatory T-cells, by binding to proteins expressed by cells of the immune system.
  • the methods disclosed herein comprise administering a polypeptide described herein (e.g., a SIRP- ⁇ D1 variant) and an antibody that targets cells of the immune system.
  • proteins expressed by cells of the immune system include, but are not limited to, 41BB, CD40, CD40L, CD163, CD206, CTLA4, PD1, TIM-3, BTLA, VISTA, LAG-3, CD28, OX40, GITR, CD137, CD27, HVEM, CCR4, CD25, CD103, KIrg1, Nrp1, CD278, Gpr83, TIGIT, CD154, CD160, and PD1H.
  • an antibody is designed such that it has preferential binding to proteins (e.g., receptors) expressed by T-cells (e.g., regulatory T-cells) as compared to other cells of the immune system.
  • an antibody in a composition of the disclosure includes an Fc domain of the IgG1, IgG2 or IgG4 subclass.
  • the methods of the disclosure include altering an immune response in a subject.
  • the methods include administering the subject a polypeptide including a high affinity SIRP- ⁇ D1 variant and an antibody, thereby altering the immune response in the subject.
  • altering the immune response includes suppressing the immune response.
  • the polypeptides and pharmaceutical compositions of the disclosure are used in various therapies to treat immunological diseases.
  • Autoimmune diseases and inflammatory diseases amenable to treatment according to the disclosure include, but are not limited to, multiple sclerosis, rheumatoid arthritis, a spondyloarthropathy, systemic lupus erythematosus, an antibody-mediated inflammatory or autoimmune disease, graft versus host disease, sepsis, diabetes, psoriasis, atherosclerosis, Sjogren's syndrome, progressive systemic sclerosis, scleroderma, acute coronary syndrome, ischemic reperfusion, Crohn's Disease, endometriosis, glomerulonephritis, myasthenia gravis, idiopathic pulmonary fibrosis, asthma, acute respiratory distress syndrome (ARDS), vasculitis, and inflammatory autoimmune myositis.
  • ARDS acute respiratory distress syndrome
  • delivering a polypeptide to a cell involves contacting the cell with one or more of the compositions described herein.
  • Effective doses for such treatment options vary depending upon many different factors, including means of administration, target site, physiological state of the patient, whether the patient is human or an animal, other medications administered, and whether treatment is prophylactic or therapeutic.
  • the patient is a human, but nonhuman mammals are also be treated, e.g., companion animals such as dogs, cats, horses, etc., laboratory mammals such as rabbits, mice, rats, etc., and the like.
  • treatment dosages are titrated to optimize safety and efficacy.
  • therapeutic dosage range from about 0.0001 to 100 mg/kg, and more usually 0.01 to 30 mg/kg, of the host body weight. In some embodiments, for example, dosages are 1 mg/kg body weight or 30 mg/kg body weight or within the range of 1-30 mg/kg.
  • an exemplary treatment regime entails administration once every week or once every two weeks or once a month or once every 3 to 6 months.
  • therapeutic agents and polypeptide constructs described herein are administered on multiple occasions. In some embodiments, intervals between single dosages are weekly, monthly or yearly. In some embodiments, intervals are also irregular as indicated by measuring blood levels of the therapeutic entity in the patient. Alternatively, the therapeutic agents or polypeptide constructs described herein are administered as a sustained release formulation, in which case less frequent administration is possible. In some embodiments, dosage and frequency varies depending on the half-life of the polypeptide in the patient.
  • a relatively low dosage is administered at relatively infrequent intervals over a long period of time.
  • patients continue to receive treatment for the rest of their lives.
  • a relatively high dosage at relatively short intervals is required until progression of the disease is reduced or terminated, and preferably until the patient shows partial or complete amelioration of symptoms of disease. Thereafter, in some embodiments, the patent is administered a prophylactic regime.
  • the terms “treatment”, “treating”, and the like refer to administering an agent, or carrying out a procedure, for the purposes of obtaining an effect.
  • the effect is prophylactic in terms of completely or partially preventing a disease or symptom thereof.
  • the effect is therapeutic in terms of affecting a partial or complete cure for a disease or symptoms of the disease.
  • polypeptides comprising a signal-regulatory protein ⁇ (SIRP- ⁇ ) D1 variant comprising a SIRP- ⁇ D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP- ⁇ D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP- ⁇ D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92.
  • SIRP- ⁇ signal-regulatory protein ⁇
  • polypeptides comprising an Fc variant, wherein the Fc variant comprises an Fc domain dimer having two Fc domain monomers, wherein each Fc domain monomer independently is selected from (i) a human IgG1 Fc region consisting of mutations L234A, L235A, G237A, and N297A; (ii) a human IgG2 Fc region consisting of mutations A330S, P331S and N297A; or (iii) a human IgG4 Fc region comprising mutations S228P, E233P, F234V, L235A, delG236, and N297A.
  • kits which include polypeptides described herein and instructions for use of the same.
  • the kits can further include at least one additional reagent.
  • a chemotherapeutic agent or anti-tumor antibody could serve as at least one additional agent.
  • kits include a label indicating the intended use of the contents of the kit. The term label includes any writing, or recorded material supplied on or with the kit, or which otherwise accompanies the kit.
  • kits includes (i) a polypeptide including a high affinity SIRP- ⁇ D1 variant; optionally (ii) an antibody; and (iii) instructions for administering (i) and (ii) (if provided) to a subject having a disease.
  • kits include (i) a polypeptide including a high affinity SIRP- ⁇ D1 variant; and (ii) instructions for administering (i) with an antibody, for example, an antibody that is not provided in the kit, to a subject having a disease.
  • kits include (i) an antibody; and (ii) instructions for administering (i) with a polypeptide including a high affinity SIRP- ⁇ D1 variant to a subject having a disease.
  • kits are used to treat a subject having cancer, such as solid tumor cancer, hematological cancer, acute myeloid leukemia, chronic lymphocytic leukemia, chronic myeloid leukemia, acute lymphoblastic leukemia, non-Hodgkin lymphoma, Hodgkin lymphoma, multiple myeloma, bladder cancer, pancreatic cancer, cervical cancer, endometrial cancer, lung cancer, bronchus cancer, liver cancer, ovarian cancer, colon and rectal cancer, stomach cancer, gastric cancer, gallbladder cancer, gastrointestinal stromal tumor cancer, thyroid cancer, head and neck cancer, oropharyngeal cancer, esophageal cancer, melanoma, non-melanoma skin cancer, Merkel cell carcinoma, virally induced cancer, neuroblastoma, breast cancer, prostate cancer, renal cancer, renal cell cancer, renal pelvis cancer, leukemia, lymphoma, sarcoma, glioma, brain tumor, carcinoma, or any combinations
  • cancer such as
  • kits are used to treat a subject having immunological diseases.
  • the immunological disease is an autoimmune disease or an inflammatory disease, such as multiple sclerosis, rheumatoid arthritis, a spondyloarthropathy, systemic lupus erythematosus, an antibody-mediated inflammatory or autoimmune disease, graft versus host disease, sepsis, diabetes, psoriasis, atherosclerosis, Sjogren's syndrome, progressive systemic sclerosis, scleroderma, acute coronary syndrome, ischemic reperfusion, Crohn's Disease, endometriosis, glomerulonephritis, myasthenia gravis, idiopathic pulmonary fibrosis, asthma, acute respiratory distress syndrome (ARDS), vasculitis, inflammatory autoimmune myositis, or any combinations thereof.
  • ARDS acute respiratory distress syndrome
  • a polypeptide of the disclosure including a high affinity SIRP- ⁇ D1 variant is generated using conventional molecular cloning and protein expression techniques. Possible amino acid substitutions in a SIRP- ⁇ D1 variant relative to a wild-type SIRP- ⁇ D1 domain are listed in Tables 2 and 5.
  • a nucleic acid molecule encoding a polypeptide of the disclosure is cloned into a vector optimized for expression in bacterial or mammalian cells using well known molecular biology techniques. After induction of protein expression, cells are collected and the expressed polypeptides are purified from the cell culture supernatant using affinity column chromatography. Purified polypeptides are then analyzed by SDS-PAGE, followed by Coomassie Blue staining to confirm the presence of protein bands of expected size.
  • Purified polypeptides are screened for binding to CD47 using available techniques in the art, such as phage display, yeast display, surface plasmon resonance (SPR), scintillation proximity assays, ELISA, ORIGEN immunoassay (IGEN), fluorescence quenching, fluorescence transfer, or any suitable bioassay.
  • the desired polypeptides bind with higher affinity to CD47, e.g., human CD47, than a wild-type SIRP- ⁇ .
  • polypeptides of wild-type SIRP- ⁇ D1 domains and high affinity SIRP- ⁇ D1 variants were generated using conventional molecular cloning and protein expression techniques. Binding to human CD47 was determined using SPR as follows: briefly, binding of human CD47 (R and D Systems, catalog number 4670-CD or in-house produced as monomeric extracellular domain, ECD) to wild-type SIRP- ⁇ and SIRP- ⁇ D1 variant polypeptides variants was analyzed on a Biacore T100 instrument (GE Healthcare) or Proteon XPR36 (Bio-rad, Hercules, Calif.) using phosphate buffered saline (PBS, pH 7.4) supplemented with 0.01% Tween-20 (PBST) as running buffer.
  • PBS phosphate buffered saline
  • PBST 0.01% Tween-20
  • ligand 200 to 1000 RU of ligand were immobilized in 10 mM sodium acetate buffer (pH 4.5) on a Biacore chip CM4 sensor or Proteon GLC chip by standard amine coupling following manufacturer recommendations.
  • concentrations of analyte e.g., ranging from at least 0.1 ⁇ to 10 ⁇ K D value, were injected for two minutes with a flow rate 100 L/min, followed by ten minutes of dissociation time. After each analyte injection, the surface was regenerated using a 2:1 mixture of Pierce IgG elution buffer (Life Technologies, catalog number 21004) and 4 M NaCl injected for 30 seconds.
  • SIRP- ⁇ D1 variant polypeptides have been determined that having a glutamate or aspartate residue at position 54 improves the binding of SIRP- ⁇ D1 variant polypeptides to mouse CD47.
  • the SIRP- ⁇ D1 variant polypeptides identified in Table 17 below demonstrate high affinity binding to mouse CD47.
  • the binding affinity to human CD47 of several SIRP- ⁇ D1 variant polypeptides was compared to the binding affinity to mouse CD47 using SPR as previously described, with mouse CD47 protein being used in place of human CD47 where appropriate. The results are presented in Table 18.
  • N80A mutation which can minimize or abrogate partial glycosylation present in certain SIRP- ⁇ D1 variant polypeptides, confers a functional benefit of increasing the homogeneity associated with SIRP- ⁇ D1 variant polypeptides containing such mutation.
  • SIRP- ⁇ variant polypeptides When SIRP- ⁇ variant polypeptides are expressed in E. coli , no glycosylation of N80 will occur due to lack of glycosylation system in E. coli compared to a mammalian system.
  • Table 19 shows that effective binding between a SIRP- ⁇ D1 variant polypeptide produced in E. coli and human CD47 can still occur, thus demonstrating that deglycosylation does not affect the binding affinity with which SIRP- ⁇ D1 variants can still bind to CD47.
  • P83 By mutating P83 to valine or other residue which is not P, increased glycosylation at N80 can occur and homogenously glycosylated SIRP- ⁇ D1 variant polypeptides can be generated.
  • the amino acid P83 can also affect the degree of glycosylation. Changing P83 to any amino acid can increase the efficiency of glycosylation at N80.
  • a SIRP- ⁇ D1 variant having a valine (V) at position 83 (SEQ ID NO: 213) was expressed in HEK293FS mammalian cells. The size of the expressed protein was compared to a SIRP- ⁇ D1 variant having the wild-type amino acid residue (e.g., proline, P) at position 83 (SEQ ID NO: 71).
  • Molecular weight analysis of the expressed protein on a protein gel FIG.
  • the variant having a P83V mutation (SEQ ID NO: 213, Lane 2) has a higher molecular weight (e.g., ⁇ 22 kDa) compared to the variant that is unmutated at position 83 (Lane 1).
  • residue 83 is mutated to Val
  • the SIRP- ⁇ variant polypeptide expressed in a mammalian cell host is primarily a molecule at higher molecular weight ( ⁇ 22 kDa), indicating efficiency for glycosylation at N80 can be increased.
  • constructs comprising heterodimers of (i) a SIRP- ⁇ -Fc fusion protein and (ii) Fc domain monomer fused to a polypeptide, such as an antigen binding domain, to bind both CD47 and an antigen, e.g., EGFR, was determined by SPR as previously described in this example.
  • the Fc fusion proteins for forming heterodimers are provided in Table 20.
  • Three monofunctional (e.g., binding one target) SIRP- ⁇ -Fc fusions were tested. These fusion proteins are depicted as A, B, C in FIG. 6 A .
  • a first monofunctional SIRP- ⁇ -Fc fusion (“A”) was a homodimer of SEQ ID NO: 136.
  • Second and third monofunctional SIRP- ⁇ -Fc fusions were heterodimers of (i) a SIRP- ⁇ -Fc fusion and (ii) a Fc domain monomer without an additional polypeptide fused to it. These were generated using the Knob & Hole mutation engineering strategies depicted in FIGS. 4 A and 4 B .
  • One monofunctional SIRP- ⁇ -Fc fusion (“B”) was formed from heterodimerization of SEQ ID NO: 139 (an Fc variant) and SEQ ID NO: 142 (a SIRP- ⁇ -Fc fusion).
  • SIRP- ⁇ -Fc fusion Another monofunctional SIRP- ⁇ -Fc fusion (“C”) was formed from heterodimerization of SEQ ID NO: 139 (an Fc variant) and SEQ ID NO: 138 (a SIRP- ⁇ Fc fusion).
  • SEQ ID NO: 220 represents the light chain of the Erbitux antibody.
  • CD47 was immobilized on a Proteon GLC chip by amine chemistry as described above.
  • analytes e.g., A, B, C, D, and Erbitux
  • PBST Proteon GLC chip
  • analytes e.g., A, B, C, D, and Erbitux
  • EGFR-ECD epidermal growth factor receptor extracellular domain produced in HEK293 cells
  • Erbitux did not bind CD47 on the chip and therefore it was not able to bind EGFR in the second injection as shown by the curve labeled “Erbitux” in FIG. 6 B and illustrated in FIG. 6 A .
  • SIRP- ⁇ -Fc fusions e.g., A, B, and C did bind CD47 but did not bind EGFR in the second injection as shown by the curves labeled “A,” “B,” and “C” shown in FIG. 6 B and illustrated in FIG. 6 A .
  • mice models of various cancers are used to test the binding of polypeptides of the disclosure to CD47.
  • a polypeptide of the disclosure is injected in a mouse, which is dissected at the later time to detect the presence of the complex of the polypeptide and CD47.
  • Antibodies specific to SIRP- ⁇ or CD47 are used in the detection.
  • Polypeptides including a high affinity SIRP- ⁇ D1 variant are tested in immunogenicity assays.
  • the polypeptides are tested both in silico and in vitro in T-cell proliferation assays, some of which are commercially available.
  • Polypeptides which provoke a minimal immunogenicity reaction in an in vitro T-cell proliferation assay and display a greater binding affinity to CD47 than does wild-type SIRP- ⁇ are selected for further development.
  • Non-human primate (NHP) can also be used to test high-affinity SIRP- ⁇ D1 variants, as the level of cross reactivity for non-human primate (NHP) CD47 and mouse CD47 may be different.
  • ADCC antibody-dependent cell cytotoxicity
  • CDC complement-dependent cytotoxicity
  • the mutations L234A, L235A, G237A, and N297A of an IgG1 Fc resulted in a severe loss of binding to Fc ⁇ receptors CD16a, CD32a, CD32b, CD32c, and CD64 as compared to a wild-type IgG1, or a construct lacking one or more of these mutations.
  • the mutations L234A, L235A, G237A e.g., IgG1 AAA
  • the mutations L234A, L235A, G237A, and N297A can result in reduction of phagocytosis of the construct comprising the Fc variant.
  • Approximately 400 Resonance Unit (RU) of minimally biotinylated Fc constructs were immobilized on flow cells of a NLC sensor chip (Bio-rad, Hercules, Calif.) by avidin-neutravidin interaction. Biotinylation was performed according to the manufacturer's instructions using Pierce EZ-Link Sulfo-NHS-LC-LC-Biotin and an equimolar ratio of linker:protein. Analytes (hFc ⁇ R) were injected in a “one-shot” kinetic mode at nominal concentrations of 0, 61, 185, 555, 1666, and 5000 nM. Association and dissociation times were monitored for 90s and 600s respectively.
  • Biosensor data were double-referenced by subtracting the interspot data (containing no immobilized protein) from the reaction spot data (immobilized protein) and then subtracting the response of a buffer “blank” analyte injection from that of an analyte injection. Double-referenced data were fit to an equilibrium analysis using a simple binding isotherm. K D,app .
  • K D app k d,app /k a,app
  • the mutations A330S, P331S, and N297A of an IgG2 Fc region resulted in a severe loss of binding to Fc ⁇ receptors CD16a, CD32a, CD32b, CD32c, and CD64 as compared to a wild-type IgG or a construct lacking these mutations. Accordingly, the mutations A330S and P331S along with aglycosylation or the deglycosylating mutation N297A resulted in complete loss of binding to the Fc ⁇ receptors studied.
  • SIRP- ⁇ Fc fusions were prepared at 5 ⁇ g/mL in PBS pH 7.4 and used to coat duplicate wells of Nunc Immulon 4HBX ELISA 96 well plates (using 50 ⁇ L/well) overnight at 4° C. The following day, plates were washed five times with wash buffer (PBS and 0.05% Tween-20) and incubated with 200 ⁇ L/well of blocking buffer (PBS and 0.5% BSA) for 1 hour at room temperature.
  • Plates were washed five times and incubated for 2 hours at room temperature with 0, 0.13, 0.41, 1.23, 3.7, 11.1, 33.3, 100 ⁇ g/mL C1q in assay buffer (PBS, 0.5% BSA, 0.05% Tween-20, 0.25% CHAPS, 5 mM EDTA, and 0.35% NaCl). Plates were washed and incubated for 1 hour with 50 l/well HRP Conjugated sheep-anti-human-C1q at 2.0 ⁇ g/mL in assay buffer. Plates were washed five times and incubated for ⁇ 10 minutes with TMB (1-Step Ultra TMB-ELISA, Thermo Sci. Cat. #34028).
  • both wildtype IgG1 (SEQ ID NO: 123) and wildtype IgG2 (SEQ ID NO: 126) bound C1q in a dose dependent manner.
  • IgG1 variants IgG1_AAA (SEQ ID NO: 124); IgG1_N297A (SEQ ID NO: 125); and IgG1_AAA_N297A (SEQ ID NO: 96) demonstrated significantly reduced and minimally detectable C1q binding activity.
  • IgG2 variants IgG2_A330S, P331S (SEQ ID NO: 127); IgG2_N297A (SEQ ID NO: 128); and IgG2_N297A, A330S, P331S (SEQ ID NO: 129) also demonstrated significantly reduced and minimally detectable C1q binding activity.
  • This reduced and minimally detectable C1q binding activity of IgG1 and IgG2 variants were comparable to wildtype IgG4 (SEQ ID NO: 130), which does not to bind C1q.
  • SIRP- ⁇ D1 variant-Fc variant polypeptides were produced as shown in Table 22 below. Binding to human CD47 was determined by the methodologies as described in Example 1.
  • phagocytosis assay To obtain quantitative measurements of phagocytosis, a phagocytosis assay was utilized in which primary human macrophages and GFP+ or CFSE-labeled tumor cells were co-cultured with Fc variant polypeptide constructs described herein. The following materials and methods were employed:
  • DLD-1-GFP-Luciferase cells, MM1R, and N87 were maintained in growth medium comprising RPMI (Gibco) supplemented with 10% heat-inactivated Fetal Bovine Serum (Gibco), 1% penicillin/streptomycin (Gibco), and 1% Glutamax (Gibco).
  • DLD-1-GFP-Luciferase and N87 cells were grown as adherent monolayers and MM1R cells were grown in suspension.
  • PBMCs Peripheral blood mononuclear cells
  • CD14+ monocytes were purified by negative selection using the Monocyte Isolation Kit II (Miltenyi Biotec) and LS columns (Miltenyi Biotec) according to the manufacturer's protocol.
  • CD14+ monocytes were seeded into 15 cm tissue culture plates (Corning) at 10 million cells per dish in 25 ml differentiation medium comprised of IMDM (Gibco) supplemented with 10% human AB serum (Corning), 1% penicillin/streptomycin, and 1% Glutamax. Cells were cultured for seven to ten days.
  • DLD-1-GFP-Luciferase and N87 cells were detached from culture plates by washing twice with 20 ml PBS and incubation in 10 ml TrypLE Select (Gibco) for 10 minutes at 37° C. Cells were removed with a cell scraper (Corning), centrifuged, washed in PBS, and resuspended in IMDM. MM1R and N87 cells were labeled with the Celltrace CFSE Cell Proliferation kit (Thermo Fisher) according to the manufacturer's instructions and resuspended in IMDM. Macrophages were detached from culture plates by washing twice with 20 ml PBS and incubation in 10 ml TrypLE Select for 20 minutes at 37° C. Cells were removed with a cell scraper (Corning), washed in PBS, and resuspended in IMDM.
  • Phagocytosis assays were assembled in ultra-low attachment U-bottom 96 well plates (Corning) containing 100,000 DLD-1 GFP Luciferase, MM1R, or N87 cells, five-fold serial dilutions of SIRP- ⁇ -Fc variants from 1000 nM to 64 pM, and cetuximab (Absolute Antibody), daratumumab, or control antibody of the same isotype (Southern Biotech) at 1 ⁇ g/ml. Plates were preincubated 30 minutes at 37° C. in a humidified incubator with 5 percent carbon dioxide, then 50,000 macrophages were added. Plates were incubated two hours at 37° C. in a humidified incubator with 5 percent carbon dioxide.
  • FIG. 7 shows phagocytosis of DLD-1-GFP-Luciferase tumor cells by human monocyte-derived macrophages in the presence of SEQ ID NO: 105 (Fc variant IgG2_A330S, P331S, N297A) and SEQ ID NO: 127 (Fc variant IgG2_A330S, P331S).
  • SEQ ID NO: 105 Fc variant IgG2_A330S, P331S, N297A
  • SEQ ID NO: 127 Fc variant IgG2_A330S, P331S
  • SEQ ID NO: 105 Fc variant IgG2_A330S, P331S, N297A
  • CX cetuximab
  • SEQ ID NO: 105+CTX cetuximab
  • a polypeptide with Fc variant IgG2_A330S, P331S has measurable phagocytosis activity as a single agent.
  • the percent of macrophages that phagocytosed tumor cells and are GFP + is indicated on the y-axis ( FIG. 7 ).
  • Concentration of CD47 binding sites from the addition of SEQ ID NO: 105 and SEQ ID NO: 127 is indicated on the x-axis.
  • DLD-1-GFP-Luciferase cells and macrophages were incubated with the indicated concentrations of SEQ ID NO: 105, SEQ ID NO: 107 and CTX (1 ug/mL) and control antibody (IgG1, k). Cells were also incubated with PBS plus cetuximab (line labeled PBS+CTX) or a PBS plus a control antibody of the same isotype (line labeled PBS+IgG1k).
  • FIG. 8 shows phagocytosis of DLD-1-GFP-Luciferase tumor cells by human monocyte-derived macrophages in the presence of SEQ ID NO: 96 (Fc variant IgG1 L234A, L235A, G237A, N297A and SEQ ID NO: 124 (Fc variant IgG1 L234A, L235A, G237A).
  • SEQ ID NO: 96 Fc variant IgG1 L234A, L235A, G237A, N297A
  • SEQ ID NO: 124 Fc variant IgG1 L234A, L235A, G237A
  • the percent of macrophages that phagocytosed tumor cells and are GFP+ is indicated on the y-axis.
  • Concentration of CD47 binding sites from addition of SEQ ID NO: 96 and SEQ ID NO: 124 is indicated on the x-axis.
  • DLD-1-GFP-Luciferase cells and macrophages were incubated with CTX at 1 ⁇ g/mL and the indicated concentrations of SEQ ID NO: 96 (line labeled SEQ ID NO: 96+CTX) or SEQ ID NO: 124 (line labeled SEQ ID NO: 124+CTX).
  • FIG. 9 shows phagocytosis of DLD-1-GFP-Luciferase tumor cells by human monocyte-derived macrophages in the presence of SEQ ID NO: 134 (Fc variant IgG4_S228P).
  • SEQ ID NO: 134 Fc variant IgG4_S228P
  • FIG. 9 shows that the SEQ ID NO: 134 construct has considerable phagocytosis activity as a single agent in in vitro phagocytosis.
  • the percent of macrophages that phagocytosed tumor cells and are GFP+ is indicated on the y-axis.
  • Concentration of CD47 binding sites from addition of SEQ ID NO: 134 is indicated on the x-axis.
  • DLD-1-GFP-Luciferase cells and macrophages were incubated with the indicated concentrations of SEQ ID NO: 134 (line labeled SEQ ID NO: 134+Medium). Cells were also incubated with control antibody (IgG1, k; black square).
  • SIRP- ⁇ D1 variant polypeptide was expressed by fusion to HSA polypeptides, as shown in Table 23 below. Binding to human CD47 was determined by the methodologies as described in Example 1.
  • SIRP- ⁇ D1 variant polypeptides comprising Fc and HSA fusions can have an extended half-life compared to a SIRP- ⁇ D1 variant alone.
  • the SIRP- ⁇ D1 variant polypeptide fused to Fc as represented by SEQ ID NO: 104 and the SIRP- ⁇ D1 variant polypeptide fused to HSA as represented by SEQ ID NO: 159 have increased half-life relative to a SIRP- ⁇ D1 variant polypeptide which is not fused to an Fc or HSA as represented by SEQ ID NO: 85.
  • the half-life extension can be attributed to the ability of SIRP- ⁇ D1 variant polypeptides which are fused to Fc and HSA to bind to FcRn, which may be associated with prolonged cycling.
  • mice were obtained from Harlan Labs, and were used for the single dose PK study of the compounds represented by SEQ ID NO: 104, SEQ ID NO: 159, and SEQ ID NO: 85.
  • Each compound was formulated at a working dose of 5 mg/mL. The volume of the dose was adjusted based on the weight of each mouse, ensuring that each mouse was dosed at 1, 3 and 10 mg/kg.
  • the compounds were administered intravenously via the mouse tail vein. Three mice were dosed for each time point at each dose level for each compound. After dosing, mice had blood withdrawn at the following 8 time points: 0.25, 1, 4, 8, 24, 48, 72 and 120 hrs.
  • the data for SEQ ID NO: 104 was obtained using a human Fc ELISA protocol. Briefly, Immulon 4HBX ELISA 96 well plates were coated (Thermo Scientific cat. #3855) with 2 ⁇ g/ml, 100 ⁇ l/well of purified CD47 overnight at room temperature in 1 ⁇ antigen coating buffer (ImmunoChemistry Technologies, cat. #6248). Wells were washed 5 times with 200-300 ⁇ L/well 1 ⁇ TBST (Tris-Buffered Saline+0.05% Tween-20) (Thermo Scientific 20 ⁇ , cat. #28360). Wells were blocked with 200 ⁇ L/well 7.5% BSA in PBS (GIBCO, cat. #15260-037) for 1-2 hours.
  • Immulon 4HBX ELISA 96 well plates were coated (Thermo Scientific cat. #3855) with 2 ⁇ g/ml, 100 ⁇ l/well of purified CD47 overnight at room temperature in 1 ⁇ antigen coating buffer (ImmunoChemis
  • Wells were washed 5 times with 200-300 ⁇ L/well 1 ⁇ TBST. 50 ⁇ L/well standard curve, Quality Controls (QCs) and unknown samples diluted in normal CD1 mouse serum diluted 1:4 in TBS was added. The standard curve, QCs and unknown samples were incubated at room temperature for 1 hour.
  • QCs Quality Controls
  • Concentrations for standard curve were as follows: 0.2500 ⁇ g/mL; 0.1250 ⁇ g/mL; 0.0625 ⁇ g/mL; 0.0313 ⁇ g/mL; 0.0156 ⁇ g/mL; 0.0078 ⁇ g/mL; 0.0039 ⁇ g/mL; 0.0020 ⁇ g/mL; 0.0010 ⁇ g/mL; 0.0005 ⁇ g/mL; 0.00025 ⁇ g/mL; and 0.00000 ⁇ g/mL.
  • QCs Quality Controls
  • SEQ ID NO: 85 The data for SEQ ID NO: 85 was obtained using a His Tag ELISA protocol.
  • Immulon 4HBX ELISA 96 well plates (Thermo Scientific cat. #3855) were coated with 2 ⁇ g/mL, 100 ⁇ L/well of purified CD47 overnight at room temperature in 1 ⁇ antigen coating buffer (ImmunoChemistry Technologies, cat. #6248). Wells were washed 5 times with 200-300 ⁇ L/well using 1 ⁇ TBST (Tris-Buffered Saline+0.05% Tween-20) (Thermo Scientific 20 ⁇ , cat. #28360). Wells were blocked with 200 ⁇ L/well 7.5% BSA in PBS (GIBCO, cat. #15260-037) for 1-2 hours.
  • TST Tris-Buffered Saline+0.05% Tween-20
  • Wells were washed 5 times with 200-300 ⁇ L/well 1 ⁇ TBST. 50 ⁇ L/well standard curve, Quality Controls (QCs) and unknown samples diluted in normal CD1 mouse serum diluted 1:4 in TBS were added. The standard curve, QCs and unknown samples were incubated at room temperature for 1 hour.
  • the standard curve concentrations were as follows: 0.12500 ⁇ g/mL; 0.06250 ⁇ g/mL; 0.03125 ⁇ g/mL; 0.01563 ⁇ g/mL; 0.00781 ⁇ g/mL; 0.00391 ⁇ g/mL; 0.00195 ⁇ g/mL; 0.00098 ⁇ g/mL; and 0.00000 ⁇ g/mL.
  • QCs Quality Controls
  • the data for SEQ ID NO: 159 was obtained using a HSA ELISA protocol.
  • Immulon 4HBX ELISA 96 well plates (Thermo Scientific cat. #3855) were coated with 2 ug/ml, 100 ul/well of purified CD47 overnight at room temperature in 1 ⁇ antigen coating buffer (ImmunoChemistry Technologies, cat. #6248).
  • Wells were washed 5 times with 200-300 ⁇ L/well using 1 ⁇ TBST (Tris-Buffered Saline+0.05% Tween-20) (Thermo Scientific 20 ⁇ , cat. #28360).
  • Wells were blocked with 200 ⁇ L/well Li-Cor Odyssey Blocking Buffer (TBS) (Li-Cor, cat.
  • the standard curve concentrations were as follows: 3.20 ⁇ g/ml; 1.60 ⁇ g/ml; 0.80 ⁇ g/ml; 0.40 ⁇ g/ml; 0.20 ⁇ g/ml; 0.10 ⁇ g/ml; 0.05 ⁇ g/ml; 0.025 ⁇ g/ml; and 0.00 ⁇ g/ml.
  • QCs Quality Controls
  • SIRP- ⁇ D1 variant polypeptides demonstrated reduced or ablated hemagglutination. Specifically, when hemagglutination occurs, a diffused red coloration is present instead of a red dot, as is shown for the positive control B6H12. For the SIRP- ⁇ D1 variant polypeptides tested in FIG. 11 , there was a reduction or ablation of hemagglutination.
  • a hemagglutination assay was carried out as follows: human erythrocytes were diluted in PBS and transferred to 96 well polystyrene plates (Corning) at 4 million cells per well in a volume of 75 ⁇ L. Five-fold serial dilutions of the indicated proteins were added to wells in a volume of 75 ⁇ L PBS, with final concentration from 1000 nM to 0.488 nM. As a negative control, PBS alone was added to one row of wells. Erythrocytes settled to the well bottom, forming a small and well-defined pellet. As a positive control, cells were treated with the anti-CD47 antibody B6H12 (ebioscience).
  • IgG2-based polypeptides SEQ ID NO: 109 and SEQ ID NO: 113 caused slight hemagglutination at 4 and 8 nM. No hemagglutination was observed for all other polypeptide constructs (IgG1-based and HSA-based).
  • mice C57BL/6 mice (7- to 10-week-old female animals) obtained from Charles River Laboratory were used.
  • Mouse colon adenocarcinoma cell line MC38 was recovered from frozen stocks and grown in RPMI 1640 containing 10% fetal bovine serum, penicillin-streptomycin, and L-glutamine. Cells were spun down and resuspended at a concentration of 2E+07 cells/mL in serum-free medium without additives.
  • Day ⁇ 7 i.e., 7 days before the projected staging day
  • the mice were implanted by subcutaneous injection into the left flank with 100 ⁇ L (2.0 ⁇ 10 6 cells) per mouse of the freshly prepared MC38 in phosphate buffered saline (PBS).
  • PBS phosphate buffered saline
  • mice of Groups 1 to 5 were treated with vehicle (PBS), anti-mPD-L1 (Clone 10F.9G2, 200 ⁇ g), SEQ ID NO: 211 (200 ⁇ g), anti-mPD-L1 (200 ⁇ g)+SEQ ID NO: 211 (100 ⁇ g), or anti-mPD-L1 (200 ⁇ g)+SEQ ID NO: 211 (200 ⁇ g), respectively.
  • Doses were by administered intraperitoneal (IP) injection of 0.05 mL/mouse on days 1, 4 and 7.
  • SEQ ID NO: 211 was generated by genetically fusing SED ID NO: 206 to a Fc domain monomer.
  • SEQ ID NO: 206 contains mutations shown to improve binding to mouse CD47. The binding data is presented in Table 18.
  • Tumor sizes were measured two times per week, and at study completion, the perpendicular minor (width, W, and height, H) and major (length, L) dimensions were measured using microcalipers (Mitutoyo, Aurora, Ill.).
  • Tumor volume (mm 3 ) was calculated using the formula for the volume of an ellipsoid sphere (L ⁇ W ⁇ H/2). Study animals were subjected to humane sacrifice during the study when tumor volumes in individual animals exceeded (or approached) 2,500 mm 3 . The number of animals remaining in the study up to Day 42 were used for a survival analysis.
  • mice dosed with vehicle or SEQ ID NO: 211 200 ⁇ g (Groups 1 and 3, respectively) (Groups 1 and 3, respectively), sacrifices began during the 4 th week (from Day 25) and all animals in these groups were dead by the end of the 5 th week (Day 35).
  • mice dosed with anti-mPD-L1 (alone or in combination with SEQ ID NO: 211; Groups 2, 4, and 5)
  • FIG. 12 shows survival curves for each treatment group during the study period.
  • the anti-mPD-L1 plus 200 ⁇ g SEQ ID NO: 211 treatment group had the highest number of surviving animals, following by the anti-mPD-L1 plus 100 ⁇ g SEQ ID NO: 211 treatment group and anti-mPD-L1 alone group, with 7 out 10 (70%), 5 out 10 (50%) and 4 out of 10 (40%) mice remaining at Day 42, respectively (Table 25).
  • Median survival was 29 and 30.5 days respectively for vehicle (Group 1) and SEQ ID NO: 211 alone (Group 3) treatments.
  • Median survival increased to 42 days for anti-mPD-L1 alone (Group 2) and anti-PD-L1 plus 100 ⁇ g SEQ ID NO: 211 (Group 4) treatment.
  • Median survival for anti-mPD-L1 plus 200 ⁇ g SEQ ID NO: 211 treatment (Group 5) was not determined as more than 50% of animals remained at the end of the study (Day 42).
  • Polypeptides including a high affinity SIRP- ⁇ D1 variant are co-administered with checkpoint inhibitors to treat mouse models of various cancers, e.g., solid tumor and hematological cancer. Cancers may be recognized by the immune system, and under some circumstances, the immune system may be involved in eliminating tumors. Blockade of co-inhibitory molecules, such as CTLA-4, PD-1, and LAG-3, may be involved in amplifying T-cell responses against tumors.
  • Polypeptides described herein are administered in combination with a checkpoint inhibitor, such as an antibody inhibitor of CTLA-4 (e.g., ipilimumab, tremelimumab), PD-1 (nivolumab, pidilizumab, MK3475 also known as pembrolizumab, BMS936559, and MPDL3280A), and LAG-3 (e.g., BMS986016).
  • a checkpoint inhibitor such as an antibody inhibitor of CTLA-4 (e.g., ipilimumab, tremelimumab), PD-1 (nivolumab, pidilizumab, MK3475 also known as pembrolizumab, BMS936559, and MPDL3280A), and LAG-3 (e.g., BMS986016).
  • mice e.g., lymphoma models
  • an antibody inhibitor of CTLA-4 and a high affinity SIRP- ⁇ D1 variant fused to an IgG Fc variant provided herein e.g., a SIRP- ⁇ construct
  • mice are treated with vehicle (PBS), tremelimumab (200 ⁇ g)+SIRP- ⁇ construct (100 pg), or tremelimumab (200 ⁇ g)+SIRP- ⁇ construct (200 ⁇ g).
  • Doses are administered by intraperitoneal (IP) injection at 0.05 mL/mouse on days 1, 4 and 7. Tumor response to combination therapy is determined daily by measuring tumor volume.
  • IP intraperitoneal
  • Tremelimumab is an IgG2 antibody that may be more effective at fixing complement while ipilimumab is an IgG1 antibody that may be useful in preventing the elimination of activated T-cells.
  • Example 16 Method of Treating a Cancer Expressing an Epithelial Marker
  • SIRP- ⁇ polypeptide constructs such as a high affinity SIRP- ⁇ D1 variant (e.g., any variant provided in Tables 2, 5, and 6) fused to an IgG Fc variant, are administered to treat a cancer expressing an epithelial cell marker.
  • Increased phagocytosis resulting from the blockade of CD47 signaling, for example by a SIRP- ⁇ D1 construct, may depend on the presence of macrophages.
  • a SIRP- ⁇ D1 polypeptide construct in combination with an antibody targeting an epithelial marker that is expressed in or on a cancer cell is used to treat the cancer reducing the risk of side effects, e.g., phagocytosis of epithelial cells, due to a low abundance of macrophages at the skin periphery.
  • Mouse models of a cancer expressing an epithelial marker are administered a SIRP- ⁇ construct in combination with an antibody that targets the epithelial marker, e.g., an anti-EGFR antibody or an anti-EpCAM antibody.
  • Antibodies targeting epithelial markers can recognize both cancerous cells and non-cancerous cells, for example non-cancerous cells at the skin periphery. However, it is expected that non-cancerous cells at the skin periphery will not be susceptible to phagocytosis due to a low abundance of macrophages near the skin.
  • a phagocytosis assay with different cell types MM1R and N87 cells was performed using methods as described in Example 8.
  • a first single-arm SIRP- ⁇ Fc fusion (e.g., A) was formed from a heterodimer of SEQ ID NO: 139 (an Fc variant) and SEQ ID NO: 138 (a SIRP- ⁇ Fc fusion).
  • a second single-arm SIRP- ⁇ Fc fusion (e.g., B) was formed from a heterodimer of SEQ ID NO: 141 (an Fc variant) and SEQ ID NO: 140 (a SIRP- ⁇ Fc fusion).
  • a third single-arm SIRP- ⁇ Fc fusion (e.g., C) was formed from a heterodimer of SEQ ID NO: 139 (an Fc variant) and SEQ ID NO: 142 (a SIRP- ⁇ Fc fusion).
  • a fourth single-arm SIRP- ⁇ Fc fusion (e.g., D) was formed from a heterodimer of SEQ ID NO: 141 (an Fc variant) and SEQ ID NO: 143 (a SIRP- ⁇ Fc fusion).
  • a fifth single-arm SIRP- ⁇ Fc fusion (e.g., E) was formed from a heterodimer of SEQ ID NO: 147 (an Fc variant) and SEQ ID NO: 146 (a SIRP- ⁇ Fc fusion).
  • a sixth single-arm SIRP- ⁇ Fc fusion (e.g., F) was formed from a heterodimer of SEQ ID NO: 149 (an Fc variant) and SEQ ID NO: 148 (a SIRP- ⁇ Fc fusion).
  • the CD47 binding affinities (K D ) of the SIRP- ⁇ single-arm when tested as a monomer are as follows: ⁇ 10 pM (A,B), ⁇ 100 pM (C, D) and ⁇ 5 nM (E, F). The sequences are provided in Table 27 below.
  • FIGS. 15 - 17 shows phagocytosis of multiple myeloma line 1R (MM1R) and gastric carcinoma line N87 by non-polarized, human monocyte-derived macrophages.
  • “+” and “ ⁇ ” denotes the addition or absence of Daratumumab (Dara) respectively in FIGS. 15 - 16 .
  • “+” and “ ⁇ ” denotes addition and absence of Herceptin/trastuzumab (Her) respectively.
  • FIG. 15 shows construct A in the presence of a control antibody (IgG1,k), e.g., “A ⁇ ” has ablated phagocytosis as a single agent while it is able to increase Daratumumab (Dara) phagocytosis, e.g., “A+”.
  • the percent of macrophages that phagocytosed MM1R and are CFSE + is indicated on the y-axis.
  • Concentration of CD47 binding sites from addition of construct A, B, or control construct is indicated on the x-axis.
  • the levels of phagocytosis are comparable to the control construct (which is a double-arm SIRP- ⁇ ).
  • the level of phagocytosis resulting from incubation with an anti-CD47 antibody, e.g. B6H12 (100 nM) is comparable to incubation with Dara, e.g. PBS+.
  • single arm SIRP- ⁇ -Fc fusions can increase Dara phagocytosis comparable to a double arm SIRP- ⁇ -Fc fusions.
  • FIG. 16 shows construct C in the presence of a control antibody (IgG1,k), e.g., “C ⁇ ” has ablated phagocytosis in the phagocytosis assay as a single agent while it is able to increase Daratumumab (Dara) phagocytosis, e.g., “C+”.
  • construct D in the presence of a control antibody (IgG1,k), e.g., “D ⁇ ” has ablated phagocytosis in the phagocytosis assay as a single agent while it is able to increase Daratumumab (Dara) phagocytosis, e.g., “D+”.
  • the percent of macrophages that phagocytosed MM1R and are CFSE + is indicated on the y-axis. Concentration of CD47 binding sites from addition of construct C, D, or control construct is indicated on the x-axis.
  • the levels of phagocytosis are comparable to the control construct (which is a double-arm SIRP- ⁇ ).
  • the level of phagocytosis resulting from incubation with an anti-CD47 antibody, e.g. B6H12 (100 nM), is comparable to incubation with Dara, e.g. PBS+.
  • single arm SIRP- ⁇ -Fc fusions can increase Dara phagocytosis comparable to a double arm SIRP- ⁇ -Fc fusions.
  • single arm SIRP- ⁇ -Fc fusions can increase Dara phagocytosis comparable to a double arm SIRP- ⁇ -Fc fusions.
  • FIG. 17 shows phagocytosis in the presence of low affinity single-arm SIRP- ⁇ constructs (E, F) performed similarly as above examples.
  • these low affinity single-arm SIRP- ⁇ constructs (E, F) in combination with Herceptin showed comparable phagocytosis of N87 cells to Herceptin alone (PBS+). Therefore, 5 nM affinity for CD47 is not sufficient for single-arm SIRP- ⁇ -Fc fusion to enhance further in vitro phagocytosis in combination with Herceptin.
  • SEQ ID NO: 215 is an engineered SIRP- ⁇ D1 variant that does not bind to human, mouse, or rat CD47 and was utilized as a negative control.
  • SEQ ID NO: 215 EEELQVIQPDKSVLVAAGETATLRCTATSLIPRGPIQWFRGAGPGRELIY NRKEGHFPRVTTVSDLTKRNNMDFSIRIGNITPADAGTYYCVKFRKGSPD DVEFKSGAGTELSVRAKPSDKTHTCPPCPAPEAAGAPSVFLFPPKPKDTL MISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYASTYR VVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTL PPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSD GSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
  • NSG mice Immunodeficient NOD scid gamma (NSG) mice (NOD.Cg-Prkdc scid Il2rg tm1Wjl /SzJ; 50 females, plus spares) were purchased as 6- to 10-week-old animals.
  • Human lymphoma cell line GFP-Luc-Raji cells were grown in RPMI 1640 containing 10% fetal bovine serum, penicillin, streptomycin, and L-glutamine. Cells then were spun down and re-suspended at a concentration of 1.0 ⁇ 10 7 cells/mL in serum-free medium without additives and combined 1:1 with MatrigelTM (Trevigen, Gaithersburg, Md.).
  • Groups 1 to 5 were treated with (1) SEQ ID NO: 215 [10 mg/kg (mpk), 3 ⁇ /week]; (2) SEQ ID NO: 104 (10 mpk, 3 ⁇ /week); (3) rituximab (5 mpk, 2 ⁇ /week)+SEQ ID NO: 100 (10 mpk, 3 ⁇ /week); (4) rituximab (5 mpk, 2 ⁇ /week)+SEQ ID NO: 104 (10 mpk, 3 ⁇ /week); or (5) rituximab (5 mpk, 2 ⁇ /week)+SEQ ID NO: 215 (10 mpk, 3 ⁇ /week), respectively.
  • Doses were administered by intraperitoneal (IP) injection at 0.05 mL/mouse. For all animals, doses were administered starting on the staging day and continuing for a total of 31 days (Days 1-31).
  • the SIRP- ⁇ construct of SEQ ID NO: 215 does not exhibit measurable binding to CD47 (see Table 28). Tumors in the SEQ ID NO: 215-dosed group (Group 1) grew linearly through Day 31 ( FIG. 19 A ), similar to tumors observed in the PBS vehicle group of the same model (data not shown). This observation demonstrates ongoing tumor growth in the absence of effective treatment.
  • CBC Complete blood count
  • HGB Hemoglobin
  • mice were treated with a high affinity SIRP- ⁇ variant construct containing either a wildtype IgG1 Fc construct (SEQ ID NO: 216) or a IgG1 Fc variant construct (SEQ ID NO:96) with IgG1 mutations L234A, L235A, G237A, and N297A (IgG1_AAA_N297A).
  • Mice were assigned to five groups of six and were treated on day 1 and 7 (see solid arrows in FIG.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Immunology (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Zoology (AREA)
  • Epidemiology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Toxicology (AREA)
  • Microbiology (AREA)
  • Cell Biology (AREA)
  • Mycology (AREA)
  • Biomedical Technology (AREA)
  • Oncology (AREA)
  • Endocrinology (AREA)
  • Pulmonology (AREA)
  • Urology & Nephrology (AREA)
  • Biotechnology (AREA)
  • Orthopedic Medicine & Surgery (AREA)
  • Diabetes (AREA)
  • Physical Education & Sports Medicine (AREA)
  • Neurology (AREA)
  • Hematology (AREA)
  • Rheumatology (AREA)

Abstract

The present disclosure features signal-regulatory protein α (SIRP-α) polypeptides and constructs that are useful, e.g., to target a cell (e.g., a cancer cell or a cell of the immune system), to increase phagocytosis of the target cell, to eliminate immune cells such as regulatory T-cells, to kill cancer cells, to treat a disease (e.g., cancer) in a subject, or any combinations thereof. The SIRP-α constructs include a high affinity SIRP-α D1 domain or variant thereof that binds CD47 with higher affinity than a wild-type SIRP-α. The SIRP-α polypeptides or constructs include a SIRP-α D1 variant fused to an Fc domain monomer, a human serum albumin (HSA), an albumin-binding peptide, or a polyethylene glycol (PEG) polymer. Compositions provided herein include (i) a polypeptide including a signal-regulatory protein α (SIRP-α) D1 variant and (ii) an antibody.

Description

CROSS-REFERENCE
This application is a continuation of U.S. patent application Ser. No. 16/153,404, filed Oct. 5, 2018, which is a continuation of U.S. patent application Ser. No. 15/230,186, filed Aug. 5, 2016 (U.S. Pat. No. 10,259,859), which claims the benefit of U.S. Provisional Application No. 62/202,772, filed Aug. 7, 2015; U.S. Provisional Application No. 62/202,775, filed Aug. 7, 2015; U.S. Provisional Application No. 62/202,779, filed Aug. 7, 2015; U.S. Provisional Application No. 62/276,801, filed Jan. 8, 2016; U.S. Provisional Application No. 62/265,887 filed Dec. 10, 2015; U.S. Provisional Application No. 62/276,796 filed Jan. 8, 2016; and U.S. Provisional Application No. 62/346,414 filed Jun. 6, 2016 which applications are each incorporated herein in their entireties by reference.
SUBMISSION OF SEQUENCE LISTING ON ASCII TEXT FILE
The content of the following submission on ASCII text file is incorporated herein by reference in its entirety: a computer readable form (CRF) of the Sequence Listing (file name: 757972000402SEQLIST.TXT, date recorded: Jan. 6, 2020, size: 427 KB)
SUMMARY OF THE INVENTION
Disclosed herein, in certain embodiments, are polypeptides comprising: a signal-regulatory protein α (SIRP-α) D1 variant comprising a SIRP-α D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP-α D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP-α D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92. In some embodiments, the wild type SIRP-α D1 domain has a sequence according to any one of SEQ ID NOs: 1-10. In some embodiments, the SIRP-α D1 domain comprises between one and nine additional amino acid mutations relative to a wild-type SIRP-α D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54 residue 56, residue 66, and residue 92. In some embodiments, the SIRP-α D1 variant comprises the amino acid sequence, EEELQX1IQPDKSVLVAAGETATLRCTX2TSLX3PVGPIQWFRGAGPGRX4LIYNQX5X6GX7FPR VTTVSDX8TKRNNMDFSIRIGX9ITPADAGTYYCX10KFRKGSPDDVEFKSGAGTELSVRAKPS (SEQ ID NO: 49), wherein X1 is V, L, or I; X2 is A, I, V, or L; X3 is I, F, S, or T; X4 is E, V, or L; X5 is K or R; X6 is E or Q; X7 is H, P, or R; X8 is L, T, S, or G; X9 is A; and X10 is V or I; and wherein the SIRP-α D1 variant has at least two amino acid substitutions relative to a wild-type SIRP-α D1 domain having a sequence according to SEQ ID NO: 1. In some embodiments, the SIRP-α D1 variant has an amino acid sequence according to any one of SEQ ID NOs: 78-85. In some embodiments, the SIRP-α D1 variant comprises the amino acid sequence, EEELQX1IQPDKSVLVAAGETATLRCTX2TSLX3PVGPIQWFRGAGPGRX4LIYNQX5X6GX7FPR VTTVSDX8TKRNNMDFSIRIGX9X10X11X12ADAGTYYCX13KFRKGSPDDVEFKSGAGTELSVR AKPS (SEQ ID NO: 218), wherein X1 is V, L, or I; X2 is A, V, L, or I; X3 is I, S, T, or F; X4 is E, L, or V; X5 is K or R; X6 is E or Q; X7 is H, R, or P; X8 is S, G, L, or T; X9 is any amino acid; X10 is any amino acid; X11 is any amino acid; X12 is any amino acid; and X13 is V or I; and wherein the SIRP-α D1 variant has at least two amino acid substitutions relative to a wild-type SIRP-α D1 domain having a sequence according to SEQ ID NO: 1. In some embodiments, X9 is A. In some embodiments, X9 is N. In some embodiments, X10 is I. In some embodiments, X9 is N and X10 is P. In some embodiments, X9 is N and X11 is any amino acid other than S, T, or C. In some embodiments, X11 is T. In some embodiments, X11 is an amino acid other than T. In some embodiments, X12 is P. In some embodiments, X9 is N and X12 is any amino acid other than P. In some embodiments, the SIRP-α D1 variant comprises the amino acid sequence, EEELQX1IQPDKSVLVAAGETATLRCTX2TSLX3PVGPIQWFRGAGPGRX4LIYNQX5X6GX7FPR VTTVSDX8TKRNNMDFSIRIGX9ITX10ADAGTYYCX11KFRKGSPDDVEFKSGAGTELSVRAKP S (SEQ ID NO: 219), wherein X1 is V, L, or I; X2 is A, V, L, or I; X3 is I, S, T, or F; X4 is E, L, or V; X5 is K or R; X6 is E or Q; X7 is H, R, or P; X8 is S, G, L, or T; X9 is N; X10 is any amino acid other than P; and X11 is V or I; and wherein the SIRP-α D1 variant has at least two amino acid substitutions relative to a wild-type SIRP-α D1 domain having a sequence according to SEQ ID NO: 1. In some embodiments, the SIRP-α D1 variant comprises the amino acid sequence, EEELQX1IQPDKSVLVAAGETATLRCTX2TSLX3PVGPIQWFRGAGPGRELIYNQX4EGX5FPRV TTVSDX6TKRNNMDFSIRIGX7ITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSVRAKPS (SEQ ID NO: 52), wherein X1 is V, L, or I; X2 is A, I, or L; X3 is I, T, S, or F; X4 is K or R; X5 is H, P, or R; X6 is L, T, or G; and X7 is A; and wherein the SIRP-α D1 variant has at least two amino acid substitutions relative to a wild-type SIRP-α D1 domain having a sequence according to SEQ ID NO: 1. In some embodiments, X1 is V or I, X2 is A or I, X3 is I or F, X4 is K or R, X5 is H or P, X6 is L or T, and X7 is A. In some embodiments, the SIRP-α D1 variant has at least three amino acid substitutions relative to a wild-type SIRP-α D1 domain having a sequence according to SEQ ID NO: 1. In some embodiments, the SIRP-α D1 variant has at least four amino acid substitutions relative to a wild-type SIRP-α D1 domain having a sequence according to SEQ ID NO: 1. In some embodiments, the SIRP-α D1 variant has at least five amino acid substitutions relative to a wild-type SIRP-α D1 domain having a sequence according to SEQ ID NO: 1. In some embodiments, the SIRP-α D1 variant has at least six amino acid substitutions relative to a wild-type SIRP-α D1 domain having a sequence according to SEQ ID NO: 1. In some embodiments, the SIRP-α D1 variant has at least seven amino acid substitutions relative to a wild-type SIRP-α D1 domain having a sequence according to SEQ ID NO: 1. In some embodiments, X1 is I. In some embodiments, X2 is I. In some embodiments, X3 is F. In some embodiments, X4 is R. In some embodiments, X5 is P. In some embodiments, X6 is T. In some embodiments, each of X1, X2, X3, X4, X5, and X6 is not a wild-type amino acid. In some embodiments, the SIRP-α D1 variant has an amino acid sequence according to any one of SEQ ID NOs: 81-85. In some embodiments, the SIRP-α D1 variant comprises the amino acid sequence, EEELQX1IQPDKSVSVAAGESAILHCTX2TSLX3PVGPIQWFRGAGPARELIYNQX4EG X5FPRVTTVSEX6TKRENMDFSISISX7ITPADAGTYYCVKFRKGSPDTEFKSGAGTELSVRAKP S (SEQ ID NO: 212), wherein X1 is V, L, or I; X2 is V, I, or L; X3 is I, T, S, or F; X4 is K or R; X5 is H, P, or R; X6 is S, T, or G; and X7 is A; and wherein the SIRP-α D1 variant has at least two amino acid substitutions relative to a wild-type SIRP-α D1 domain having the sequence of SEQ ID NO: 2. In some embodiments, the polypeptide binds to human CD47 with a KD less than about 5×10−9 M. In some embodiments, the polypeptide further comprises an Fc domain monomer linked to the N-terminus or the C-terminus of the polypeptide, wherein the Fc domain monomer is a human IgG1, IgG2, or IgG4 Fc region. In some embodiments, the Fc domain monomer comprises at least one mutation relative to a wild-type human IgG1, IgG2, or IgG4 Fc region. In some embodiments, the polypeptide has the amino acid sequence of any one of SEQ ID NO: 135, SEQ ID NO: 136, or SEQ ID NO: 137. In some embodiments, the Fc domain monomer comprises (a)_one of the following amino acid substitutions relative to wild type human IgG1: T366W, T366S, L368A, Y407V, T366Y, T394W, F405W, Y349T, Y349E, Y349V, L351T, L351H, L351N, L351K, P353S, S354D, D356K, D356R, D356S, E357K, E357R, E357Q, S364A, T366E, L368T, L368Y, L368E, K370E, K370D, K370Q, K392E, K392D, T394N, P395N, P396T, V397T, V397Q, L398T, D399K, D399R, D399N, F405T, F405H, F405R, Y407T, Y407H, Y407I, K409E, K409D, K409T, or K409I; or (b) (i) a N297A mutation relative to a human IgG1 Fc region; (ii) a L234A, L235A, and G237A mutation relative to a human IgG1 Fc region; (iii) a L234A, L235A, G237A, and N297A mutation relative to a human IgG1 Fc region; (iv) a N297A mutation relative to a human IgG2 Fc region; (v) a A330S and P331 S mutation relative to a human IgG2 Fc region; (vi) a A330S, P331 S, and N297A mutation relative to a human IgG2 Fc region; (vii) a S228P, E233P, F234V, L235A, and delG236 mutation relative to a human IgG4 Fc region; or (viii) a S228P, E233P, F234V, L235A, delG236, and N297A mutation relative to a human IgG4 Fc region. In some embodiments, the Fc domain monomer comprises (a) one of the following amino acid substitutions relative to wild type human IgG1: T366W, T366S, L368A, Y407V, T366Y, T394W, F405W, Y349T, Y349E, Y349V, L351T, L351H, L351N, L351K, P353S, S354D, D356K, D356R, D356S, E357K, E357R, E357Q, S364A, T366E, L368T, L368Y, L368E, K370E, K370D, K370Q, K392E, K392D, T394N, P395N, P396T, V397T, V397Q, L398T, D399K, D399R, D399N, F405T, F405H, F405R, Y407T, Y407H, Y407I, K409E, K409D, K409T, or K409I; and (b) the Fc domain monomer further comprises (i) a N297A mutation relative to a human IgG1 Fc region; (ii) a L234A, L235A, and G237A mutation relative to a human IgG1 Fc region; (iii) a L234A, L235A, G237A, and N297A mutation relative to a human IgG1 Fc region; (iv) a N297A mutation relative to a human IgG2 Fc region; (v) a A330S and P331S mutation relative to a human IgG2 Fc region; (vi) a A330S, P331 S, and N297A mutation relative to a human IgG2 Fc region; (vii) a S228P, E233P, F234V, L235A, and delG236 mutation relative to a human IgG4 Fc region; or (viii) a S228P, E233P, F234V, L235A, delG236, and N297A mutation relative to a human IgG4 Fc region. In some embodiments, the polypeptide exhibits a reduction of phagocytosis in a phagocytosis assay compared to a polypeptide with a wild-type human IgG Fc region. In some embodiments, the Fc domain monomer is linked to a second polypeptide comprising a second Fc domain monomer to form an Fc domain dimer. In some embodiments, the second Fc domain monomer is linked to an additional polypeptide. In some embodiments, the additional polypeptide comprises an antibody variable domain. In some embodiments, the antibody variable domain targets an antigen expressed on a cell. In some embodiments, the cell is a cancer cell. In some embodiments, the antibody variable domain targets a cell surface protein involved in immune cell regulation. In some embodiments, the additional polypeptide comprises a therapeutic protein. In some embodiments, the therapeutic protein is a cytokine, an interleukin, an antigen, a steroid, an anti-inflammatory agent, or an immunomodulatory agent. In some embodiments, the additional polypeptide comprises a SIRP-α D1 variant. In some embodiments, the polypeptide further comprises a human serum albumin (HSA) (SEQ ID NO: 12). In some embodiments, the HSA comprises a C34S or K573P amino acid substitution relative to SEQ ID NO: 12. In some embodiments, the polypeptide has an amino acid sequence according to any one of SEQ ID NOs: 152-159. In some embodiments, the polypeptide further comprises an albumin-binding peptide. In some embodiments, the albumin-binding peptide comprises the amino acid sequence DICLPRWGCLW (SEQ ID NO: 160). In some embodiments, the polypeptide further comprises a polyethylene glycol (PEG) polymer. In some embodiments, the PEG polymer is joined to a cysteine substitution in the polypeptide.
Disclosed herein, in certain embodiments, are polypeptides comprising: a signal-regulatory protein α (SIRP-α) D1 variant, wherein the SIRP-α D1 variant comprises the amino acid sequence, EEX1X2QX3IQPDKX4VX5VAAGEX6X7X8LX9CTX10TSLX11PVGPIQWFRGAGPX12RX13LIYNQX14X15GX16FPRVTTVSX17X18TX19RX20NMDFX21IX2IX23X24ITX25ADAGTYYCX26KX27RKGSPD X28X29EX30KSGAGTELSVRX31KPS (SEQ ID NO: 47), wherein X1 is E, or G; X2 is L, I, or V; X3 is V, L, or I; X4 is S, or F; X5 is L, or S; X6 is S, or T; X7 is A, or V; X8 is I, or T; X9 is H, R, or L; X10 is A, V, I, or L; X11 is I, T, S, or F; X12 is A, or G; X13 is E, V, or L; X14 is K, or R; X15 is E, or Q; X16 is H, P, or R; X17 is D, or E; X18 is S, L, T, or G; X19 is K, or R; X20 is E, or N; X21 is S, or P; X22 is S, or R; X23 is S, or G; X24 is any amino acid; X25 is any amino acid; X26 is V, or I; X27 is F, L, or V; X28 is D or absent; X29 is T, or V; X30 is F, or V; and X31 is A, or G; and wherein the SIRP-α D1 variant has at least two amino acid substitutions relative to a wild-type SIRP-α D1 domain having a sequence according to any one of SEQ ID NOs: 1 to 10; and an Fc variant comprising an Fc domain dimer having two Fc domain monomers, wherein each Fc domain monomer independently is (i) a human IgG1 Fc region comprising a N297A mutation; (ii) a human IgG1 Fc region comprising L234A, L235A, and G237A mutations; (iii) a human IgG1 Fc region comprising L234A, L235A, G237A, and N297A mutations; (iv) a human IgG2 Fc region comprising a N297A mutation; (v) a human IgG2 Fc region comprising A330S and P331 S mutations; (vi) a human IgG2 Fc region comprising A330S, P331 S, and N297A mutations; (vii) a human IgG4 Fc region comprising S228P, E233P, F234V, L235A, and delG236 mutations; or (viii) a human IgG4 Fc region comprising S228P, E233P, F234V, L235A, delG236, and N297A mutations. In some embodiments, one of the Fc domain monomers in the Fc domain dimer comprises a human IgG1 Fc region comprising L234A, L235A, G237A, and N297A mutations. In some embodiments, the polypeptide comprises an amino acid sequence according to any one of SEQ ID NOs: 98-104, 107-113, 116-122, or 135-137. In some embodiments, the Fc variant exhibits ablated or reduced binding to an Fcγ receptor compared to a wild-type version of a human IgG Fc region. In some embodiments, the IgG1 or IgG2 Fc variant exhibits ablated or reduced binding to CD16a, CD32a, CD32b, CD32c, and CD64 Fcγ receptors compared to a wild-type version of a human IgG1 or IgG2 Fc region. In some embodiments, the IgG4 Fc variant exhibits ablated or reduced binding to CD16a and CD32b Fcγ receptors compared to a wild-type version of the human IgG4 Fc region. In some embodiments, the IgG1 or IgG2 Fc variant exhibits ablated or reduced binding to C1q compared to a wild-type version of a human IgG1 or IgG2 Fc fusion. In some embodiments, the Fc variant binds to an Fcγ receptor with a KD greater than about 5×10−6 M.
Disclosed herein, in certain embodiments, are polypeptides comprising an Fc variant, wherein the Fc variant comprises an Fc domain dimer having two Fc domain monomers, wherein each Fc domain monomer independently is selected from (i) a human IgG1 Fc region consisting of mutations L234A, L235A, G237A, and N297A; (ii) a human IgG2 Fc region consisting of mutations A330S, P331S and N297A; or (iii) a human IgG4 Fc region comprising mutations S228P, E233P, F234V, L235A, delG236, and N297A. In some embodiments, at least one of the Fc domain monomers is a human IgG1 Fc region consisting of mutations L234A, L235A, G237A, and N297A. In some embodiments, at least one of the Fc domain monomers is a human IgG2 Fc region consisting of mutations A330S, P331S and N297A. In some embodiments, the Fc variant exhibits ablated or reduced binding to an Fcγ receptor compared to the wild-type version of the human IgG Fc region. In some embodiments, the Fc variant exhibits ablated or reduced binding to CD16a, CD32a, CD32b, CD32c, and CD64 Fcγ receptors compared to the wild-type version of the human IgG Fc region. In some embodiments, the Fc variant exhibits ablated or reduced binding to C1q compared to the wild-type version of the human IgG Fc fusion. In some embodiments, at least one of the Fc domain monomers is a human IgG4 Fc region comprising mutations S228P, E233P, F234V, L235A, delG236, and N297A. In some embodiments, the Fc variant exhibits ablated or reduced binding to a Fcγ receptor compared to the wild-type human IgG4 Fc region. In some embodiments, the Fc variant exhibits ablated or reduced binding to CD16a and CD32b Fcγ receptors compared to the wild-type version of its human IgG4 Fc region. In some embodiments, the Fc variant binds to an Fcγ receptor with a KD greater than about 5×10−6M. In some embodiments, the polypeptide further comprises a CD47 binding polypeptide. In some embodiments, the Fc variant exhibits ablated or reduced binding to an Fcγ receptor compared to a wild-type version of a human IgG Fc region. In some embodiments, the CD47 binding polypeptide does not cause acute anemia in rodents and non-human primates. In some embodiments, the CD47 binding polypeptide does not cause acute anemia in humans. In some embodiments, the CD47 binding polypeptide is a signal-regulatory protein α (SIRP-α) polypeptide or a fragment thereof. In some embodiments, the SIRP-α polypeptide comprises a SIRP-α D1 variant comprising the amino acid sequence, EEELQX1IQPDKSVLVAAGETATLRCTX2TSLX3PVGPIQWFRGAGPGRX4LIYNQX5EGX6FPR VTTVSDX7TKRNNMDFSIRIGX8ITPADAGTYYCX9KFRKGSPDDVEFKSGAGTELSVRAKPS (SEQ ID NO: 221), wherein X1 is V or I; X2 is A or I; X3 is I or F; X4 is E or V; X5 is K or R; X6 is H or P; X7 is L or T; X8 is any amino acid other than N; and X9 is V or I. In some embodiments, the SIRP-α polypeptide comprises a SIRP-α D1 variant wherein X1 is V or I; X2 is A or I; X3 is I or F; X4 is E; X5 is K or R; X6 is H or P; X7 is L or T; X8 is not N; and X9 is V.
Disclosed herein, in certain embodiments, are polypeptides comprising: a signal-regulatory protein α (SIRP-α) D1 variant, wherein the SIRP-α D1 variant is a non-naturally occurring high affinity SIRP-α D1 domain, wherein the SIRP-α D1 variant binds to human CD47 with an affinity that is at least 10-fold greater than the affinity of a naturally occurring D1 domain; and an Fc domain monomer, wherein the Fc domain monomer is linked to a second polypeptide comprising a second Fc domain monomer to form an Fc domain, wherein the Fc domain has ablated or reduced effector function. In some embodiments, the non-naturally occurring high affinity SIRP-α D1 domain comprises an amino acid mutation at residue 80.
Disclosed herein, in certain embodiments, are polypeptides comprising a signal-regulatory protein α (SIRP-α) D1 variant, wherein the SIRP-α D1 variant binds CD47 from a first species with a KD less than 250 nM; and wherein the SIRP-α D1 variant binds CD47 from a second species with a KD less than 250 nM; and the KD for CD47 from the first species and the KD for CD47 from the second species are within 100 fold of each other; wherein the first species and the second species are selected from the group consisting of: human, rodent, and non-human primate. In some embodiments, the SIRP-α D1 variant binds CD47 from at least 3 different species. In some embodiments, the non-human primate is cynomolgus monkey.
Disclosed herein, in certain embodiments, are polypeptides comprising: (a) a signal-regulatory protein α (SIRP-α) D1 domain that binds human CD47 with a KD less than 250 nM; and (b) an Fc domain monomer linked to the N-terminus or the C-terminus of the SIRP-α D1 domain, wherein the polypeptide does not cause acute anemia in rodents and non-human primates. In some embodiments, the polypeptide is a non-naturally occurring variant of a human SIRP-α. In some embodiments, administration of the polypeptide in vivo results in hemoglobin reduction by less than 50% during the first week after administration. In some embodiments, administration of the polypeptide in humans results in hemoglobin reduction by less than 50% during the first week after administration. In some embodiments, the polypeptide further comprises at least one Fc variant, wherein the Fc variant is selected from (i) a human IgG1 Fc region consisting of mutations L234A, L235A, G237A, and N297A; (ii) a human IgG2 Fc region consisting of mutations A330S, P331 S and N297A; or (iii) a human IgG4 Fc region comprising mutations S228P, E233P, F234V, L235A, delG236, and N297A. In some embodiments, the Fc variant is a human IgG1 Fc region consisting of mutations L234A, L235A, G237A, and N297A. In some embodiments, the Fc variant is a human IgG2 Fc region consisting of mutations A330S, P331S and N297A. In some embodiments, the Fc variant is a human IgG4 Fc region comprising mutations S228P, E233P, F234V, L235A, delG236, and N297A.
Disclosed herein, in certain embodiments, are methods of treating an individual having a disease or disorder, the method comprising administering to the subject a polypeptide disclosed herein. In some embodiments, the polypeptide comprises a signal-regulatory protein α (SIRP-α) D1 variant comprising a SIRP-α D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP-α D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP-α D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92. In some embodiments, the polypeptide comprises a signal-regulatory protein α (SIRP-α) D1 variant, wherein the SIRP-α D1 variant comprises the amino acid sequence, EEX1X2QX3IQPDKX4VX5VAAGEX6X7X8X9CTX10TSLX11PVGPIQWFRGAGPX12RX13LIYNQ X14X15GX16FPRVTTVSX17X18TX19RX20NMDFX21IX22IX23X24ITX25ADAGTYYCX26KX27RKGS PDX28X29EX30KSGAGTELSVRX31KPS (SEQ ID NO: 47), wherein X1 is E, or G; X2 is L, I, or V; X3 is V, L, or I; X4 is S, or F; X5 is L, or S; X6 is S, or T; X7 is A, or V; X8 is I, or T; X9 is H, R, or L; X10 is A, V, I, or L; X11 is I, T, S, or F; X12 is A, or G; X13 is E, V, or L; X14 is K, or R; X15 is E, or Q; X16 is H, P, or R; X17 is D, or E; X18 is S, L, T, or G; X19 is K, or R; X20 is E, or N; X21 is S, or P; X22 is S, or R; X23 is S, or G; X24 is any amino acid; X25 is any amino acid; X26 is V, or I; X27 is F, L, or V; X28 is D or absent; X29 is T, or V; X30 is F, or V; and X31 is A, or G; and wherein the SIRP-α D1 variant has at least two amino acid substitutions relative to a wild-type SIRP-α D1 domain having a sequence according to any one of SEQ ID NOs: 1 to 10; and an Fc variant comprising an Fc domain dimer having two Fc domain monomers, wherein each Fc domain monomer independently is (i) a human IgG1 Fc region comprising a N297A mutation; (ii) a human IgG1 Fc region comprising L234A, L235A, and G237A mutations; (iii) a human IgG1 Fc region comprising L234A, L235A, G237A, and N297A mutations; (iv) a human IgG2 Fc region comprising a N297A mutation; (v) a human IgG2 Fc region comprising A330S and P331S mutations; (vi) a human IgG2 Fc region comprising A330S, P331S, and N297A mutations; (vii) a human IgG4 Fc region comprising S228P, E233P, F234V, L235A, and delG236 mutations; or (viii) a human IgG4 Fc region comprising S228P, E233P, F234V, L235A, delG236, and N297A mutations. In some embodiments, the polypeptide comprises an Fc variant, wherein the Fc variant comprises an Fc domain dimer having two Fc domain monomers, wherein each Fc domain monomer independently is selected from (i) a human IgG1 Fc region consisting of mutations L234A, L235A, G237A, and N297A; (ii) a human IgG2 Fc region consisting of mutations A330S, P331S and N297A; or (iii) a human IgG4 Fc region comprising mutations S228P, E233P, F234V, L235A, delG236, and N297A. In some embodiments, the polypeptide comprises a signal-regulatory protein α (SIRP-α) D1 variant, wherein the SIRP-α D1 variant is a non-naturally occurring high affinity SIRP-α D1 domain, wherein the SIRP-α D1 variant binds to human CD47 with an affinity that is at least 10-fold greater than the affinity of a naturally occurring D1 domain; and an Fc domain monomer, wherein the Fc domain monomer is linked to a second polypeptide comprising a second Fc domain monomer to form an Fc domain, wherein the Fc domain has ablated or reduced effector function. In some embodiments, the non-naturally occurring high affinity SIRP-α D1 domain comprises an amino acid mutation at residue 80. In some embodiments, the polypeptide comprises a signal-regulatory protein α (SIRP-α) D1 variant, wherein the SIRP-α D1 variant binds CD47 from a first species with a KD less than 250 nM; and wherein the SIRP-α D1 variant binds CD47 from a second species with a KD less than 250 nM; and the KD for CD47 from the first species and the KD for CD47 from the second species are within 100 fold of each other; wherein the first species and the second species are selected from the group consisting of: human, rodent, and non-human primate. In some embodiments, the polypeptide comprises (a) a signal-regulatory protein α (SIRP-α) D1 domain that binds human CD47 with a KD less than 250 nM; and (b) an Fc domain monomer linked to the N-terminus or the C-terminus of the SIRP-α D1 domain, wherein the polypeptide does not cause acute anemia in rodents and non-human primates. In some embodiments, the disease or disorder is a cancer, an autoimmune disease, or an inflammatory disease. In some embodiments, the disease or disorder is a cancer, and the cancer is selected from solid tumor cancer, hematological cancer, acute myeloid leukemia, chronic lymphocytic leukemia, chronic myeloid leukemia, acute lymphoblastic leukemia, non-Hodgkin lymphoma, Hodgkin lymphoma, multiple myeloma, bladder cancer, pancreatic cancer, cervical cancer, endometrial cancer, lung cancer, bronchus cancer, liver cancer, ovarian cancer, colon and rectal cancer, stomach cancer, gastric cancer, gallbladder cancer, gastrointestinal stromal tumor cancer, thyroid cancer, head and neck cancer, oropharyngeal cancer, esophageal cancer, melanoma, non-melanoma skin cancer, Merkel cell carcinoma, virally induced cancer, neuroblastoma, breast cancer, prostate cancer, renal cancer, renal cell cancer, renal pelvis cancer, leukemia, lymphoma, sarcoma, glioma, brain tumor, and carcinoma. In some embodiments, the disease or disorder is an autoimmune disease or an inflammatory disease, and the autoimmune disease or the inflammatory disease is selected from multiple sclerosis, rheumatoid arthritis, a spondyloarthropathy, systemic lupus erythematosus, an antibody-mediated inflammatory or autoimmune disease, graft versus host disease, sepsis, diabetes, psoriasis, atherosclerosis, Sjogren's syndrome, progressive systemic sclerosis, scleroderma, acute coronary syndrome, ischemic reperfusion, Crohn's Disease, endometriosis, glomerulonephritis, myasthenia gravis, idiopathic pulmonary fibrosis, asthma, acute respiratory distress syndrome (ARDS), vasculitis, and inflammatory autoimmune myositis. In some embodiments, the SIRP-α D1 variant has a sequence according to any one of SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159. In some embodiments, the method further comprises administering at least one additional agent. In some embodiments, the at least one additional agent is an antibody, tumor associated antigen, or a non-antibody therapeutic. In some embodiments, at least two additional agents are administered. In some embodiments, the at least two additional agents comprise two antibodies. In some embodiments, the at least two additional agents comprise an antibody and a tumor associated antigen. In some embodiments, the at least one additional agent is an antibody. In some embodiments, the antibody is a human IgG1 isotype antibody. In some embodiments, the antibody is a human IgG2 isotype antibody. In some embodiments, the antibody is a human IgG4 isotype antibody. In some embodiments, the antibody is selected from an anti-HER2 antibody, anti-CD20 antibody, anti-CD19 antibody, anti-CS1 antibody, anti-CD38 antibody, anti-EGFR antibody, anti-PD1 antibody, anti-OX40 antibody, anti-PD-1 antibody, anti-PD-L1 antibody, anti-CD274 antibody, anti-CTLA-4 antibody, anti-CD137 antibody, anti-4-1BB antibody, anti-B7-H3 antibody, anti-FZD7 antibody, anti-CD27 antibody, anti-CCR4 antibody, anti-CD38 antibody, anti-CSF1R antibody, anti-CSF antibody, anti-CD30 antibody, anti-BAFF antibody, anti-VEGF antibody, or anti-VEGFR2 antibody. In some embodiments, the antibody is selected from an anti-HER2 antibody, anti-CD20 antibody, anti-CD19 antibody, anti-CS1 antibody, anti-CD38 antibody, anti-PD-1 antibody, anti-RANKL antibody, or anti-PD-L1 antibody. In some embodiments, the at least one additional agent is at least one antibody and the antibody is selected from cetuximab, necitumumab, pembrolizumab, nivolumab, pidilizumab, MEDI0680, MED16469, atezolizumab, avelumab, durvalumab, MEDI6383, RG7888, ipilimumab, tremelimumab, urelumab, PF-05082566, enoblituzumab, vantictumab, varlilumab, mogamalizumab, SAR650984, daratumumab, trastuzumab, trastuzumab emtansine, pertuzumab, elotuzumab, rituximab, ofatumumab, obinutuzumab, RG7155, FPA008, panitumumab, brentuximab vedotin, MSB0010718C, belimumab, bevacizumab, denosumab, panitumumab, ramucirumab, necitumumab, nivolumab, pembrolizumab, avelumab, atezolizumab, durvalumab, MEDI0680, pidilizumab, or BMS-93659. In some embodiments, the antibody is trastuzumab. In some embodiments, the SIRP-α D1 variant has a sequence according to any one of SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159. In some embodiments, the antibody is rituximab. In some embodiments, the SIRP-α D1 variant has a sequence according to any one of SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159. In some embodiments, the antibody is cetuximab. In some embodiments, the SIRP-α D1 variant has a sequence according to any one of SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159. In some embodiments, the antibody is daratumumab. In some embodiments, the SIRP-α D1 variant has a sequence according to any one of SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159. In some embodiments, the antibody is belimumab. In some embodiments, the SIRP-α D1 variant has a sequence according to any one of SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159. In some embodiments, n the antibody is bevacizumab. In some embodiments, the SIRP-α D1 variant has a sequence according to any one of SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159. In some embodiments, the antibody is denosumab. In some embodiments, the SIRP-α D1 variant has a sequence according to any one of SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159. In some embodiments, the antibody is pantimumab. In some embodiments, the SIRP-α D1 variant has a sequence according to any one of SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159. In some embodiments, the antibody is ramucirumab. In some embodiments, the SIRP-α D1 variant has a sequence according to any one of SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159. In some embodiments, the antibody is necitumumab. In some embodiments, the SIRP-α D1 variant has a sequence according to any one of SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159. In some embodiments, the antibody is nivolumab. In some embodiments, the SIRP-α D1 variant has a sequence according to any one of SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159. In some embodiments, the antibody is pembrolizumab. In some embodiments, the SIRP-α D1 variant has a sequence according to any one of SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159. In some embodiments, the antibody is avelumab. In some embodiments, the SIRP-α D1 variant has a sequence according to any one of SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159. In some embodiments, the antibody is atezolizumab. In some embodiments, the SIRP-α D1 variant has a sequence according to any one of SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159. In some embodiments, the antibody is durvalumab. In some embodiments, the SIRP-α D1 variant has a sequence according to any one of SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159. In some embodiments, the antibody is MEDI0680. In some embodiments, the SIRP-α D1 variant has a sequence according to any one of SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159. In some embodiments, the antibody is pidilizumab. In some embodiments, the SIRP-α D1 variant has a sequence according to any one of SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159. In some embodiments, the antibody is BMS-93659. In some embodiments, the SIRP-α D1 variant has a sequence according to any one of SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159. In some embodiments, the at least one additional agent is a tumor associated antigen and the tumor associated antigen elicits an immune response. In some embodiments, the at least one additional agent is an antibody and the antibody targets a HLA/peptide or MHC/peptide complex. In some embodiments, the antibody targets a HLA/peptide or MHC/peptide complex comprising NY-ESO-1/LAGE1, SSX-2, MAGE family (MAGE-A3), gp100/pmel17, Melan-A/MART-1, gp75/TRP1, tyrosinase, TRP2, CEA, PSA, TAG-72, Immature laminin receptor, MOK/RAGE-1, WT-1, Her2/neu, EphA3, SAP-1, BING-4, Ep-CAM, MUC1, PRAME, survivin, Mesothelin, BRCA1/2 (mutated), CDK4, CML66, MART-2, p53 (mutated), Ras (mutated), β-catenin (mutated), TGF-βRII (mutated), HPV E6, or E7. In some embodiments, the antibody is ESK1, RL1B, Pr20, or 3.2G1.
BRIEF DESCRIPTION OF THE DRAWINGS
The novel features of the invention are set forth with particularity in the appended claims. A better understanding of the features and advantages of the present invention will be obtained by reference to the following detailed description that sets forth illustrative embodiments, in which the principles of the invention are utilized, and the accompanying drawings of which:
FIG. 1 is an illustration of a SIRP-α construct including a SIRP-α D1 domain or variant thereof joined to a first Fc domain monomer, which forms an Fc domain with a second Fc domain monomer;
FIG. 2 is an illustration of a SIRP-α construct including a SIRP-α D1 domain or variant thereof joined to a first Fc domain monomer and an antibody variable domain joined to a second Fc domain monomer, wherein the first Fc domain monomer and the second Fc domain monomer combine to form an Fc domain;
FIG. 3 is an illustration of a SIRP-α construct including a SIRP-α D1 domain or variant thereof joined to a first Fc domain monomer and a therapeutic protein joined to a second Fc domain monomer, wherein the first Fc domain monomer and the second Fc domain monomer combine to form an Fc domain;
FIG. 4A is an illustration of a SIRP-α construct including a SIRP-α D1 domain or variant thereof joined to a first Fc domain monomer having a knob mutation, which forms an Fc domain with a second Fc domain monomer having a hole mutation; FIG. 4B is an illustration of a SIRP-α construct including a SIRP-α D1 domain or variant thereof joined to a first Fc domain monomer having a hole mutation, which forms an Fc domain with a second Fc domain monomer having a knob mutation;
FIG. 5A is an illustration of a SIRP-α construct including a SIRP-α D1 domain or variant thereof joined to an Fc domain monomer; FIG. 5B is an illustration of a SIRP-α construct which is a homodimer of the construct illustrated in FIG. 5A;
FIG. 6 exemplifies SPR binding data for monofunctional and bifunctional SIRP-α constructs including a SIRP-α D1 domain;
FIG. 7 exemplifies phagocytosis of DLD-1-GFP-Luciferase tumor cells by human monocyte-derived macrophages in the presence of varying concentrations of SIRP-α polypeptide constructs;
FIG. 8 exemplifies phagocytosis of DLD-1-GFP-Luciferase tumor cells by human monocyte-derived macrophages in the presence of varying concentrations of SIRP-α polypeptide constructs;
FIG. 9 exemplifies phagocytosis of DLD-1-GFP-Luciferase tumor cells by human monocyte-derived macrophages in the presence of varying concentrations of SIRP-α polypeptide constructs;
FIG. 10 exemplifies half-life stability of SIRP-α polypeptides over a defined time period;
FIG. 11 exemplifies hemagglutination assay data for SIRP-α polypeptide constructs;
FIG. 12 exemplifies survival curves of mice syngeneic tumor models treated with SIRP-α polypeptide constructs and anti-mPD-L1;
FIG. 13 exemplifies a tumor volume analysis of mice syngeneic tumor models treated with SIRP-α polypeptide constructs in combination with anti-mPD-L1;
FIG. 14 exemplifies binding of various concentrations of C1q complement to SIRP-α-Fc fusions;
FIG. 15 exemplifies phagocytosis of MM1R cells by human monocyte-derived macrophages in the presence of varying concentrations of SIRP-α polypeptide constructs;
FIG. 16 exemplifies phagocytosis of MM1R cells by human monocyte-derived macrophages in the presence of varying concentrations of SIRP-α polypeptide constructs;
FIG. 17 exemplifies phagocytosis of N87 cells by human monocyte-derived macrophages in the presence of varying concentrations of SIRP-α polypeptide constructs;
FIG. 18 exemplifies molecular weight analysis of a SIRP-α D1 variant having a P83V mutation;
FIG. 19A exemplifies tumor growth of human GFP-Luc-Raji lymphoma cells in a NOD scid gamma (NSG) mouse model of cancer treated with various SIRP-α constructs with or without rituximab; FIG. 19B exemplifies a scatter plot of tumor volume of the tumors described in FIG. 19A; FIG. 19C exemplifies hemoglobin values of the treated mice described in FIG. 19A; and
FIG. 20 exemplifies red blood cell counts taken from mice treated with either a SIRP-α wildtype IgG1 Fc construct or a SIRP-α IgG1 Fc variant construct.
DETAILED DESCRIPTION OF THE INVENTION Definitions
The term “about” or “approximately” means within an acceptable error range for the particular value as determined by one of ordinary skill in the art, which will depend in part on how the value is measured or determined, i.e., the limitations of the measurement system. For example, “about” can mean within 1 or more than 1 standard deviation, per the practice in the art. Alternatively, “about” can mean a range of up to 20%, up to 10%, up to 5%, or up to 1% of a given value. Alternatively, particularly with respect to biological systems or processes, the term can mean within an order of magnitude, preferably within 5-fold, and more preferably within 2-fold, of a value. Where particular values are described in the application and claims, unless otherwise stated the term “about” meaning within an acceptable error range for the particular value should be assumed.
The terminology used herein is for the purpose of describing particular cases only and is not intended to be limiting. As used herein, the singular forms “a”, “an” and “the” are intended to include the plural forms as well, unless the context clearly indicates otherwise. Furthermore, to the extent that the terms “including”, “includes”, “having”, “has”, “with”, or variants thereof are used in either the detailed description or the claims, such terms are intended to be inclusive in a manner similar to the term “comprising.”
As used herein, the term “antibody” refers to intact antibodies; antibody fragments, provided that they exhibit the desired biological activity (e.g. epitope binding); monoclonal antibodies; polyclonal antibodies; monospecific antibodies; multi-specific antibodies (e.g., bispecific antibodies); and antibody-like proteins.
As used herein, the term “antibody variable domain” refers to the portions of the light and heavy chains of an antibody that include amino acid sequences of complementary determining regions (CDRs, e.g., CDR L1, CDR L2, CDR L3, CDR H1, CDR H2, and CDR H3) and framework regions (FRs).
As used herein, the term “linker” refers to a linkage between two elements, e.g., protein domains. In some embodiments, a linker can be a covalent bond or a spacer. The term “spacer” refers to a moiety (e.g., a polyethylene glycol (PEG) polymer) or an amino acid sequence (e.g., a 1-200 amino acid sequence) occurring between two polypeptides or polypeptide domains to provide space or flexibility (or both space and flexibility) between the two polypeptides or polypeptide domains. In some embodiments, an amino acid spacer is part of the primary sequence of a polypeptide (e.g., joined to the spaced polypeptides or polypeptide domains via the polypeptide backbone).
As used herein, the term “therapeutically effective amount” refers to an amount of a polypeptide or a pharmaceutical composition containing a polypeptide described herein, e.g., a polypeptide having a SIRP-α D1 domain or variant thereof, that is sufficient and effective in achieving a desired therapeutic effect in treating a patient having a disease, such as a cancer, e.g., solid tumor or hematological cancer. In some embodiments, a therapeutically effective amount of polypeptide will avoid adverse side effects.
As used herein, the term “pharmaceutical composition” refers to a medicinal or pharmaceutical formulation that includes an active ingredient as well as excipients or diluents (or both excipients and diluents) and enables the active ingredient to be administered by suitable methods of administration. In some embodiments, the pharmaceutical compositions disclosed herein include pharmaceutically acceptable components that are compatible with the polypeptide. In some embodiments, the pharmaceutical composition is in tablet or capsule form for oral administration or in aqueous form for intravenous or subcutaneous administration, for example by injection.
As used herein, the terms “subject,” “individual,” and “patient” are used interchangeably to refer to a vertebrate, for example, a mammal. Mammals include, but are not limited to, murines, simians, humans, farm animals, sport animals, and pets. Tissues, cells, and their progeny of a biological entity obtained in vivo or cultured in vitro are also encompassed. None of the terms entail supervision of a medical professional.
As used herein, the term “affinity” or “binding affinity” refers to the strength of the binding interaction between two molecules. Generally, binding affinity refers to the strength of the sum total of non-covalent interactions between a molecule and its binding partner, such as a high affinity SIRP-α D1 variant and CD47. Unless indicated otherwise, binding affinity refers to intrinsic binding affinity, which reflects a 1:1 interaction between members of a binding pair. The binding affinity between two molecules is commonly described by the dissociation constant (KD) or the association constant (KA). Two molecules that have low binding affinity for each other generally bind slowly, tend to dissociate easily, and exhibit a large KD. Two molecules that have high affinity for each other generally bind readily, tend to remain bound longer, and exhibit a small KD. In some embodiments, the KD of two interacting molecules is determined using known methods and techniques, e.g., surface plasmon resonance (SPR). KD can be calculated as the ratio of koff/kon.
As used herein, the term “KD less than” refers to a numerically smaller KD value and an increasing binding affinity relative to the recited KD value. As used herein, the term “KD greater than” refers to a numerically larger KD value and a decreasing binding affinity relative to the recited KD value.
As used herein, the term “acute anemia” refers to a decrease of red blood cell mass or hemoglobin of 30% during the first five days after administration of a compound or treatment.
I. Signal-Regulatory Protein α (SIRP-α) D1 Domain and Variants Thereof
Disclosed herein, in some embodiments, are polypeptides comprising a signal-regulatory protein α (SIRP-α) D1 variant comprising a SIRP-α D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP-α D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP-α D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92.
Also disclosed herein, in some embodiments, are polypeptides comprising an Fc variant, wherein the Fc variant comprises an Fc domain dimer having two Fc domain monomers, wherein each Fc domain monomer independently is selected from (i) a human IgG1 Fc region consisting of mutations L234A, L235A, G237A, and N297A; (ii) a human IgG2 Fc region consisting of mutations A330S, P331S and N297A; or (iii) a human IgG4 Fc region comprising mutations S228P, E233P, F234V, L235A, delG236, and N297A.
Signal-regulatory protein α (“SIRP-α” or “SIRP-alpha”) is a transmembrane glycoprotein belonging to the Ig superfamily that is widely expressed on the membrane of myeloid cells. SIRP-α interacts with CD47, a protein broadly expressed on many cell types in the body. The interaction of SIRP-α with CD47 prevents engulfment of “self” cells, which can otherwise be recognized by the immune system. It has been observed that high CD47 expression on tumor cells can act, in acute myeloid leukemia and several solid tumor cancers, as a negative prognostic factor for survival.
Native SIRP-α comprises 3 highly homologous immunoglobulin (Ig)-like extracellular domains—D1, D2, and D3. The SIRP-α D1 domain (“D1 domain”) refers to the membrane distal, extracellular domain of SIRP-α and mediates binding of SIRP-α to CD47. As used herein, the term “SIRP-α polypeptide” refers to any SIRP-α polypeptide or fragment thereof that is capable of binding to CD47. There are at least ten variants of wild-type human SIRP-α. Table 1 shows the amino acid sequences of the D1 domains of the ten naturally occurring wild-type human SIRP-α D1 domain variants (SEQ ID NOs: 1-10). In some embodiments, a SIRP-α polypeptide comprises a SIRP-α D1 domain. In some embodiments, a SIRP-α polypeptide comprises a wild-type D1 domain, such as those provided in SEQ ID NOs: 1-10. In some embodiments, a SIRP-α polypeptide includes a D2 or D3 domain (or both a D2 and a D3 domain) (Table 3) of a wild-type human SIRP-α.
TABLE 1
Sequences of Wild-Type SIRP-α D1 Domains
SEQ
ID NO: Description Amino Acid Sequence
 1 Wild-type D1 EEELQVIQPDKSVLVAAGETATLRCTATSLIPVGPI
domain variant 1 QWFRGAGPGRELIYNQKEGHFPRVTTVSDLTKRNNM
DFSIRIGNITPADAGTYYCVKFRKGSPDDVEFKSGA
GTELSVRAKPS
 2 Wild-type D1 EEELQVIQPDKSVSVAAGESAILHCTVTSLIPVGPI
domain variant 2 QWFRGAGPARELIYNQKEGHFPRVTTVSESTKRENM
DFSISISNITPADAGTYYCVKFRKGSPDTEFKSGAG
TELSVRAKPS
 3 Wild-type D1 EEELQVIQPDKSVSVAAGESAILLCTVTSLIPVGPI
domain variant 3 QWFRGAGPARELIYNQKEGHFPRVTTVSESTKRENM
DFSISISNITPADAGTYYCVKFRKGSPDTEFKSGAG
TELSVRAKPS
 4 Wild-type D1 EEGLQVIQPDKSVSVAAGESAILHCTATSLIPVGPI
domain variant 4 QWFRGAGPGRELIYNQKEGHFPRVTTVSDLTKRNNM
DFSIRIGNITPADAGTYYCVKFRKGSPDDVEFKSGA
GTELSVRAKPS
 5 Wild-type D1 EEELQVIQPDKFVLVAAGETATLRCTATSLIPVGPI
domain variant 5 QWFRGAGPGRELIYNQKEGHFPRVTTVSDLTKRNNM
DFSIRIGNITPADAGTYYCVKFRKGSPDDVEFKSGA
GTELSVRAKPS
 6 Wild-type D1 EEELQVIQPDKSVLVAAGETATLRCTATSLIPVGPI
domain variant 6 QWFRGAGPGRELIYNQKEGHFPRVTTVSDLTKRNNM
DFPIRIGNITPADAGTYYCVKFRKGSPDDVEFKSGA
GTELSVRAKPS
 7 Wild-type D1 EEELQVIQPDKSVSVAAGESAILHCTVTSLIPVGPI
domain variant 7 QWFRGAGPARELIYNQKEGHFPRVTTVSESTKRENM
DFSISISNITPADAGTYYCVKFRKGSPDTEFKSGAG
TELSVRGKPS
 8 Wild-type D1 EEELQVIQPDKSVLVAAGETATLRCTATSLIPVGPI
domain variant 8 QWFRGAGPARELIYNQKEGHFPRVTTVSESTKRENM
DFSISISNITPADAGTYYCVKFRKGSPDTEFKSGAG
TELSVRAKPS
 9 Wild-type D1 EEELQVIQPDKSVLVAAGETATLRCTATSLIPVGPI
domain variant 9 QWFRGAGPGRELIYNQKEGHFPRVTTVSDLTKRNNM
DFSIRISNITPADAGTYYCVKFRKGSPDDVEFKSGA
GTELSVRAKPS
10 Wild-type D1 EEELQVIQPDKSVSVAAGESAILHCTVTSLIPVGPI
domain variant 10 QWFRGAGPARELIYNQKEGHFPRVTTVSESTKRENM
DFSISISNITPADAGTYYCVKFRKGSPDTEFKSGAG
TELSVRAKPS
11 Wild-type pan-D1 EEX1LQVIQPDKX2VX3VAAGEX4AX5LX6CTX7TSLI
domain PVGPIQWFRGAGPX8RELIYNQKEGHFPRVTTVSX9
X10TKRX11NMDFX12IX13IX14NITPADAGTYYCVKF
RKGSX15X16DX17EFKSGAGTELSVRX18KPS
Amino acid X1 is E or G; X2 is S or F;
substitutions X3 is L or S; X4 is T or S;
relative to X5 is T or 1; X6 is R, H, or L;
SEQ ID NO: 11 X7 is A or V; X8 is G or A;
X9 is D or E; X10 is L or S;
X11 is N or E or D; X12 is S or P;
X13 is R or S; X14 is G or S;
X15 is P or absent; X16 is D or P;
X17 is V or T; and X18 is A or G
As used herein, the terms “high affinity SIRP-α D1 variant,” “high affinity SIRP-α variant,” or “SIRP-α D1 variant” refers to a polypeptide comprising a SIRP-α D1 domain or a CD47-binding portion of a SIRP-α polypeptide that has a higher affinity to CD47 than wild-type SIRP-α. A high affinity SIRP-α D1 variant comprises at least one amino acid substitution, deletion, or insertion (or a combination thereof) relative to a wild-type SIRP-α.
In some embodiments, high affinity SIRP-α D1 variants disclosed herein comprise a SIRP-α D1 domain or variant thereof. In some embodiments, a high affinity SIRP-α D1 variant comprises one or more amino acid substitutions, insertions, additions, or deletions relative to a wild-type D1 domain shown in SEQ ID NOs: 1-10. Table 2 lists exemplary amino acid substitutions in each SIRP-α D1 domain variant (SEQ ID NOs: 13-22). In some embodiments, the SIRP-α D1 domain polypeptide or high affinity SIRP-α D1 variant comprises a fragment of the D1 domain. In some embodiments, the SIRP-α polypeptide fragment or high affinity SIRP-α variant fragment comprises an amino acid sequence of less than 10 amino acids in length, about 10 amino acids in length, about 20 amino acids in length, about 30 amino acids in length, about 40 amino acids in length, about 50 amino acids in length, about 60 amino acids in length, about 70 amino acids in length, about 80 amino acids in length, about 90 amino acids in length, about 100 amino acids in length, or more than about 100 amino acids in length. In some embodiments, the SIRP-α D1 domain fragments retain the ability to bind to CD47.
In some embodiments, a polypeptide of the disclosure comprising a high affinity SIRP-α D1 variant binds with higher binding affinity to CD47 than a wild-type human SIRP-α D1 domain. In some embodiments, the high affinity SIRP-α D1 variant binds to human CD47 with at least 1-fold (e.g., at least 1.5-fold, 2-fold, 2.5-fold, 3-fold, 3.5-fold, 4-fold, 5-fold or greater than 5-fold) affinity than the affinity of a naturally occurring D1 domain. In some embodiments, the high affinity SIRP-α D1 variant binds to human CD47 with at least 1-fold (e.g., at least 10-fold, 100-fold, 1000-fold or greater than 1000-fold) affinity than the affinity of a naturally occurring D1 domain.
As used herein, the term “optimized affinity” or “optimized binding affinity” refers to an optimized strength of the binding interaction between a polypeptide disclosed herein, including a high affinity SIRP-α D1 variant, and CD47. For example, in some embodiments, the polypeptide binds primarily or with higher affinity to CD47 on cancer cells and does not substantially bind or binds with lower affinity to CD47 on non-cancer cells. In some embodiments, the binding affinity between the polypeptide and CD47 is optimized such that the interaction does not cause clinically relevant toxicity or decreases toxicity compared to a variant which binds with maximal affinity. In some embodiments, in order to achieve an optimized binding affinity between a polypeptide provided herein and CD47, the polypeptide including a high affinity SIRP-α D1 variant is developed to have a lower binding affinity to CD47 than which is maximally achievable. In some embodiments, the high affinity SIRP-α variants disclosed herein cross react with rodent, non-human primate (NHP), and human CD47.
As used herein, the term “immunogenicity” refers to the property of a protein (e.g., a therapeutic protein) which causes an immune response in the host as though it is a foreign antigen. The immunogenicity of a protein can be assayed in vitro in a variety of different ways, such as through in vitro T-cell proliferation assays.
As used herein, the term “minimal immunogenicity” refers to an immunogenicity of a protein (e.g., a therapeutic protein) that has been modified, e.g., through amino acid substitutions, to be lower (e.g., at least 10%, 25%, 50%, or 100% lower) than the immunogenicity before the amino acid substitutions are introduced (e.g., an unmodified protein). In some embodiments, a protein (e.g., a therapeutic protein) is modified to have minimal immunogenicity and causes no or very little host immune response even though it is a foreign antigen.
In some embodiments, the high affinity SIRP-α D1 variant has minimal immunogenicity. In some embodiments, a SIRP-α polypeptide of the disclosure administered to a subject has the same amino acid sequence as that of the SIRP-α polypeptide in a biological sample of the subject, except for amino acid changes which increase affinity of the SIRP-α D1 variant. In some embodiments, the polypeptide variants disclosed herein lower the risk of side effects compared to anti-CD47 antibodies or wild-type SIRP-α. In some embodiments, the polypeptide variants disclosed herein lower the risk of anemia compared to anti-CD47 antibodies or wild-type SIRP-α. In some embodiments, the polypeptide variants disclosed herein do not cause acute anemia in rodent or non-human primates (NHP) studies.
Table 2 lists specific amino acid substitutions in a high affinity SIRP-α D1 variant relative to each D1 domain sequence. In some embodiments, a high affinity SIRP-α D1 variant includes one or more (e.g., two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen or more) of the substitutions listed in Table 2. In some embodiments, a high affinity SIRP-α D1 variant includes at most fourteen amino acid substitutions relative to a wild-type D1 domain. In some embodiments, a high affinity SIRP-α D1 variant includes at most ten amino acid substitutions relative to a wild-type D1 domain. In some embodiments, a high affinity SIRP-α D1 variant includes at most seven amino acid substitutions relative to a wild-type D1 domain. In some embodiments, a high affinity SIRP-α D1 variant of the disclosure has at least 90% (e.g., at least 92%, 95%, 97% or greater than 97%) amino acid sequence identity to a sequence of a wild-type D1 domain.
In some embodiments, a high affinity SIRP-α D1 variant is a chimeric high affinity SIRP-α D1 variant that includes a portion of two or more wild-type D1 domains or variants thereof (e.g., a portion of one wild-type D1 domain or variant thereof and a portion of another wild-type D1 domain or variant thereof). In some embodiments, a chimeric high affinity SIRP-α D1 variant includes at least two portions (e.g., three, four, five or more portions) of wild-type D1 domains or variants thereof, wherein each of the portions is from a different wild-type D1 domain. In some embodiments, a chimeric high affinity SIRP-α D1 variant further includes one or more amino acid substitutions listed in Table 2.
TABLE 2
Amino Acid Substitutions in a High Affinity SIRP-α D1 Variant
SEQ
ID NO: Description Amino Acid Sequence
13 D1 domain v1 EEEX1QX2IQPDKSVLVAAGETX3TLRCTX4TSLX5PV
GPIQWFRGAGPGRX6LIYNQX7X8GX9FPRVTTVSDX10
TX11RNNMDFSIRIGNITPADAGTYYCX12KX13RKGS
PDDVEX14KSGAGTELSVRAKPS
Amino acid X1 = L, I, V; X2 = V, L, I; 
substitutions X3 = A, V; X4 = A, I, L;
relative to X5 = I, T, S, F; X6 = E, V, L; 
SEQ ID NO: 13 X7 = K, R; X8 = E, Q;
X9 = H, P, R; X10 = L, T, G;
X11 = K, R; X12 = V, I; 
X13 = F, L, V; X14 = F, V
14 D1 domain v2 EEEX1QX2IQPDKSVSVAAGESX3ILHCTX4TSLX5PVG
PIQWFRGAGPARX6LIYNQX7X8GX9FPRVTTVSEX10T
X11RENMDFSISISNITPADAGTYYCX12KX13RKGSPD
TEX14KSGAGTELSVRAKPS
Amino acid X1 = L, I, V; X2 = V, L, I;
substitutions X3 = A, V; X4 = V, I, L; 
relative to X5 = I, T, S, F; X6 = E, V, L; 
SEQ ID NO: 14 X7 = K, R; X8 = E, Q;
X9 = H, P, R; X10 = S, T, G; 
X11 = K, R; X12 = V, I; 
X13 = F, L, V; X14 = F, V
15 D1 domain v3 EEEX1QX2IQPDKSVSVAAGESX3ILLCTX4TSLX5PVG
PIQWFRGAGPARX6LIYNQX7X8GX9FPRVTTVSEX10T
X11RENMDFSISISNITPADAGTYYCX12KX13RKGSPD
TEX14KSGAGTELSVRAKPS
Amino acid X1 = L, I, V; X2 = V, L, I;
substitutions X3 = A, V; X4 = V, I, L; 
relative to X5 = I, T, S, F; X6 = E, V, L;
SEQ ID NO: 15 X7 = K, R; X8 = E, Q; 
X9 = H, P, R; X10 = S, T, G; 
X11 = K, R; X12 = V, I; 
X13 = F, L, V; X14 = F, V
16 D1 domain v4 EEGX1QX2IQPDKSVSVAAGESX3ILHCTX4TSLX5PVG
PIQWFRGAGPGRX6LIYNQX7X8GX9FPRVTTVSDX10
TX11RNNMDFSIRIGNITPADAGTYYCX12KX13RKGSP
DDVEX14KSGAGTELSVRAKPS
Amino acid X1 = L, I, V; X2 = V, L, I;
substitutions X3 = A, V; X4 = A, I, L; 
relative to X5 = I, T, S, F; X6 = E, V, L; 
SEQ ID NO: 16 X7 = K, R; X8 = E, Q;
X9 = H, P, R; X10 = L, T, G;
X11 = K, R; X12 = V, I;
X13 = F, L, V; X14 = F, V
17 D1 domain v5 EEEX1QX2IQPDKFVLVAAGETX3TLRCTX4TSLX5PV
GPIQWFRGAGPGRX6LIYNQX7X8GX9FPRVTTVSDX10
TX11RNNMDFSIRIGNITPADAGTYYCX12KX13RKGS
PDDVEX14KSGAGTELSVRAKPS
Amino acid X1 = L, I, V; X2 = V, L, I;
substitutions X3 = A, V; X4 = A, I, L;
relative to X5 = I, T, S, F; X6 = E, V, L; 
SEQ ID NO: 17 X7 = K, R; X8 = E, Q; 
X9 = H, P, R; X10 = L, T, G; 
X11 = K, R; X12 = V, I; 
X13 = F, L, V; X14 = F, V
18 D1 domain v6 EEEX1QX2IQPDKSVLVAAGETX3TLRCTX4TSLX5PV
GPIQWFRGAGPGRX6LIYNQX7X8GX9FPRVTTVSDX10
TX11RNNMDFPIRIGNITPADAGTYYCX12KX13RKGS
PDDVEX14KSGAGTELSVRAKPS
Amino acid X1 = L, I, V; X2 = V, L, I;
substitutions X3 = A, V; X4 = A, I, L; 
relative to X5 = I, T, S, F; X6 = E, V, L; 
SEQ ID NO: 18 X7 = K, R; X8 = E, Q; 
X9 = H, P, R; X10 = L, T, G; 
X11 = K, R; X12 = V, I; 
X13 = F, L, V; X14 = F, V
19 D1 domain v7 EEEX1QX2IQPDKSVSVAAGESX3ILHCTX4TSLX5PVG
PIQWFRGAGPARX6LIYNQX7X8GX9FPRVTTVSEX10T
X11RENMDFSISISNITPADAGTYYCX12KX13RKGSPD
TEX14KSGAGTELSVRGKPS
Amino acid X1 = L, I, V; X2 = V, L, I;
substitutions X3 = A, V; X4 = V, I, L; 
relative to X5 = I, T, S, F; X6 = E, V, L; 
SEQ ID NO: 19 X7 = K, R; X8 = E, Q; 
X9 = H, P, R; X10 = S, T, G; 
X11 = K, R; X12 = V, I; 
X13 = F, L, V; X14 = F, V
20 D1 domain v8 EEEX1QX2IQPDKSVLVAAGETX3TLRCTX4TSLX5PV
GPIQWFRGAGPARX6LIYNQX7X8GX9FPRVTTVSEX10
TX11RENMDFSISISNITPADAGTYYCX12KX13RKGSP
DTEX14KSGAGTELSVRAKPS
Amino acid X1 = L, I, V; X2 = V, L, I;
substitutions X3 = A, V; X4 = A, I, L; 
relative to X5 = I, T, S, F; X6 = E, V, L; 
SEQ ID NO: 20 X7 = K, R; X8 = E, Q; 
X9 = H, P, R; X10 = S, T, G; 
X11 = K, R; X12 = V, I; 
X13 = F, L, V; X14 = F, V
21 D1 domain v9 EEEX1QX2IQPDKSVLVAAGETX3TLRCTX4TSLX5PV
GPIQWFRGAGPGRX6LIYNQX7X8GX9FPRVTTVSDX10
TX11RNNMDFSIRISNITPADAGTYYCX12KX13RKGSP
DDVEX14KSGAGTELSVRAKPS
Amino acid X1 = L, I, V; X2 = V, L, I;
substitutions X3 = A, V; X4 = A, I, L; 
relative to X5 = I, T, S, F; X6 = E, V, L; 
SEQ ID NO: 21 X7 = K, R; X8 = E, Q; 
X9 = H, P, R; X10 = L, T, G; 
X11 = K, R; X12 = V, I; 
X13 = F, L, V; X14 = F, V
22 D1 domain v10 EEEX1QX2IQPDKSVSVAAGESX3ILHCTX4TSLX5PVG
PIQWFRGAGPARX6LIYNQX7X8GX9FPRVTTVSEX10T
X11RENMDFSISISNITPADAGTYYCX12KX13RKGSPD
TEX14KSGAGTELSVRAKPS
Amino acid X1 = L, I, V; X2 = V, L, I;
substitutions X3 = A, V; X4 = V, I, L; 
relative to X5 = I, T, S, F; X6 = E, V, L; 
SEQ ID NO: 22 X7 = K, R; X8 = E, Q; 
X9 = H, P, R; X10 = S, T, G; 
X11 = K, R; X12 = V, I; 
X13 = F, L, V; X14 = F, V
23 Pan D1 domain EEX1X2QX3IQPDKX4VX5VAAGEX6X7X8LX9CTX10TS
LX11PVGPIQWFRGAGPX12RX13LIYNQX14X15GX16FP
RVTTVSX17X18TX19RX20NMDFX21IX22IX23NITPADAG
TYYCX24KX25RKGSPDX26X27EX28KSGAGTELSVRX29
KPS
Amino acid X1 = E, G; X2 = L, I, V;  
substitutions X3 = V, L, I; X4 = S, F;
relative to X5 = L, S; X6 = 5, T; 
SEQ ID NO: 23 X7 = A, V; X8 = I, T; 
X9 = H, R; X10 = A, V, I, L; 
X11 = I, T, S, F; X12 = A, G; 
X13 = E, V, L; X14 = K, R; 
X15 = E, Q; X16 = H, P, R; 
X17 = D, E; X18 = S, L, T, G; 
X19 = K, R; X20 = E, D;
X21 = S, P; X22 = S, R; 
X23 = S, G; X24 = V, I;
X25 = F, L, V; X26 = D or absent; 
X27 = T, V; X28 = F, V; 
and X29 = A, G
In some embodiments, a polypeptide includes a SIRP-α D1 variant having a sequence of: EEEX1QX2IQPDKSVLVAAGETX3TLRCTX4TSLX5PVGPIQWFRGAGPGRX6LIYNQX7X8GX9F PRVTTVSDX10TX11RNNMDFSIRIGNITPADAGTYYCX12KX13RKGSPDDVEX14KSGAGTELS VRAKPS (SEQ ID NO: 13), wherein X1 is L, I, or V; X2 is V, L, or, I; X3 is A or V; X4 is A, I, or L; X5 is I, T, S, or F; X6 is E, V, or L; X7 is K or R; X8 is E or Q; X9 is H, P, or R; X10 is L, T, or G; X11 is K or R; X12 is V or I; X13 is F, L, or V; and X14 is F or V; and wherein the variant has at least one amino acid substitution relative to a wild-type SIRP-α D1 domain having the sequence of SEQ ID NO: 1.
In some embodiments, a polypeptide includes a SIRP-α D1 variant having a sequence of: EEGX1QX2IQPDKSVSVAAGESX3ILHCTX4TSLX5PVGPIQWFRGAGPGRX6LIYNQX7X8GX9F PRVTTVSDX10TX11RNNMDFSIRIGNITPADAGTYYCX12KX13RKGSPDDVEX14KSGAGTELS VRAKPS (SEQ ID NO: 16), wherein X1 is L, I, or V; X2 is V, L, or, I; X3 is A or V; X4 is A, I, or L; X5 is I, T, S, or F; X6 is E, V, or L; X7 is K or R; X8 is E or Q; X9 is H, P, or R; X10 is L, T, or G; X11 is K or R; X12 is V or I; X13 is F, L, or V; and X14 is F or V; and wherein the variant has at least one amino acid substitution relative to a wild-type SIRP-α D1 domain having the sequence of SEQ ID NO: 4.
In some embodiments, a polypeptide includes a SIRP-α D1 variant having a sequence of: EEEX1QX2IQPDKFVLVAAGETX3TLRCTX4TSLX5PVGPIQWFRGAGPGRX6LIYNQX7X8GX9F PRVTTVSDX10TX11RNNMDFSIRIGNITPADAGTYYCX12KX13RKGSPDDVEX14KSGAGTELS VRAKPS (SEQ ID NO: 17), wherein X1 is L, I, or V; X2 is V, L, or, I; X3 is A or V; X4 is A, I, or L; X5 is I, T, S, or F; X6 is E, V, or L; X7 is K or R; X8 is E or Q; X9 is H, P, or R; X10 is L, T, or G; X11 is K or R; X12 is V or I; X13 is F, L, or V; and X14 is F or V; and wherein the variant has at least one amino acid substitution relative to a wild-type SIRP-α D1 domain having the sequence of SEQ ID NO: 5.
In some embodiments, a polypeptide includes a SIRP-α D1 variant having a sequence of: EEEX1QX2IQPDKSVLVAAGETX3TLRCTX4TSLX5PVGPIQWFRGAGPGRX6LIYNQX7X8GX9F PRVTTVSDX10TX11RNNMDFPIRIGNITPADAGTYYCX12KX13RKGSPDDVEX14KSGAGTELS VRAKPS (SEQ ID NO: 18), wherein X1 is L, I, or V; X2 is V, L, or, I; X3 is A or V; X4 is A, I, or L; X5 is I, T, S, or F; X6 is E, V, or L; X7 is K or R; X8 is E or Q; X9 is H, P, or R; X10 is L, T, or G; X11 is K or R; X12 is V or I; X13 is F, L, or V; and X14 is F or V; and wherein the variant has at least one amino acid substitution relative to a wild-type SIRP-α D1 domain having the sequence of SEQ ID NO: 6.
In some embodiments, a polypeptide includes a SIRP-α D1 variant having a sequence of: EEEX1QX2IQPDKSVLVAAGETX3TLRCTX4TSLX5PVGPIQWFRGAGPGRX6LIYNQX7X8GX9F PRVTTVSDX10TX11RNNMDFSIRISNITPADAGTYYCX12KX13RKGSPDDVEX14KSGAGTELS VRAKPS (SEQ ID NO: 21), wherein X1 is L, I, or V; X2 is V, L, or, I; X3 is A or V; X4 is A, I, or L; X5 is I, T, S, or F; X6 is E, V, or L; X7 is K or R; X8 is E or Q; X9 is H, P, or R; X10 is L, T, or G; X11 is K or R; X12 is V or I; X13 is F, L, or V; and X14 is F or V; and wherein the variant has at least one amino acid substitution relative to a wild-type SIRP-α D1 domain having the sequence of SEQ ID NO: 9.
In any of the aforementioned embodiments, a polypeptide includes a high affinity SIRP-α D1 variant having a sequence of any one of SEQ ID NOs: 13, 16-18, and 21, wherein X1 is L, I, or V. In any of the aforementioned embodiments, X2 is V, L, or, I. In any of the aforementioned embodiments, X3 is A or V. In any of the aforementioned embodiments, X4 is A, I, or L. In any of the aforementioned embodiments, X5 is I, T, S, or F. In any of the aforementioned embodiments, X6 is E, V, or L. In any of the aforementioned embodiments, X7 is K or R. In any of the aforementioned embodiments, X8 is E or Q. In any of the aforementioned embodiments, X9 is H, P, or R. In any of the aforementioned embodiments, X10 is L, T, or G. In any of the aforementioned embodiments, X11 is K or R. In any of the aforementioned embodiments, X12 is V or I. In any of the aforementioned embodiments, X13 is F, L, V. In any of the aforementioned embodiments, X14 is F or V. In some embodiments, the polypeptide of this aspect of the disclosure includes no more than six amino acid substitutions relative to the wild-type SIRP-α D1 domain having the sequence of any one of SEQ ID NOs: 1, 4-6, and 9.
In some embodiments, the polypeptide binds CD47 with at least 10-fold greater binding affinity than the wild-type SIRP-α D1 domain having the sequence of any one of SEQ ID NOs: 1, 4-6, and 9. In some embodiments, the polypeptide binds CD47 with at least 100-fold greater binding affinity than the wild-type SIRP-α D1 domain having the sequence of any one of SEQ ID NOs: 1, 4-6, and 9. In some embodiments, the polypeptide binds CD47 with at least 1000-fold greater binding affinity than the wild-type SIRP-α D1 domain having the sequence of any one of SEQ ID NOs: 1, 4-6, and 9. In some embodiments, a SIRP-α D1 variant polypeptide or fragment thereof binds to CD47 with a KD less than 1×10−8M, less than 5×10−9 M, less than 1×10−9M, less 5×10−10 M, less than 1×10−10 M or less than 1×10−11M. In some embodiments, a SIRP-α D1 variant polypeptide or fragment thereof binds to CD47 with a KD between about 500 nM and 100 nM, between about 100 nM and 50 nM, between about 50 nM and 10 nM, between about 10 nM and 5 nM, between about 5 nM and 1 nM, between about 1 nM and 500 pM, between about 500 pM and 100 pM, between about 100 pM and 50 pM, or between about 50 pM and 10 pM.
In some embodiments, a polypeptide includes a SIRP-α D1 variant having a sequence of: EEEX1QX2IQPDKSVSVAAGESX3ILHCTX4TSLX5PVGPIQWFRGAGPARX6LIYNQX7X8GX9F PRVTTVSEX10TX11RENMDFSISISNITPADAGTYYCX12KX13RKGSPDTEX14KSGAGTELSVR AKPS (SEQ ID NO: 14), wherein X1 is L, I, or V; X2 is V, L, or, I; X3 is A or V; X4 is V, I, or L; X5 is I, T, S, or F; X6 is E, V, or L; X7 is K or R; X8 is E or Q; X9 is H, P, or R; X10 is S, T, or G; X11 is K or R; X12 is V or I; X13 is F, L, or V; and X14 is F or V; and wherein the variant has at least one amino acid substitution relative to a wild-type SIRP-α D1 domain having the sequence of SEQ ID NO: 2.
In some embodiments, a polypeptide includes a SIRP-α D1 variant having a sequence of: EEEX1QX2IQPDKSVSVAAGESX3ILLCTX4TSLX5PVGPIQWFRGAGPARX6LIYNQX7X8GX9FP RVTTVSEX10TX11RENMDFSISISNITPADAGTYYCX12KX13RKGSPDTEX14KSGAGTELSVRA KPS (SEQ ID NO: 15), wherein X1 is L, I, or V; X2 is V, L, or, I; X3 is A or V; X4 is V, I, or L; X5 is I, T, S, or F; X6 is E, V, or L; X7 is K or R; X8 is E or Q; X9 is H, P, or R; X10 is S, T, or G; X11 is K or R; X12 is V or I; X13 is F, L, or V; and X14 is F or V; and wherein the variant has at least one amino acid substitution relative to a wild-type SIRP-α D1 domain having the sequence of SEQ ID NO: 3.
In some embodiments, a polypeptide includes a SIRP-α D1 variant having a sequence of: EEEX1QX2IQPDKSVSVAAGESX3ILHCTX4TSLX5PVGPIQWFRGAGPARX6LIYNQX7X8GX9F PRVTTVSEX10TX11RENMDFSISISNITPADAGTYYCX12KX13RKGSPDTEX14KSGAGTELSVR GKPS (SEQ ID NO: 19), wherein X1 is L, I, or V; X2 is V, L, or, I; X3 is A or V; X4 is V, I, or L; X5 is I, T, S, or F; X6 is E, V, or L; X7 is K or R; X8 is E or Q; X9 is H, P, or R; X10 is S, T, or G; X11 is K or R; X12 is V or I; X13 is F, L, or V; and X14 is F or V; and wherein the variant has at least one amino acid substitution relative to a wild-type SIRP-α D1 domain having the sequence of SEQ ID NO: 7.
In some embodiments, a polypeptide includes a SIRP-α D1 variant having a sequence of: EEEX1QX2IQPDKSVSVAAGESX3ILHCTX4TSLX5PVGPIQWFRGAGPARX6LIYNQX7X8GX9F PRVTTVSEX10TX11RENMDFSISISNITPADAGTYYCX12KX13RKGSPDTEX14KSGAGTELSVR AKPS (SEQ ID NO: 22), wherein X1 is L, I, or V; X2 is V, L, or, I; X3 is A or V; X4 is V, I, or L; X5 is I, T, S, or F; X6 is E, V, or L; X7 is K or R; X8 is E or Q; X9 is H, P, or R; X10 is S, T, or G; X11 is K or R; X12 is V or I; X13 is F, L, or V; and X14 is F or V; and wherein the variant has at least one amino acid substitution relative to a wild-type SIRP-α D1 domain having the sequence of SEQ ID NO: 10.
In any of the aforementioned embodiments in this aspect of the disclosure, the polypeptide has the sequence of any one of SEQ ID NOs: 14, 15, 19, and 22, wherein X1 is L, I, or V. In any of the aforementioned embodiments, X2 is V, L, or, I. In any of the aforementioned embodiments, X3 is A or V. In any of the aforementioned embodiments, X4 is V, I, or L. In any of the aforementioned embodiments, X5 is I, T, S, or F. In any of the aforementioned embodiments, X6 is E, V, or L. In any of the aforementioned embodiments, X7 is K or R. In any of the aforementioned embodiments, X8 is E or Q. In any of the aforementioned embodiments, X9 is H, P, or R. In any of the aforementioned embodiments, X10 is S, T, or G. In any of the aforementioned embodiments, X11 is K or R. In any of the aforementioned embodiments, X12 is V or I. In any of the aforementioned embodiments, X13 is F, L, or V. In any of the aforementioned embodiments, X14 is F or V. In some embodiments, the polypeptide of this aspect of the disclosure includes no more than six amino acid substitutions relative to the wild-type SIRP-α D1 domain having the sequence of any one of SEQ ID NOs: 2, 3, 7, and 10.
In some embodiments, the polypeptide binds CD47 with at least 10-fold greater binding affinity than the wild-type SIRP-α D1 domain having the sequence of any one of SEQ ID NOs: 2, 3, 7, and 10. In some embodiments, the polypeptide binds CD47 with at least 100-fold greater binding affinity than the wild-type SIRP-α D1 domain having the sequence of any one of SEQ ID NOs: 2, 3, 7, and 10. In some embodiments, the polypeptide binds CD47 with at least 1000-fold greater binding affinity than the wild-type SIRP-α D1 domain having the sequence of any one of SEQ ID NOs: 2, 3, 7, and 10. In some embodiments, a SIRP-α D1 variant polypeptide or fragment thereof binds to CD47 with a KD less than 1×10−8 M, less than 5×10−9 M, less than 1×10−9 M, less 5×10−10 M, less than 1×10−10M or less than 1×10−11M. In some embodiments, a SIRP-α D1 variant polypeptide or fragment thereof binds to CD47 with a KD between about 500 nM and 100 nM, between about 100 nM and 50 nM, between about 50 nM and 10 nM, between about 10 nM and 5 nM, between about 5 nM and 1 nM, between about 1 nM and 500 pM, between about 500 pM and 100 pM, between about 100 pM and 50 pM, or between about 50 pM and 10 pM.
In some embodiments, a polypeptide includes a SIRP-α D1 variant having a sequence of: EEEX1QX2IQPDKSVLVAAGETX3TLRCTX4TSLX5PVGPIQWFRGAGPARX6LIYNQX7X8GX9F PRVTTVSEX10TX11RENMDFSISISNITPADAGTYYCX12KX13RKGSPDTEX14KSGAGTELSVR AKPS (SEQ ID NO: 20), wherein X1 is L, I, or V; X2 is V, L, or, I; X3 is A or V; X4 is A, I, or L; X5 is I, T, S, or F; X6 is E, V, or L; X7 is K or R; X8 is E or Q; X9 is H, P, or R; X10 is S, T, or G; X11 is K or R; X12 is V or I; X13 is F, L, or V; and X14 is F or V; and wherein the variant has at least one amino acid substitution relative to a wild-type SIRP-α D1 domain having the sequence of SEQ ID NO: 8.
In some embodiments, the polypeptide has the sequence of SEQ ID NO: 20, wherein X1 is L, I, or V. In any of the aforementioned embodiments in this aspect of the disclosure, X2 is V, L, or, I. In any of the aforementioned embodiments, X3 is A or V. In any of the aforementioned embodiments, X4 is A, I, or L. In any of the aforementioned embodiments, X5 is I, T, S, or F. In any of the aforementioned embodiments, X6 is E, V, or L. In any of the aforementioned embodiments, X7 is K or R. In any of the aforementioned embodiments, X8 is E or Q. In any of the aforementioned embodiments, X9 is H, P, or R. In any of the aforementioned embodiments, X10 is S, T, or G. In any of the aforementioned embodiments, X11 is K or R. In any of the aforementioned embodiments, X12 is V or I. In any of the aforementioned embodiments, X13 is F, L, or V. In any of the aforementioned embodiments, X14 is F or V. In some embodiments, the polypeptide of this aspect of the disclosure includes no more than six amino acid substitutions relative to the wild-type SIRP-α D1 domain having the sequence of SEQ ID NO: 8.
In some embodiments, the polypeptide binds CD47 with at least 10-fold greater binding affinity than the wild-type SIRP-α D1 domain having the sequence of SEQ ID NO: 8. In some embodiments, the polypeptide binds CD47 with at least 100-fold greater binding affinity than the wild-type SIRP-α D1 domain having the sequence of SEQ ID NO: 8. In some embodiments, the polypeptide binds CD47 with at least 1000-fold greater binding affinity than the wild-type SIRP-α D1 domain having the sequence of SEQ ID NO: 8. In some embodiments, a SIRP-α D1 variant polypeptide or fragment thereof binds to CD47 with a KD less than 1×10−8 M, less than 5×10−9 M, less than 1×10−9 M, less 5×10−10 M, less than 1×10−10 M or less than 1×10−11M. In some embodiments, a SIRP-α D1 variant polypeptide or fragment thereof binds to CD47 with a KD between about 500 nM and 100 nM, between about 100 nM and 50 nM, between about 50 nM and 10 nM, between about 10 nM and 5 nM, between about 5 nM and 1 nM, between about 1 nM and 500 pM, between about 500 pM and 100 pM, between about 100 pM and 50 pM, or between about 50 pM and 10 pM.
In some embodiments, a polypeptide includes a SIRP-α D1 variant having a sequence of: EEX1X2QX3IQPDKX4VX5VAAGEX6X7X8LX9CTX10TSLX11PVGPIQWFRGAGPX12RX13LIYNQ X14X15GX16FPRVTTVSX17X18TX19RX20NMDFX21IX22IX23NITPADAGTYYCX24KX25RKGSPDX26X27EX28KSGAGTELSVRX29KPS (SEQ ID NO: 23), wherein X1 is E or G; X2 is L, I, or V; X3 is V, L, or, I; X4 is S or F; X5 is L or S; X6 is S or T; X7 is A or V; X8 is I or T; X9 is H or R; X10 is A, V, I, or L; X11 is I, T, S, or F; X12 is A or G; X13 is E, V, or L; X14 is K or R; X15 is E or Q; X16 is H, P, or R; X17 is D or E; X18 is S, L, T, or G; X19 is K or R; X20 is E or D; X21 is S or P; X22 is S or R; X23 is S or G; X24 is V or I; X25 is F, L, V; X26 is D or absent; X27 is T or V; X28 is F or V; and X29 is A or G; and wherein the variant has at least one amino acid substitution relative to a wild-type SIRP-α D1 domain having the sequence of any one of SEQ ID NOs: 1-10.
In any of the aforementioned embodiments in this aspect of the disclosure, X2 is L, I, or V. In any of the aforementioned embodiments, X3 is V, L, or, I. In any of the aforementioned embodiments, X4 is S or F. In any of the aforementioned embodiments, X5 is L or S. In any of the aforementioned embodiments, X6 is S or T. In any of the aforementioned embodiments, X7 is A or V. In any of the aforementioned embodiments, X8 is I or T. In any of the aforementioned embodiments, X9 is H or R. In any of the aforementioned embodiments, X10 is A, V, I, or L. In any of the aforementioned embodiments, X11 is I, T, S, or F. In any of the aforementioned embodiments, X12 is A or G. In any of the aforementioned embodiments, X13 is E, V, or L. In any of the aforementioned embodiments, X14 is K or R. In any of the aforementioned embodiments, X15 is E or Q. In any of the aforementioned embodiments, X16 is H, P, or R. In any of the aforementioned embodiments, X17 is D or E. In any of the aforementioned embodiments, X18 is S, L, T, or G. In any of the aforementioned embodiments, X19 is K or R. In any of the aforementioned embodiments, X20 is E or D. In any of the aforementioned embodiments, X21 is S or P. In any of the aforementioned embodiments, X22 is S or R. In any of the aforementioned embodiments, X23 is S or G. In any of the aforementioned embodiments, X24 is V or I. In any of the aforementioned embodiments, X25 is F, L, V. In any of the aforementioned embodiments, X26 is D or absent. In any of the aforementioned embodiments, X27 is T or V. In any of the aforementioned embodiments, X28 is F or V. In any of the aforementioned embodiments, X29 is A or G. In some embodiments, the polypeptide of this aspect of the disclosure includes no more than six amino acid substitutions relative to the wild-type SIRP-α D1 domain having the sequence of any one of SEQ ID NOs: 1-10.
In some embodiments, the polypeptide binds CD47 with at least 10-fold greater binding affinity than the wild-type SIRP-α D1 domain having the sequence of any one of SEQ ID NOs: 1-10. In some embodiments, the polypeptide binds CD47 with at least 100-fold greater binding affinity than the wild-type SIRP-α D1 domain having the sequence of any one of SEQ ID NOs: 1-10. In some embodiments, the polypeptide binds CD47 with at least 1000-fold greater binding affinity than the wild-type SIRP-α D1 domain having the sequence of any one of SEQ ID NOs: 1-10. In some embodiments, a SIRP-α D1 variant polypeptide or fragment thereof binds to CD47 with a KD less than 1×10−8 M, less than 5×10−9 M, less than 1×10−9 M, less 5×10−10 M, less than 1×10−10 M or less than 1×10−11 M. In some embodiments, a SIRP-α D1 variant polypeptide or fragment thereof binds to CD47 with a KD between about 500 nM and 100 nM, between about 100 nM and 50 nM, between about 50 nM and 10 nM, between about 10 nM and 5 nM, between about 5 nM and 1 nM, between about 1 nM and 500 pM, between about 500 pM and 100 pM, between about 100 pM and 50 pM, or between about 50 pM and 10 pM.
In some embodiments, a polypeptide of the disclosure including a high affinity SIRP-α D1 variant further comprises a D2 domain having the sequence of SEQ ID NO: 24, a D3 domain having the sequence of SEQ ID NO: 25, or a D2 domain having the sequence of SEQ ID NO: 24 and a D3 domain having the sequence of SEQ ID NO: 25 of a wild-type human SIRP-α as shown in Table 3. In some embodiments, the high affinity SIRP-α D1 variant further comprises a fragment or variant of a D2 domain or a fragment or variant of a D3 domain. In some embodiments, the high affinity SIRP-α D1 variant further comprises a fragment or variant of a D2 domain and a fragment or variant of a D3 domain. In some embodiments, a high affinity SIRP-α D1 variant is joined to a D2 or D3 domain by way of a linker. In some embodiments, a high affinity SIRP-α D1 variant is joined to a D2 and D3 domain by way of a linker.
TABLE 3
Amino Acid Sequences of
SIRP-α D2 and D3 Domains
SEQ
ID NO: Description Amino Acid Sequence
24 SIRP-α D2 APVVSGPAARATPQHTVSFTCESH
domain GFSPRDITLKWFKNGNELSDFQTN
VDPVGESVSYSIHSTAKVVLTRED
VHSQVICEVAHVTLQGDPLRGTAN
LSETIR
25 SIRP-α D3 VPPTLEVTQQPVRAENQVNVTCQV
domain RKFYPQRLQLTWLENGNVSRTETA
STVTENKDGTYNWMSWLLVNVSAH
RDDVKLTCQVEHDGQPAVSKSHDL
KVS
In some embodiments, a polypeptide of the disclosure including a high affinity SIRP-α D1 variant is attached to an Fc domain monomer, a human serum albumin (HSA) or variant thereof, a serum-binding protein or peptide, or an organic molecule, e.g., a polymer (e.g., a PEG polymer), in order to improve the pharmacokinetic properties of the polypeptide, e.g., increase serum half-life. In some embodiments, a high affinity SIRP-α D1 variant is attached to an Fc domain monomer that is unable to dimerize. In some embodiments, Fc domain monomers, HSA proteins, serum-binding proteins or peptides, and organic molecules such as a PEG serve to increase the serum half-life of the polypeptides described herein. In some embodiments, a polypeptide of the disclosure including a high affinity SIRP-α D1 variant does not include the sequence of any one of SEQ ID NOs: 26-36 shown in Table 4.
TABLE 4
SEQ
ID NO: Amino Acid Sequence
26 EEELQVIQPDKSVSVAAGESAILHCTITSLIPVGPIQWFR
GAGPARELIYNQREGHFPRVTTVSETTRRENMDFSISISN
ITPADAGTYYCVKFRKGSPDTEVKSGAGTELSVRAKPS
27 EEEVQVIQPDKSVSVAAGESAILHCTLTSLIPVGPIQWFR
GAGPARVLIYNQRQGHFPRVTTVSEGTRRENMDFSISISN
ITPADAGTYYCIKFRKGSPDTEFKSGAGTELSVRAKPS
28 EEEVQIIQPDKSVSVAAGESVILHCTITSLTPVGPIQWFR
GAGPARLLIYNQREGPFPRVTTVSETTRRENMDFSISISN
ITPADAGTYYCVKLRKGSPDTEFKSGAGTELSVRAKPS
29 EEELQIIQPDKSVSVAAGESAILHCTITSLSPVGPIQWFR
GAGPARVLIYNQRQGPFPRVTTVSEGTKRENMDFSISISN
ITPADAGTYYCIKLRKGSPDTEFKSGAGTELSVRAKPS
30 EEEIQVIQPDKSVSVAAGESVIIHCTVTSLFPVGPIQWFR
GAGPARVLIYNQRQGRFPRVTTVSEGTKRENMDFSISISN
ITPADAGTYYCVKVRKGSPDTEVKSGAGTELSVRAKPS
31 EEEVQIIQPDKSVSVAAGESIILHCTVTSLFPVGPIQWFR
GAGPARVLIYNQREGRFPRVTTVSEGTRRENMDFSISISN
ITPADAGTYYCIKLRKGSPDTEFKSGAGTELSVRAKPS
32 EEEVQLIQPDKSVSVAAGESAILHCTVTSLFPVGPIQWFR
GAGPARVLIYNQREGPFPRVTTVSEGTKRENMDFSISISN
ITPADAGTYYCIKFRKGSPDTEVKSGAGTELSVRAKPS
33 EEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQWFR
GAGPGRVLIYNQRQGPFPRVTTVSDTTKRNNMDFSIRIGN
ITPADAGTYYCIKFRKGSPDDVEFKSGAGTELSVRAKPS
34 EEELQIIQPDKSVSVAAGESAILHCTITSLFPVGPIQWFR
GAGPARLLIYNQRQGPFPRVTTVSETTKRENMDFSISISN
ITPADAGTYYCVKFRKGSPDTEFKSGAGTELSVRAKPS
35 EEEVQIIQPDKSVSVAAGESAILHCTITSLFPVGPIQWFR
GAGPARVLIYNQKQGPFPRVTTISETTRRENMDFSISISN
ITPADAGTYYCIKFRKGSPDTEFKSGAGTELSVRAKPS
36 EEELQIIQPDKSVSVAAGESAILHCTITSLTPVGPIQWFR
GAGPARVLIYNQRQGPFPRVTTVSEGTRRENMDFSISISN
ITPADAGTYYCIKFRKGSPDTEVKSGAGTELSVRAKPS
In some embodiments, the polypeptides and polypeptide constructs described herein are utilized in vitro for binding assays, such as immune assays. For example, in some embodiments, the polypeptides and polypeptide constructs described herein are utilized in liquid phase or bound to a solid phase carrier. In some embodiments, polypeptides utilized for immunoassays are detectably labeled in various ways.
In some embodiments, polypeptides and polypeptide constructs described herein are bound to various carriers and used to detect the presence of specific antigen expressing cells. Examples of carriers include glass, polystyrene, polypropylene, polyethylene, dextran, nylon, amylases, natural and modified celluloses, polyacrylamides, agaroses, and magnetite. The nature of the carrier can be either soluble or insoluble.
Various different labels and methods of labeling are known. Examples of labels include enzymes, radioisotopes, fluorescent compounds, colloidal metals, chemiluminescent compounds, and bio-luminescent compounds. Various techniques for binding labels to polypeptides disclosed herein are available.
In some embodiments, the polypeptides are coupled to low molecular weight haptens. These haptens are then specifically detected by means of a second reaction. For example, in some embodiments, the hapten biotin is used with avidin or the haptens dinitrophenol, pyridoxal, or fluorescein are detected with specific anti-hapten antibodies (e.g., anti-dinitrophenol antibodies, anti-pyridoxal antibodies, and anti-fluorescein antibodies respectively).
II. High Affinity SIRP-α D1 Domains with Altered Glycosylation
Disclosed herein, in some embodiments, are polypeptides comprising a signal-regulatory protein α (SIRP-α) D1 variant comprising a SIRP-α D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP-α D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP-α D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92.
Also disclosed herein, in some embodiments, are polypeptides comprising an Fc variant, wherein the Fc variant comprises an Fc domain dimer having two Fc domain monomers, wherein each Fc domain monomer independently is selected from (i) a human IgG1 Fc region consisting of mutations L234A, L235A, G237A, and N297A; (ii) a human IgG2 Fc region consisting of mutations A330S, P331S and N297A; or (iii) a human IgG4 Fc region comprising mutations S228P, E233P, F234V, L235A, delG236, and N297A.
In some embodiments, a polypeptide in a composition disclosed herein comprises a high affinity SIRP-α D1 variant that has reduced or minimal glycosylation. The D1 domain of each of the ten wild-type human SIRP-α proteins (SEQ ID NOs: 1-10 in Table 1) contains a single potential N-linked glycosylation site at amino acid N80 in the sequence N80ITP. Expression of a SIRP-α D1 domain in Chinese Hamster Ovary (CHO) cells results in a major band of 16 kDa (non-glycosylated) and a minor band of higher molecular weight that was removed by Endo Hf. Endo Hf is a recombinant protein fusion of Endoglycosidase H and maltose binding protein. Endo Hf cleaves within the chitobiose core of high mannose and some hybrid oligosaccharides from N-linked glycoproteins. This implies that a proline at amino acid position 83 can reduce the efficiency of glycosylation, leading to a protein with different degrees of glycosylation and therefore heterogeneity. For drug development, heterogeneity can give rise to challenges in process development. Therefore, to investigate the possibility of generating homogenous, non-glycosylated forms of high affinity SIPR-α D1 variants, in some embodiments, amino acid N80 of a SIPR-α D1 variant is mutated to Ala. In some embodiments, to make a non-glycosylated, high affinity SIRP-α D1 variant, amino acid N80 in a high affinity SIRP-α D1 variant is replaced by any amino acid, including any naturally and non-naturally occurring amino acid, e.g., N80A and N80Q. In some embodiments, a high affinity SIRP-α D1 variant comprises an N80A mutation and at least 1 additional mutation (e.g., at least 2, 3, 4, 5, 6, 7, 8, 9, or 10 additional mutations or more). In some embodiments, the additional mutation is in the CD47 binding site. In some embodiments, the additional mutation is in the hydrophobic core of the D1 domain.
In some embodiments, a polypeptide in a composition disclosed herein includes a high affinity SIRP-α D1 variant that has increased glycosylation relative to a wild-type SIRP-α D1 domain. Another option to increase homogeneity of the final product is to enhance the efficiency of glycosylation at amino acid N80 and generate high affinity SIRP-α D1 variants with increased glycosylation relative to a wild-type. In some embodiments, the amino acid P83 in the sequence NITP83 affects the degree of glycosylation at amino acid N80. In some embodiments, changing P83 to any amino acid increases the efficiency of glycosylation at N80. In some embodiments, amino acid P83 in a high affinity SIRP-α D1 variant is replaced by any amino acid, including naturally and non-naturally amino acids, e.g., P83V, P83A, P83I, and P83L. In some embodiments, a polypeptide of the disclosure is expressed in a cell that is optimized not to glycosylate proteins that are expressed by such cell, for example by genetic engineering of the cell line (e.g., genetically engineered yeast or mammalian host) or modifications of cell culture conditions such as addition of kifunensine or by using a naturally non-glycosylating host such as a prokaryote (E. coli, etc.).
Table 5 lists specific amino acid substitutions in a high affinity SIRP-α D1 variant relative to each D1 domain variant sequence. In some embodiments, a high affinity SIRP-α D1 variant includes one or more (e.g., two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen or more) of the substitutions listed in Table 5. In some embodiments, the SIRP-α D1 variants are not glycosylated or are minimally glycosylated. In some embodiments, the SIRP-α D1 variants are fully glycosylated or almost fully glycosylated. In some embodiments, a high affinity SIRP-α D1 variant includes at most fourteen amino acid substitutions relative to a wild-type D1 domain. In some embodiments, a high affinity SIRP-α D1 variant includes at most ten amino acid substitutions relative to a wild-type D1 domain. In some embodiments, a high affinity SIRP-α D1 variant includes at most seven amino acid substitutions relative to a wild-type D1 domain. In some embodiments, a high affinity SIRP-α D1 variant of the disclosure has at least 90% (e.g., at least 92%, 95%, 97% or greater than 97%) amino acid sequence identity to a sequence of a wild-type D1 domain.
In some embodiments, a high affinity SIRP-α D1 variant is a chimeric high affinity SIRP-α D1 variant that includes a portion of two or more wild-type D1 domains or variants thereof (e.g., a portion of one wild-type D1 domain or variant thereof and a portion of another wild-type D1 domain or variant thereof). In some embodiments, a chimeric high affinity SIRP-α D1 variant includes at least two portions (e.g., three, four, five or more portions) of wild-type D1 domains or variants thereof, wherein each of the portions is from a different wild-type D1 domain. In some embodiments, a chimeric high affinity SIRP-α D1 variant further includes one or more amino acid substitutions listed in Table 5.
TABLE 5
Amino Acid Substitutions
in a High Affinity SIRP-α D1 Variant
SEQ
ID NO: Description Amino Acid Sequence
 37 D1 domain v1 EEEX1QX2IQPDKSVLVAAGETX3TLRCTX4TSLX5PV 
GPIQWFRGAGPGRX6LIYNQX7TX8GX9FPRVTTVSDX10
TX11RNNMDFSIRIGX12ITX13ADAGTYYCX14KX15RK 
GSPDDVEX16KSGAGTELSVRAKPS
Amino acid X1 = L, I, V; X2 = V, L, I; 
substitutions X3 = A, V; X4 = A, I, L; 
relative to X5 = I, T, S, F; X6 = E, V, L; 
SEQ ID NO: 37 X7 = K, R; X8 = E, Q; 
X9 = H, P, R; X10 = L, T, G; 
X11 = K, R; X12 = N, A, C, D, E, F, 
G, H, I, K, L, M, P, Q, R, S, T, V, 
W, Y; X13 = P, A, C, D, E, F, G, H, 
I, K, L, M, N, Q, R, S, T, V, W, Y; 
X14 = V, I; X15 = F, L, V; 
X16 = F, V
 38 D1 domain v2 EEEX1QX2IQPDKSVSVAAGESX3ILHCTX4TSLX5PVG 
PIQWFRGAGPARX6LIYNQX7X8GX9FPRVTTVSEX10T 
X11RENMDFSISISX12ITX13ADAGTYYCX14KX15RKGS 
PDTEX16KSGAGTELSVRAKPS
Amino acid X1 = L, I, V; X2 = V, L, I; 
substitutions X3 = A, V; X4 = V, I, L; 
relative to X5 = I, T, S, F; X6 = E, V, L; 
SEQ ID NO: 38 X7 = K, R; X8 = E, Q; 
X9 = H, P, R; X10 = S, T, G; 
X11 = K, R; X12 = N, A, C, D, E, F, G, 
H, I, K, L, M, P, Q, R, S, T, V, W, 
Y; X13 = P, A, C, D, E, F, G, H, I, 
K, L, M, N, Q, R, S, T, V, W, Y; 
X14 = V, I; X15 = F, L, V; X16 = F, V
 39 D1 domain v3 EEEX1QX2IQPDKSVSVAAGESX3ILLCTX4TSLX5PVG 
PIQWFRGAGPARX6LIYNQX7X8GX9FPRVTTVSEX10T 
X11RENMDFSISISX12ITX13ADAGTYYCX14KX15RKGS 
PDTEX16KSGAGTELSVRAKPS
Amino acid X1 = L, I, V; X2 = V, L, I; 
substitutions X3 = A, V; X4 = V, I, L; 
relative to X5 = I, T, S, F; X6 = E, V, L; 
SEQ ID NO: 39 X7 = K, R; X8 = E, Q; 
X9 = H, P, R; X10 = S, T, G; 
X11 = K, R; X12 = N, A, C, D, E, F, G,
H, I, K, L, M, P, Q, R, S, T, V, W, Y; 
X13 = P, A, C, D, E, F, G, H, I, K, L, 
M, N, Q, R, S, T, V, W, Y; 
X14 = V, I; X15 = F, L, V; X16 = F, V
 40 D1 domain v4 EEGX1QX2IQPDKSVSVAAGESX3ILHCTX4TSLX5PVG 
PIQWFRGAGPGRX6LIYNQX7X8GX9FPRVTTVSDX10
TX11RNNMDFSIRIGX12ITX13ADAGTYYCX14KX15RKGS
PDDVEX16KSGAGTELSVRAKPS
Amino acid X1 = L, I, V; X2 = V, L, I; 
substitutions X3 = A, V; X4 = A, I, L; 
relative to X5 = I, T, S, F; X6 = E, V, L; 
SEQ ID NO: 40 X7 = K, R; X8 = E, Q; X9 = H, P, R; 
X10 = L, T, G; X11 = K, R; 
X12 = N, A, C, D, E, F, G, H, I, 
K, L, M, P, Q, R, S, T, V, W, Y; 
X13 = P, A, C, D, E, F, G, H, I, 
K, L, M, N, Q, R, S, T, V, W, Y; 
X14 = V, I; X15 = F, L, V; X16 = F, V
 41 D1 domain v5 EEEX1QX2IQPDKFVLVAAGETX3TLRCTX4TSLX5PV 
GPIQWFRGAGPGRX6LIYNQX7X8GX9FPRVTTVSDX10
TX11RNNMDFSIRIGX12ITX13ADAGTYYCX14KX15RK 
GSPDDVEX16KSGAGTELSVRAKPS
Amino acid X1 = L, I, V; X2 = V, L, I; X3 = A, V; 
substitutions X4 = A, I, L; X5 = I, T, S, F; 
relative to X6 = E, V, L; X7 = K, R; X8 = E, Q; 
SEQ ID NO: 41 X9 = H, P, R; X10 = L, T, G; 
X11 = K, R; X12 = N, A, C, D, E, F, 
G, H, I, K, L, M, P, Q, R, S, 
T, V, W, Y; X13 = P, A, C, D, E, 
F, G, H, I, K, L, M, N, Q, R, S, 
T, V, W, Y; X14 = V, I; 
X15 = F, L, V; X16 = F, V
 42 D1 domain v6 EEEX1QX2IQPDKSVLVAAGETX3TLRCTX4TSLX5PV 
GPIQWFRGAGPGRX6LIYNQX7X8GX9FPRVTTVSDX10
TX11RNNMDFPIRIGX12ITX13ADAGTYYCX14KX15RK 
GSPDDVEX16KSGAGTELSVRAKPS
Amino acid X1 = L, I, V; X2 = V, L, I; X3 = A, V; 
substitutions X4 = A, I, L; X5 = I, T, S, F; 
relative to X6 = E, V, L; X7 = K, R; X8 = E, Q; 
SEQ ID NO: 42 X9 = H, P, R; X10 = L, T, G; X11 = K, R; 
X12 = N, A, C, D, E, F, G, H, I, K, 
L, M, P, Q, R, S, T, V, W, Y; 
X13 = P, A, C, D, E, F, G, H, I, K, 
L, M, N, Q, R, S, T, V, W, Y; 
X14 = V, I; X15 = F, L, V; X16 = F, V
 43 D1 domain v7 EEEX1QX2IQPDKSVSVAAGESX3ILHCTX4TSLX5PVG 
PIQWFRGAGPARX6LIYNQX7X8GX9FPRVTTVSEX10T 
X11RENMDFSISISX12ITX13ADAGTYYCX14KX15RKGS 
PDTEX16KSGAGTELSVRGKPS
Amino acid X1 = L, I, V; X2 = V, L, I; X3 = A, V; 
substitutions X4 = V, I, L; X5 = I, T, S, F; 
relative to X6 = E, V, L; X7 = K, R; X8 = E, Q; 
SEQ ID NO: 43 X9 = H, P, R; X10 = S, T, G; X11 = K, R; 
X12 = N, A, C, D, E, F, G, H, I, K, 
L, M, P, Q, R, S, T, V, W, Y; 
X13 = P, A, C, D, E, F, G, H, I, K, 
L, M, N, Q, R, S, T, V, W, Y; 
X14 = V, I; X15 = F, L, V; X16 = F, V
 44 D1 domain v8 EEEX1QX2IQPDKSVLVAAGETX3TLRCTX4TSLX5PV 
GPIQWFRGAGPARX6LIYNQX7X8GX9FPRVTTVSEX10
TX11RENMDFSISISX12ITX13ADAGTYYCX14KX15RK 
GSPDTEX16KSGAGTELSVRAKPS
Amino acid X1 = L, I, V; X2 = V, L, I; X3 = A, V; 
substitutions X4 = A, I, L; X5 = I, T, S, F; 
relative to X6 = E, V, L; X7 = K, R; X8 = E, Q; 
SEQ ID NO: 44 X9 = H, P, R; X10 = S, T, G; X11 = K, R; 
X12 = N, A, C, D, E, F, G, H, I, K, L, 
M, P, Q, R, S, T, V, W, Y; 
X13 = P, A, C, D, E, F, G, H, I, K, L, 
M, N, Q, R, S, T, V, W, Y; 
X14 = V, I; X15 = F, L, V; X16 = F, V
 45 D1 domain v9 EEEX1QX2IQPDKSVLVAAGETX3TLRCTX4TSLX5PV 
GPIQWFRGAGPGRX6LIYNQX7X8GX9FPRVTTVSDX10
TX11RNNMDFSIRISX12ITX13ADAGTYYCX14KX15RK 
GSPDDVEX16KSGAGTELSVRAKPS
Amino acid X1 = L, I, V; X2 = V, L, I; X3 = A, V; 
substitutions X4 = A, I, L; X5 = I, T, S, F; 
relative to X6 = E, V, L; X7 = K, R; X8 = E, Q; 
SEQ ID NO: 45 X9 = H, P, R; X10 = L, T, G; X11 = K, R; 
X12 = N, A, C, D, E, F, G, H, I, K, L,
M, P, Q, R, S, T, V, W, Y; 
X13 = P, A, C, D, E, F, G, H, I, K, L, 
M, N, Q, R, S, T, V, W, Y; 
X14 = V, I; X15 = F, L, V; X16 = F, V
 46 D1 domain v10 EEEX1QX2IQPDKSVSVAAGESX3ILHCTX4TSLX5PVG 
PIQWFRGAGPARX6LIYNQX7X8GX9FPRVTTVSEX10T 
X11RENMDFSISISX12ITX13ADAGTYYCX14KX15RKGS 
PDTEX16KSGAGTELSVRAKPS
Amino acid X1 = L, I, V; X2 = V, L, I; X3 = A, V; 
substitutions X4 = V, I, L; X5 = I, T, S, F; 
relative to X6 = E, V, L; X7 = K, R; X8 = E, Q; 
SEQ ID NO: 46 X9 = H, P, R; X10 = S, T, G; X11 = K, R; 
X12 = N, A, C, D, E, F, G, H, I, K, L, 
M, P, Q, R, S, T, V, W, Y; 
X13 = P, A, C, D, E, F, G, H, I, K, L, 
M, N, Q, R, S, T, V, W, Y; 
X14 = V, I; X15 = F, L, V; X16 = F, V
 47 Pan D1 domain EEX1X2QX3IQPDKX4VX5VAAGEX6X7X8LX9CTX10TS 
LX11PVGPIQWFRGAGPX12RX13LIYNQX14X15GX16FP 
RVTTVSX17X18TX19RX20NMDFX21IX22IX23X24ITX25AD 
AGTYYCX26KX27RKGSPDX28X29EX30KSGAGTELSVR 
X31KPS
Amino acid X1 = E, G; X2 = L, I, V; X3 = V, L, I; 
substitutions X4 = S, F; X5 = L, S; X6 = S, T; X7 = A, V; 
relative to X8 = I, T; X9 = H, R, L; X10 = A, V, I, L; 
SEQ ID NO: 47 X11 = I, T, S, F; X12 = A, G; X13 = E, V, L; 
X14 = K, R; X15 = E, Q; X16 = H, P, R; 
X17 = D, E; X18 = S, L, T, G; X19 = K, R; 
X20 = E, N; X21 = S, P; X22 = S, R; 
X23 = S, G; X24 = any amino acid; 
X25 = any amino acid; X26 = V, I; 
X27 = F, L, V; X28 = D or absent; 
X29 = T, V; X30 = F, V; and X31 = A, G
 48 Pan D1 domain EEELQX1IQPDKSVX2VAAGEX3AX4LX5CTX6TSLX7P 
VGPIQWFRGAGPX8RX9LIYNQX10X11GX12FPRVTTV 
SX13X14TKRX15NMDFSIX16IX17X18ITPADAGTYYCX19
KFRKGX20X21X22DX23EFKSGAGTELSVRAKPS
Amino acid X1 = V, I; X2 = L, S; X3 = T, S; 
substitutions X4 = T, I; X5 = R, H; X6 = A, V, I; 
relative to X7 = I, R, Y, K, F; X8 = G, A; 
SEQ ID NO: 48 X9 = E, V; X10 = K, R; X11 = E, D, Q; 
X12 = H, P; X13 = D, E; X14 = S, L, T; 
X15 = N, E; X16 = R, S; X17 = G, S; 
X18 = N, A; X19 = V, I; 
X20 = S, I, M; X21 = P or absent; 
X22 = D, P; and X23 = V, T
 49 Pan D1 domain EEELQX1IQPDKSVLVAAGETATLRCTX2TSLX3PVGP 
IQWFRGAGPGRX4LIYNQX5X6GX7FPRVTTVSDX8TK 
RNNMDFSIRIGX9ITPADAGTYYCX10KFRKGSPDDV 
EFKSGAGTELSVRAKPS
Amino acid X1 = V, I, L; X2 = A, I, V, L; 
substitutions X3 = I, F, S, T; X4 = E, V, L; 
relative to X5 = K, R; X6 = E, Q; X7 = H, P, R; 
SEQ ID NO: 49 X8 = L, T, S, G; X9 =  A; and 
X10 = V, I
 50 Pan D1 domain EEELQX1IQPDKSVSVAAGESAILHCTX2TSLX3PVGPI 
QWFRGAGPARX4LIYNQX5X6GX7FPRVTTVSEX8TK 
RENMDFSISISX9ITPADAGTYYCX10KFRKGSPDTEF 
KSGAGTELSVRAKPS
Amino acid X1 = V, I; X2 = V, I; X3 = I, F; 
substitutions X4 = E, V; X5 = K, R; X6 = E, Q; 
relative to X7 = H, P; X8 = S, T; X9 = N, A; 
SEQ ID NO: 50 and X10 = V, I
 51 Pan D1 domain EEELQX1IQPDKSVLVAAGETATLRCTX2TSLX3PVGP 
IQWFRGAGPGRX4LIYNQX5EGX6FPRVTTVSDX7TK 
RNNMDFSIRIGX8ITPADAGTYYCX9KFRKGSPDDVE 
FKSGAGTELSVRAKPS
Amino acid X1 = V, I; X2 = A, I; X3 = I, F; 
substitutions X4 = E, V; X5 = K, R; X6 = H, P; 
relative to X7 = L, T; X8 = N, A; and 
SEQ ID NO: 51 X9 = V, I
 52 Pan D1 domain EEELQX1IQPDKSVLVAAGETATLRCTX2TSLX3PVGP 
IQWFRGAGPGRELIYNQX4EGX5FPRVTTVSDX6TKR 
NNMDFSIRIGX7ITPADAGTYYCVKFRKGSPDDVEF 
KSGAGTELSVRAKPS
Amino acid X1 = V, L, I; X2 = A, I, L; 
substitutions X3 = I, T, S, F; X4 = K, R; 
relative to X5 = H, P, R; X6 = L, T, G; 
SEQ ID NO: 52 and X7 = N, A
212 Pan D1 domain EEELQX1IQPDKSVSVAAGESAILHCTX2TSLX3PVGPI 
QWFRGAGPARELIYNQX4EGX5FPRVTTVSEX6TKRE 
NMDFSISISX7ITPADAGTYYCVKFRKGSPDTEFKSG 
AGTELSVRAKPS
Amino acid X1 = V, L, I; X2 = V, I, L; 
substitutions X3 = I, T, S, F; X4 = K, R; 
relative to X5 = H, P, R; X6 = S, T, G; 
SEQ ID NO: 212 and X7 = N, A
217 Pan D1 domain EEELQX1IQPDKSVLVAAGETATLRCTX2TSLX3PVGP 
IQWFRGAGPGRX4LIYNQX5X6GX7FPRVTTVSDX8TK 
RNNMDFSIRIGX9X10X11X12ADAGTYYCX13KFRKGSP 
DDVEFKSGAGTELSVRAKPS
Amino acid X1 = V, L, or I; X2 = A, V, L, or I; 
substitutions X3 = I, S, T, or F; X4 = E, L, or V; 
relative to X5 = K or R; X6 = E or Q; X7 = H, R or P; 
SEQ ID NO: 217 X8 = S, G, L or T, X9 = any amino acid; 
X10 = any amino acid; X11 = any amino acid; 
X12 = any amino acid; and X13 = V or I
218 Pan D1 domain EEELQX1IQPDKSVLVAAGETATLRCTX2TSLX3PVGP 
IQWFRGAGPGRX4LIYNQX5X6GX7FPRVTTVSDX8TK 
RNNMDFSIRIGX9ITX10ADAGTYYCX11KFRKGSPDD 
VEFKSGAGTELSVRAKPS
Amino acid X1 = V, L or I; X2 = A, V, L, or I; 
substitutions X3 = I, S, T or F; X4 = E, L, or V; 
relative to X5 = K or R; X6 = E or Q; X7 = H, R or P; 
SEQ ID NO: 218 X8 = S, G, L, or T; X9 = N; 
X10 = any amino acid other than P; 
and X11 = V or I
In some embodiments, a polypeptide includes a SIRP-α D1 variant having a sequence of: EEEX1QX2IQPDKSVLVAAGETX3TLRCTX4TSLX5PVGPIQWFRGAGPGRX6LIYNQX7X8GX9F PRVTTVSDX10TX11RNNMDFSIRIGX12ITX13ADAGTYYCX14KX15RKGSPDDVEX16KSGAGTE LSVRAKPS (SEQ ID NO: 37), wherein X1 is L, I, or V; X2 is V, L, or, I; X3 is A or V; X4 is A, I, or L; X5 is I, T, S, or F; X6 is E, V, or L; X7 is K or R; X8 is E or Q; X9 is H, P, or R; X10 is L, T, or G; X11 is K or R; X12 is N, A, C, D, E, F, G, H, I, K, L, M, P, Q, R, S, T, V, W, or Y; X13 is P, A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, or Y; X14 is V or I; X15 is F, L, or V; and X16 is F or V; and wherein the variant has at least one amino acid substitution relative to a wild-type SIRP-α D1 domain having the sequence of SEQ ID NO: 1.
In some embodiments, a polypeptide includes a SIRP-α D1 variant having a sequence of: EEGX1QX2IQPDKSVSVAAGESX3ILHCTX4TSLX5PVGPIQWFRGAGPGRX6LIYNQX7X8GX9F PRVTTVSDX10TX11RNNMDFSIRIGX12ITX13ADAGTYYCX14KX15RKGSPDDVEX16KSGAGTE LSVRAKPS (SEQ ID NO: 40), wherein X1 is L, I, or V; X2 is V, L, or, I; X3 is A or V; X4 is A, I, or L; X5 is I, T, S, or F; X6 is E, V, or L; X7 is K or R; X8 is E or Q; X9 is H, P, or R; X10 is L, T, or G; X11 is K or R; X12 is N, A, C, D, E, F, G, H, I, K, L, M, P, Q, R, S, T, V, W, or Y; X13 is P, A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, or Y; X14 is V or I; X15 is F, L, or V; and X16 is F or V; and wherein the variant has at least one amino acid substitution relative to a wild-type SIRP-α D1 domain having the sequence of SEQ ID NO: 4.
In some embodiments, a polypeptide includes a SIRP-α D1 variant having a sequence of: EEEX1QX2IQPDKFVLVAAGETX3TLRCTX4TSLX5PVGPIQWFRGAGPGRX6LIYNQX7X8GX9F PRVTTVSDX10TX11RNNMDFSIRIGX12ITX13ADAGTYYCX14KX15RKGSPDDVEX16KSGAGTE LSVRAKPS (SEQ ID NO: 41), wherein X1 is L, I, or V; X2 is V, L, or, I; X3 is A or V; X4 is A, I, or L; X5 is I, T, S, or F; X6 is E, V, or L; X7 is K or R; X8 is E or Q; X9 is H, P, or R; X10 is L, T, or G; X11 is K or R; X12 is N, A, C, D, E, F, G, H, I, K, L, M, P, Q, R, S, T, V, W, or Y; X13 is P, A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, or Y; X14 is V or I; X15 is F, L, or V; and X16 is F or V; and wherein the variant has at least one amino acid substitution relative to a wild-type SIRP-α D1 domain having the sequence of SEQ ID NO: 5.
In some embodiments, a polypeptide includes a SIRP-α D1 variant having a sequence of: EEEX1QX2IQPDKSVLVAAGETX3TLRCTX4TSLX5PVGPIQWFRGAGPGRX6LIYNQX7X8GX9F PRVTTVSDX10TX11RNNMDFPIRIGX12ITX13ADAGTYYCX14KX15RKGSPDDVEX16KSGAGTE LSVRAKPS (SEQ ID NO: 42), and wherein X1 is L, I, or V; X2 is V, L, or, I; X3 is A or V; X4 is A, I, or L; X5 is I, T, S, or F; X6 is E, V, or L; X7 is K or R; X8 is E or Q; X9 is H, P, or R; X10 is L, T, or G; X11 is K or R; X12 is N, A, C, D, E, F, G, H, I, K, L, M, P, Q, R, S, T, V, W, or Y; X13 is P, A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, or Y; X14 is V or I; X15 is F, L, or V; and X16 is F or V; and wherein the variant has at least one amino acid substitution relative to a wild-type SIRP-α D1 domain having the sequence of SEQ ID NO: 6.
In some embodiments, a polypeptide includes a SIRP-α D1 variant having a sequence of: EEEX1QX2IQPDKSVLVAAGETX3TLRCTX4TSLX5PVGPIQWFRGAGPGRX6LIYNQX7X8GX9F PRVTTVSDX10TX11RNNMDFSIRISX12ITX13ADAGTYYCX14KX15RKGSPDDVEX16KSGAGTE LSVRAKPS (SEQ ID NO: 45), and wherein X1 is L, I, or V; X2 is V, L, or, I; X3 is A or V; X4 is A, I, or L; X5 is I, T, S, or F; X6 is E, V, or L; X7 is K or R; X8 is E or Q; X9 is H, P, or R; X10 is L, T, or G; X11 is K or R; X12 is N, A, C, D, E, F, G, H, I, K, L, M, P, Q, R, S, T, V, W, or Y; X13 is P, A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, or Y; X14 is V or I; X15 is F, L, or V; and X16 is F or V; and wherein the variant has at least one amino acid substitution relative to a wild-type SIRP-α D1 domain having the sequence of SEQ ID NO: 9.
In any of the aforementioned embodiments in this aspect of the disclosure, a polypeptide includes a SIRP-α D1 variant having a sequence of any one of SEQ ID NOs: 37, 40-42, and 45, wherein X1 is L, I, or V. In any of the aforementioned embodiments, X2 is V, L, or, I. In any of the aforementioned embodiments, X3 is A or V. In any of the aforementioned embodiments, X4 is A, I, or L. In any of the aforementioned embodiments, X5 is I, T, S, or F. In any of the aforementioned embodiments, X6 is E, V, or L. In any of the aforementioned embodiments, X7 is K or R. In any of the aforementioned embodiments, X8 is E or Q. In any of the aforementioned embodiments, X9 is H, P, or R. In any of the aforementioned embodiments, X10 is L, T, or G. In any of the aforementioned embodiments, X11 is K or R. In any of the aforementioned embodiments, X12 is N, A, C, D, E, F, G, H, I, K, L, M, P, Q, R, S, T, V, W, or Y. In any of the aforementioned embodiments, X13 is P, A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, or Y. In any of the aforementioned embodiments, X14 is V or I. In any of the aforementioned embodiments, X15 is F, L, V. In any of the aforementioned embodiments, X16 is F or V.
In some embodiments, a polypeptide provided herein includes no more than ten amino acid substitutions relative to the wild-type SIRP-α D1 domain having the sequence of any one of SEQ ID NOs: 1, 4-6, and 9. In some embodiments, the polypeptide provided herein includes no more than seven amino acid substitutions relative to the wild-type SIRP-α D1 domain having the sequence of any one of SEQ ID NOs: 1, 4-6, and 9.
In some embodiments, the polypeptide binds CD47 with at least 10-fold greater binding affinity than the wild-type SIRP-α D1 domain having the sequence of any one of SEQ ID NOs: 1, 4-6, and 9. In some embodiments, the polypeptide binds CD47 with at least 100-fold greater binding affinity than the wild-type SIRP-α D1 domain having the sequence of any one of SEQ ID NOs: 1, 4-6, and 9. In some embodiments, the polypeptide binds CD47 with at least 1000-fold greater binding affinity than the wild-type SIRP-α D1 domain having the sequence of any one of SEQ ID NOs: 1, 4-6, and 9. In some embodiments, a SIRP-α D1 variant polypeptide or fragment thereof binds to CD47 with a KD less than 1×10−8 M, less than 5×10−9 M, less than 1×10−9 M, less 5×10−10 M, less than 1×10−10 M or less than 1×10−11M. In some embodiments, a SIRP-α D1 variant polypeptide or fragment thereof binds to CD47 with a KD between about 500 nM and 100 nM, between about 100 nM and 50 nM, between about 50 nM and 10 nM, between about 10 nM and 5 nM, between about 5 nM and 1 nM, between about 1 nM and 500 pM, between about 500 pM and 100 pM, between about 100 pM and 50 pM, or between about 50 pM and 10 pM.
In some embodiments, a polypeptide includes a SIRP-α D1 variant having a sequence of: EEEX1QX2IQPDKSVSVAAGESX3ILHCTX4TSLX5PVGPIQWFRGAGPARX6LIYNQX7X8GX9F PRVTTVSEX10TX11RENMDFSISISX12ITX13ADAGTYYCX14KX15RKGSPDTEX16KSGAGTELS VRAKPS (SEQ ID NO: 38), wherein X1 is L, I, or V; X2 is V, L, or, I; X3 is A or V; X4 is V, I, or L; X5 is I, T, S, or F; X6 is E, V, or L; X7 is K or R; X8 is E or Q; X9 is H, P, or R; X10 is S, T, or G; X11 is K or R; X12 is N, A, C, D, E, F, G, H, I, K, L, M, P, Q, R, S, T, V, W, or Y; X13 is P, A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, or Y; X14 is V or I; X15 is F, L, or V; and X16 is F or V; and wherein the variant has at least one amino acid substitution relative to a wild-type SIRP-α D1 domain having the sequence of SEQ ID NO: 2.
In some embodiments, a polypeptide includes a SIRP-α D1 variant having a sequence of: EEEX1QX2IQPDKSVSVAAGESX3ILLCTX4TSLX5PVGPIQWFRGAGPARX6LIYNQX7X8GX9FP RVTTVSEX10TX11RENMDFSISISX12ITX13ADAGTYYCX14KX15RKGSPDTEX16KSGAGTELSV RAKPS (SEQ ID NO: 39), wherein X1 is L, I, or V; X2 is V, L, or, I; X3 is A or V; X4 is V, I, or L; X5 is I, T, S, or F; X6 is E, V, or L; X7 is K or R; X8 is E or Q; X9 is H, P, or R; X10 is S, T, or G; X11 is K or R; X12 is N, A, C, D, E, F, G, H, I, K, L, M, P, Q, R, S, T, V, W, or Y; X13 is P, A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, or Y; X14 is V or I; X15 is F, L, or V; and X16 is F or V; and wherein the variant has at least one amino acid substitution relative to a wild-type SIRP-α D1 domain having the sequence of SEQ ID NO: 3.
In some embodiments, a polypeptide includes a SIRP-α D1 variant having a sequence of: EEEX1QX2IQPDKSVSVAAGESX3ILHCTX4TSLX5PVGPIQWFRGAGPARX6LIYNQX7X8GX9F PRVTTVSEX10TX11RENMDFSISISX12ITX13ADAGTYYCX14KX15RKGSPDTEX16KSGAGTELS VRGKPS (SEQ ID NO: 43), wherein X1 is L, I, or V; X2 is V, L, or, I; X3 is A or V; X4 is V, I, or L; X5 is I, T, S, or F; X6 is E, V, or L; X7 is K or R; X8 is E or Q; X9 is H, P, or R; X10 is S, T, or G; X11 is K or R; X12 is N, A, C, D, E, F, G, H, I, K, L, M, P, Q, R, S, T, V, W, or Y; X13 is P, A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, or Y; X14 is V or I; X15 is F, L, or V; and X16 is F or V; and wherein the variant has at least one amino acid substitution relative to a wild-type SIRP-α D1 domain having the sequence of SEQ ID NO: 7.
In some embodiments, a polypeptide includes a SIRP-α D1 variant having a sequence of: EEEX1QX2IQPDKSVSVAAGESX3ILHCTX4TSLX5PVGPIQWFRGAGPARX6LIYNQX7X8GX9F PRVTTVSEX10TX11RENMDFSISISX12ITX13ADAGTYYCX14KX15RKGSPDTEX16KSGAGTELS VRAKPS (SEQ ID NO: 46), wherein X1 is L, I, or V; X2 is V, L, or, I; X3 is A or V; X4 is V, I, or L; X5 is I, T, S, or F; X6 is E, V, or L; X7 is K or R; X8 is E or Q; X9 is H, P, or R; X10 is S, T, or G; X11 is K or R; X12 is N, A, C, D, E, F, G, H, I, K, L, M, P, Q, R, S, T, V, W, or Y; X13 is P, A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, or Y; X14 is V or I; X15 is F, L, or V; and X16 is F or V; and wherein the variant has at least one amino acid substitution relative to a wild-type SIRP-α D1 domain having the sequence of SEQ ID NO: 10.
In any of the aforementioned embodiments in this aspect of the disclosure, a polypeptide includes a SIRP-α D1 variant having a sequence of any one of SEQ ID NOs: 38, 39, 43, and 46, wherein X1 is L, I, or V. In any of the aforementioned embodiments, X2 is V, L, or, I. In any of the aforementioned embodiments, X3 is A or V. In any of the aforementioned embodiments, X4 is V, I, or L. In any of the aforementioned embodiments, X5 is I, T, S, or F. In any of the aforementioned embodiments, X6 is E, V, or L. In any of the aforementioned embodiments, X7 is K or R. In any of the aforementioned embodiments, X8 is E or Q. In any of the aforementioned embodiments, X9 is H, P, or R. In any of the aforementioned embodiments, X10 is S, T, or G. In any of the aforementioned embodiments, X11 is K or R. In any of the aforementioned embodiments, X12 is N, A, C, D, E, F, G, H, I, K, L, M, P, Q, R, S, T, V, W, or Y. In any of the aforementioned embodiments, X13 is P, A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, or Y. In any of the aforementioned embodiments, X14 is V or I. In any of the aforementioned embodiments, X15 is F, L, or V. In any of the aforementioned embodiments, X16 is F or V.
In some embodiments, a polypeptide includes a SIRP-α D1 variant having no more than ten amino acid substitutions relative to the wild-type SIRP-α D1 domain having the sequence of any one of SEQ ID NOs: 2, 3, 7, and 10. In some embodiments, a polypeptide includes a SIRP-α D1 variant having no more than seven amino acid substitutions relative to the wild-type SIRP-α D1 domain having the sequence of any one of SEQ ID NOs: 2, 3, 7, and 10.
In some embodiments, the polypeptide binds CD47 with at least 10-fold greater binding affinity than the wild-type SIRP-α D1 domain having the sequence of any one of SEQ ID NOs: 2, 3, 7, and 10. In some embodiments, the polypeptide binds CD47 with at least 100-fold greater binding affinity than the wild-type SIRP-α D1 domain having the sequence of any one of SEQ ID NOs: 2, 3, 7, and 10. In some embodiments, the polypeptide binds CD47 with at least 1000-fold greater binding affinity than the wild-type SIRP-α D1 domain having the sequence of any one of SEQ ID NOs: 2, 3, 7, and 10. In some embodiments, a SIRP-α D1 variant polypeptide or fragment thereof binds to CD47 with a KD less than 1×10−8 M, less than 5×10−9 M, less than 1×10−9 M, less 5×10−10 M, less than 1×10−10 M or less than 1×10−11 M. In some embodiments, a SIRP-α D1 variant polypeptide or fragment thereof binds to CD47 with a KD between about 500 nM and 100 nM, between about 100 nM and 50 nM, between about 50 nM and 10 nM, between about 10 nM and 5 nM, between about 5 nM and 1 nM, between about 1 nM and 500 pM, between about 500 pM and 100 pM, between about 100 pM and 50 pM, or between about 50 pM and 10 pM.
In some embodiments, a polypeptide includes a SIRP-α D1 variant having a sequence of: EEEX1QX2IQPDKSVLVAAGETX3TLRCTX4TSLX5PVGPIQWFRGAGPARX6LIYNQX7X8GX9F PRVTTVSEX10TX11RENMDFSISISX12ITX13ADAGTYYCX14KX15RKGSPDTEX16KSGAGTELS VRAKPS (SEQ ID NO: 44), wherein X1 is L, I, or V; X2 is V, L, or, I; X3 is A or V; X4 is A, I, or L; X5 is I, T, S, or F; X6 is E, V, or L; X7 is K or R; X8 is E or Q; X9 is H, P, or R; X10 is S, T, or G; X11 is K or R; X12 is N, A, C, D, E, F, G, H, I, K, L, M, P, Q, R, S, T, V, W, or Y; X13 is P, A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, or Y; X14 is V or I; X15 is F, L, or V; and X16 is F or V; and wherein the variant has at least one amino acid substitution relative to a wild-type SIRP-α D1 domain having the sequence of SEQ ID NO: 8.
In some embodiments, the polypeptide has the sequence of SEQ ID NO: 44, wherein X1 is L, I, or V. In any of the aforementioned embodiments in this aspect of the disclosure, X2 is V, L, or, I. In any of the aforementioned embodiments, X3 is A or V. In any of the aforementioned embodiments, X4 is A, I, or L. In any of the aforementioned embodiments, X5 is I, T, S, or F. In any of the aforementioned embodiments, X6 is E, V, or L. In any of the aforementioned embodiments, X7 is K or R. In any of the aforementioned embodiments, X8 is E or Q. In any of the aforementioned embodiments, X9 is H, P, or R. In any of the aforementioned embodiments, X10 is S, T, or G. In any of the aforementioned embodiments, X11 is K or R. In any of the aforementioned embodiments, X12 is N, A, C, D, E, F, G, H, I, K, L, M, P, Q, R, S, T, V, W, or Y. In any of the aforementioned embodiments, X13 is P, A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, or Y. In any of the aforementioned embodiments, X14 is V or I. In any of the aforementioned embodiments, X15 is F, L, or V. In any of the aforementioned embodiments, X16 is F or V.
In some embodiments, a polypeptide includes a SIRP-α D1 variant having no more than ten amino acid substitutions relative to the wild-type SIRP-α D1 domain having the sequence of SEQ ID NO: 8. In some embodiments, a polypeptide includes a SIRP-α D1 variant having no more than seven amino acid substitutions relative to the wild-type SIRP-α D1 domain having the sequence of SEQ ID NO: 8.
In some embodiments, the polypeptide binds CD47 with at least 10-fold greater binding affinity than the wild-type SIRP-α D1 domain having the sequence of SEQ ID NO: 8. In some embodiments, the polypeptide binds CD47 with at least 100-fold greater binding affinity than the wild-type SIRP-α D1 domain having the sequence of SEQ ID NO: 8. In some embodiments, the polypeptide binds CD47 with at least 1000-fold greater binding affinity than the wild-type SIRP-α D1 domain having the sequence of SEQ ID NO: 8. In some embodiments, a SIRP-α D1 variant polypeptide or fragment thereof binds to CD47 with a KD less than 1×10−8 M, less than 5×10−9 M, less than 1×10−9 M, less 5×10−10 M, less than 1×10−10 M or less than 1×10−11M. In some embodiments, a SIRP-α D1 variant polypeptide or fragment thereof binds to CD47 with a KD between about 500 nM and 100 nM, between about 100 nM and 50 nM, between about 50 nM and 10 nM, between about 10 nM and 5 nM, between about 5 nM and 1 nM, between about 1 nM and 500 pM, between about 500 pM and 100 pM, between about 100 pM and 50 pM, or between about 50 pM and 10 pM.
In another aspect, the disclosure features a polypeptide including a SIRP-α D1 variant having a sequence of: EEX1X2QX3IQPDKX4VX5VAAGEX6X7X8LX9CTX10TSLX11PVGPIQWFRGAGPX12RX13LIYNQ X14X15GX16FPRVTTVSX17X18TX19RX20NMDFX21IX22IX23X24ITX25ADAGTYYCX26KX27RKGS PDX28X29EX30KSGAGTELSVRX31KPS (SEQ ID NO: 47), wherein X1 is E or G; X2 is L, I, or V; X3 is V, L, or, I; X4 is S or F; X5 is L or S; X6 is S or T; X7 is A or V; X8 is I or T; X9 is H or R; X10 is A, V, I, or L; X11 is I, T, S, or F; X12 is A or G; X13 is E, V, or L; X14 is K or R; X15 is E or Q; X16 is H, P, or R; X17 is D or E; X18 is S, L, T, or G; X19 is K or R; X20 is E or N; X21 is S or P; X22 is S or R; X23 is S or G; X24 is any amino acid; X25 is any amino acid; X26 is V or I; X27 is F, L, V; X28 is D or absent; X29 is T or V; X30 is F or V; and X31 is A or G; and wherein the variant has at least one amino acid substitution relative to a wild-type SIRP-α D1 domain having the sequence of any one of SEQ ID NOs: 1-10.
In some embodiments, the polypeptide has the sequence of SEQ ID NO: 47, wherein X1 is E or G. In any of the aforementioned embodiments in this aspect of the disclosure, X2 is L, I, or V. In any of the aforementioned embodiments, X3 is V, L, or, I. In any of the aforementioned embodiments, X4 is S or F. In any of the aforementioned embodiments, X5 is L or S. In any of the aforementioned embodiments, X6 is S or T. In any of the aforementioned embodiments, X7 is A or V. In any of the aforementioned embodiments, X8 is I or T. In any of the aforementioned embodiments, X9 is H or R. In any of the aforementioned embodiments, X10 is A, V, I, or L. In any of the aforementioned embodiments, X11 is I, T, S, or F. In any of the aforementioned embodiments, X12 is A or G. In any of the aforementioned embodiments, X13 is E, V, or L. In any of the aforementioned embodiments, X14 is K or R. In any of the aforementioned embodiments, X15 is E or Q. In any of the aforementioned embodiments, X16 is H, P, or R. In any of the aforementioned embodiments, X17 is D or E. In any of the aforementioned embodiments, X18 is S, L, T, or G. In any of the aforementioned embodiments, X19 is K or R. In any of the aforementioned embodiments, X20 is E or N. In any of the aforementioned embodiments, X21 is S or P. In any of the aforementioned embodiments, X22 is S or R. In any of the aforementioned embodiments, X23 is S or G. In any of the aforementioned embodiments, X24 is N, A, C, D, E, F, G, H, I, K, L, M, P, Q, R, S, T, V, W, or Y. In any of the aforementioned embodiments, X25 is P, A, C, D, E, F, G, H, I, K, L, M, N, Q, R, S, T, V, W, or Y. In any of the aforementioned embodiments, X26 is V or I. In any of the aforementioned embodiments, X27 is F, L, V. In any of the aforementioned embodiments, X28 is D or absent. In any of the aforementioned embodiments, X29 is T or V. In any of the aforementioned embodiments, X30 is F or V. In any of the aforementioned embodiments, X31 is A or G.
In some embodiments, the polypeptide of this aspect of the disclosure includes no more than ten amino acid substitutions relative to the wild-type SIRP-α D1 domain having the sequence of any one of SEQ ID NOs: 1-10. In some embodiments, the polypeptide of this aspect of the disclosure includes no more than seven amino acid substitutions relative to the wild-type SIRP-α D1 domain having the sequence of any one of SEQ ID NOs: 1-10.
In some embodiments, the polypeptide binds CD47 with at least 10-fold greater binding affinity than the wild-type SIRP-α D1 domain having the sequence of any one of SEQ ID NOs: 1-10. In some embodiments, the polypeptide binds CD47 with at least 100-fold greater binding affinity than the wild-type SIRP-α D1 domain having the sequence of any one of SEQ ID NOs: 1-10. In some embodiments, the polypeptide binds CD47 with at least 1000-fold greater binding affinity than the wild-type SIRP-α D1 domain having the sequence of any one of SEQ ID NOs: 1-10. In some embodiments, a SIRP-α D1 variant polypeptide or fragment thereof binds to CD47 with a KD less than 1×10−8 M, less than 5×10−9 M, less than 1×10−9 M, less 5×10−10 M, less than 1×10−10 M or less than 1×10−11 M. In some embodiments, a SIRP-α D1 variant polypeptide or fragment thereof binds to CD47 with a KD between about 500 nM and 100 nM, between about 100 nM and 50 nM, between about 50 nM and 10 nM, between about 10 nM and 5 nM, between about 5 nM and 1 nM, between about 1 nM and 500 pM, between about 500 pM and 100 pM, between about 100 pM and 50 pM, or between about 50 pM and 10 pM.
In some embodiments, a polypeptide includes a SIRP-α D1 variant having a sequence of:
EEELQX1IQPDKSVX2VAAGEX3AX4LX5CTX6TSLX7PVGPIQWFRGAGPX8RX9LIY NQX10X11GX12FPRVTTVSX13X14TKRX15NMDFSIX16IX17X18ITPADAGTYYCX19KFRKGX20X21 X22DX23EFKSGAGTELSVRAKPS (SEQ ID NO: 48), wherein X1 is V or I; X2 is L or S; X3 is T or S; X4 is T or I; X5 is R or H; X6 is A, V, or I; X7 is I, R, Y, K or F; X8 is G or A; X9 is E or V; X10 is K or R; X11 is E, D or Q; X12 is H or P; X13 is D or E; X14 is S, L or T; X15 is N or E; X16 is R or S; X17 is G or S; X18 is N or A; X19 is V or I; X20 is S, I or M; X21 is P or absent; X22 is D or P; and X23 is V or T, or a fragment thereof.
In another aspect, the disclosure features a polypeptide including a SIRP-α D1 variant having a sequence of: EEELQX1IQPDKSVLVAAGETATLRCTX2TSLX3PVGPIQWFRGAGPGRX4LIYNQX5X6GX7FP RVTTVSDX8TKRNNMDFSIRIGX9ITPADAGTYYCX10KFRKGSPDDVEFKSGAGTELSVRAK PS (SEQ ID NO: 49), wherein X1 is V, L, or I; X2 is A, I, V, or L; X3 is I, F, S, or T; X4 is E, V, or L; X5 is K or R; X6 is E or Q; X7 is H, P, or R; X8 is L, T, S, or G; X9 is A; and X10 is V or I; and wherein the variant has at least one amino acid substitution relative to a wild-type SIRP-α D1 domain having the sequence of any one of SEQ ID NO: 1.
In some embodiments, the polypeptide has the sequence of SEQ ID NO: 49, wherein X1 is V, L or I. In any of the aforementioned embodiments in this aspect of the disclosure, X2 is A, I, V, or L. In any of the aforementioned embodiments, X3 is I, F, S, or T. In any of the aforementioned embodiments, X4 is E, V, or L. In any of the aforementioned embodiments, X5 is K or R. In any of the aforementioned embodiments, X6 is E or Q. In any of the aforementioned embodiments, X7 is H, P, or R. In any of the aforementioned embodiments, X8 is L, T, S or G. In any of the aforementioned embodiments, X9 is A. In any of the aforementioned embodiments, X10 is V or I.
In some embodiments, the polypeptide has a high affinity SIRP-α D1 domain having at least 85% sequence identity (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity) to SEQ ID NO: 49, wherein each of X1, X2, X3, X4, X5, X6, X7, X8, X9, and X10 are not a wild-type amino acid.
In some embodiments, the polypeptide of this aspect of the disclosure includes no more than ten amino acid substitutions relative to the wild-type SIRP-α D1 domain having the sequence of any one of SEQ ID NO: 1. In some embodiments, the polypeptide of this aspect of the disclosure includes no more than seven amino acid substitutions relative to the wild-type SIRP-α D1 domain having the sequence of any one of SEQ ID NO: 1.
In some embodiments, the polypeptide binds CD47 with at least 10-fold greater binding affinity than the wild-type SIRP-α D1 domain having the sequence of any one of SEQ ID NO: 1. In some embodiments, the polypeptide binds CD47 with at least 100-fold greater binding affinity than the wild-type SIRP-α D1 domain having the sequence of any one of SEQ ID NO: 1. In some embodiments, the polypeptide binds CD47 with at least 1000-fold greater binding affinity than the wild-type SIRP-α D1 domain having the sequence of any one of SEQ ID NO: 1. In some embodiments, a SIRP-α D1 variant polypeptide or fragment thereof binds to CD47 with a KD less than 1×10−8 M, less than 5×10−9 M, less than 1×10−9 M, less 5×10−10 M, less than 1×10−10 M or less than 1×10−11 M. In some embodiments, a SIRP-α D1 variant polypeptide or fragment thereof binds to CD47 with a KD between about 500 nM and 100 nM, between about 100 nM and 50 nM, between about 50 nM and 10 nM, between about 10 nM and 5 nM, between about 5 nM and 1 nM, between about 1 nM and 500 pM, between about 500 pM and 100 pM, between about 100 pM and 50 pM, or between about 50 pM and 10 pM.
In another aspect, the disclosure features a polypeptide including a SIRP-α D1 variant having a sequence of:
EEELQX1IQPDKSVSVAAGESAILHCTX2TSLX3PVGPIQWFRGAGPARX4LIYNQX5X6GX7FPR VTTVSEX8TKRENMDFSISISX9ITPADAGTYYCX10KFRKGSPDTEFKSGAGTELSVRAKPS, (SEQ ID NO: 50), wherein X1 is V or I; X2 is V or I; X3 is I or F; X4 is E or V; X5 is K or R; X6 is E or Q; X7 is H or P; X8 is S or T; X9 is N or A; and X10 V or I; and wherein the variant has at least one amino acid substitution relative to a wild-type SIRP-α D1 domain having the sequence of any one of SEQ ID NO: 2.
In some embodiments, the polypeptide has the sequence of SEQ ID NO: 50, wherein X1 is V or I. In any of the aforementioned embodiments in this aspect of the disclosure, X2 is V or I. In any of the aforementioned embodiments, X3 is I or F. In any of the aforementioned embodiments, X4 is E or V. In any of the aforementioned embodiments, X5 is K or R. In any of the aforementioned embodiments, X6 is E or Q. In any of the aforementioned embodiments, X7 is H or P. In any of the aforementioned embodiments, X8 is S or R. In any of the aforementioned embodiments, X9 is N or A. In any of the aforementioned embodiments, X10 is V or I.
In some embodiments, the polypeptide has a high affinity SIRP-α D1 domain having at least 85% sequence identity (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity) to SEQ ID NO: 50, wherein each of X1, X2, X3, X4, X5, X6, X7, X8, X9, and X10 is not a wild-type amino acid.
In some embodiments, the polypeptide of this aspect of the disclosure includes no more than ten amino acid substitutions relative to the wild-type SIRP-α D1 domain having the sequence of any one of SEQ ID NO: 2. In some embodiments, the polypeptide of this aspect of the disclosure includes no more than seven amino acid substitutions relative to the wild-type SIRP-α D1 domain having the sequence of any one of SEQ ID NO: 2.
In some embodiments, the polypeptide binds CD47 with at least 10-fold greater binding affinity than the wild-type SIRP-α D1 domain having the sequence of any one of SEQ ID NO: 2. In some embodiments, the polypeptide binds CD47 with at least 100-fold greater binding affinity than the wild-type SIRP-α D1 domain having the sequence of any one of SEQ ID NO: 2. In some embodiments, the polypeptide binds CD47 with at least 1000-fold greater binding affinity than the wild-type SIRP-α D1 domain having the sequence of any one of SEQ ID NO: 2. In some embodiments, a SIRP-α D1 variant polypeptide or fragment thereof binds to CD47 with a KD less than 1×10−8 M, less than 5×10−9 M, less than 1×10−9 M, less 5×10−10 M, less than 1×10−10 M or less than 1×10−11 M. In some embodiments, a SIRP-α D1 variant polypeptide or fragment thereof binds to CD47 with a KD between about 500 nM and 100 nM, between about 100 nM and 50 nM, between about 50 nM and 10 nM, between about 10 nM and 5 nM, between about 5 nM and 1 nM, between about 1 nM and 500 pM, between about 500 pM and 100 pM, between about 100 pM and 50 pM, or between about 50 pM and 10 pM.
In another aspect, the disclosure features a polypeptide including a SIRP-α D1 variant having a sequence of:
EEELQX1IQPDKSVLVAAGETATLRCTX2TSLX3PVGPIQWFRGAGPGRX4LIYNQX5EGX6FPR VTTVSDX7TKRNNMDFSIRIGX8ITPADAGTYYCX9KFRKGSPDDVEFKSGAGTELSVRAKPS (SEQ ID NO: 51), wherein X1 is V or I; X2 is A or I; X3 is I or F; X4 is E or V; X5 is K or R; X6 is H or P; X7 is L or T; X8 is N or A; and X9 is V or I; and wherein the variant has at least one amino acid substitution relative to a wild-type SIRP-α D1 domain having the sequence of any one of SEQ ID NO: 1.
In some embodiments, the polypeptide has the sequence of SEQ ID NO: 51, wherein X1 is V or I. In any of the aforementioned embodiments in this aspect of the disclosure, X2 is A or I. In any of the aforementioned embodiments, X3 is I or F. In any of the aforementioned embodiments, X4 is E or V. In any of the aforementioned embodiments, X5 is K or R. In any of the aforementioned embodiments, X6 is H or P. In any of the aforementioned embodiments, X7 is L or T. In any of the aforementioned embodiments, X8 is N or A. In any of the aforementioned embodiments, X9 is V or I. In some embodiments, X4 is not V.
In some embodiments, the polypeptide has the sequence of SEQ ID NO: 51, wherein X8 is A. In any of the aforementioned embodiments in this aspect of the disclosure, X8 is A and X1 is V or I. In any of the aforementioned embodiments in this aspect of the disclosure, X8 is A and X2 is A or I. In any of the aforementioned embodiments, X8 is A and X3 is I or F. In any of the aforementioned embodiments, X8 is A and X4 is E or V. In some embodiments, X4 is not V. In any of the aforementioned embodiments, X8 is A and X5 is K or R. In any of the aforementioned embodiments, X8 is A and X6 is H or P. In any of the aforementioned embodiments, X8 is A and X7 is A or V. In any of the aforementioned embodiments, X8 is A and X9 is V or I.
In some embodiments, the polypeptide has the sequence of SEQ ID NO: 51, wherein X8 is A. In any of the aforementioned embodiments in this aspect of the disclosure, X8 is A and X1 is I. In any of the aforementioned embodiments in this aspect of the disclosure, X8 is A and X2 is I. In any of the aforementioned embodiments, X8 is A and X3 is F. In any of the aforementioned embodiments, X8 is A and X4 is V. In any of the aforementioned embodiments, X8 is A and X5 is R. In any of the aforementioned embodiments, X8 is A and X6 is P. In any of the aforementioned embodiments, X8 is A and X7 is T. In any of the aforementioned embodiments, X8 is A and X9 is I.
In some embodiments, the polypeptide has a high affinity SIRP-α D1 domain having at least 85% sequence identity (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity) to SEQ ID NO: 51, wherein each of X1, X2, X3, X4, X5, X6, X7, X8, and X9 is not a wild-type amino acid.
In some embodiments, the polypeptide of this aspect of the disclosure includes no more than ten amino acid substitutions relative to the wild-type SIRP-α D1 domain having the sequence of any one of SEQ ID NO: 1. In some embodiments, the polypeptide of this aspect of the disclosure includes no more than seven amino acid substitutions relative to the wild-type SIRP-α D1 domain having the sequence of any one of SEQ ID NO: 1.
In some embodiments, the polypeptide binds CD47 with at least 10-fold greater binding affinity than the wild-type SIRP-α D1 domain having the sequence of any one of SEQ ID NO: 1. In some embodiments, the polypeptide binds CD47 with at least 100-fold greater binding affinity than the wild-type SIRP-α D1 domain having the sequence of any one of SEQ ID NOs: 1. In some embodiments, the polypeptide binds CD47 with at least 1000-fold greater binding affinity than the wild-type SIRP-α D1 domain having the sequence of any one of SEQ ID NO: 1. In some embodiments, a SIRP-α D1 variant polypeptide or fragment thereof binds to CD47 with a KD less than 1×10−8 M, less than 5×10−9 M, less than 1×10−9 M, less 5×10−10 M, less than 1×10−10 M or less than 1×10−11 M. In some embodiments, a SIRP-α D1 variant polypeptide or fragment thereof binds to CD47 with a KD between about 500 nM and 100 nM, between about 100 nM and 50 nM, between about 50 nM and 10 nM, between about 10 nM and 5 nM, between about 5 nM and 1 nM, between about 1 nM and 500 pM, between about 500 pM and 100 pM, between about 100 pM and 50 pM, or between about 50 pM and 10 pM.
EEELQX1IQPDKSVLVAAGETATLRCTX2TSLX3PVGPIQWFRGAGPGRELIYNQX4EGX5FPRV TTVSDX6TKRNNMDFSIRIGX7ITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSVRAKPS (SEQ ID NO: 222), wherein X1 is V, L, or I; X2 is A, I, or L; X3 is I, T, S, or F; X4 is K or R; X5 is H or P; X6 is L, T, or G; X7 is N or A; and wherein the variant has at least one amino acid substitution relative to a wild-type SIRP-α D1 domain having a sequence according to SEQ ID NO: 1.
In some embodiments, the polypeptide has the sequence of SEQ ID NO: 222, wherein X1 is V, L, or I. In any of the aforementioned embodiments in this aspect of the disclosure, X2 is A, I, or L. In any of the aforementioned embodiments, X3 is I, T, S, or F. In any of the aforementioned embodiments, X4 is K or R. In any of the aforementioned embodiments, X5 is H or P. In any of the aforementioned embodiments, X6 is L, T, or G. In any of the aforementioned embodiments, X7 is N or A.
In some embodiments, the polypeptide has the sequence of SEQ ID NO: 222, wherein X1 is V or I. In any of the aforementioned embodiments in this aspect of the disclosure, X2 is A or I. In any of the aforementioned embodiments, X3 is I or F. In any of the aforementioned embodiments, X4 is K or R. In any of the aforementioned embodiments, X5 is H or P. In any of the aforementioned embodiments, X6 is L or T. In any of the aforementioned embodiments, X7 is N or A.
In some embodiments, the polypeptide has the sequence of SEQ ID NO: 222, wherein X7 is A. In any of the aforementioned embodiments in this aspect of the disclosure, X7 is A and X1 is V or I. In any of the aforementioned embodiments in this aspect of the disclosure, X7 is A and X2 is A or I. In any of the aforementioned embodiments, X7 is A and X3 is I or F. In any of the aforementioned embodiments, X7 is A and X4 is K or R. In any of the aforementioned embodiments, X7 is A and X5 is H or P. In any of the aforementioned embodiments, X7 is A and X6 is L or T.
In some embodiments, the polypeptide has the sequence of SEQ ID NO: 222, wherein X7 is A. In any of the aforementioned embodiments in this aspect of the disclosure, X7 is A and X1 is I. In any of the aforementioned embodiments in this aspect of the disclosure, X7 is A and X2 is I. In any of the aforementioned embodiments, X7 is A and X3 is F. In any of the aforementioned embodiments, X7 is A and X4 is R. In any of the aforementioned embodiments, X7 is A and X5 is P. In any of the aforementioned embodiments, X7 is A and X6 is T.
In some embodiments, the polypeptide has a high affinity SIRP-α D1 domain having at least 85% sequence identity (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity) to SEQ ID NO: 222, wherein each of X1, X2, X3, X4, X5, X6, and X7 is not a wild-type amino acid.
In some embodiments, the polypeptide of this aspect of the disclosure includes no more than ten amino acid substitutions relative to the wild-type SIRP-α D1 domain having the sequence of any one of SEQ ID NO: 1. In some embodiments, the polypeptide of this aspect of the disclosure includes no more than seven amino acid substitutions relative to the wild-type SIRP-α D1 domain having the sequence of any one of SEQ ID NO: 1.
In some embodiments, the polypeptide binds CD47 with at least 10-fold greater binding affinity than the wild-type SIRP-α D1 domain having the sequence of any one of SEQ ID NO: 1. In some embodiments, the polypeptide binds CD47 with at least 100-fold greater binding affinity than the wild-type SIRP-α D1 domain having the sequence of any one of SEQ ID NO: 1. In some embodiments, the polypeptide binds CD47 with at least 1000-fold greater binding affinity than the wild-type SIRP-α D1 domain having the sequence of any one of SEQ ID NO: 1. In some embodiments, fragments include polypeptides of less than 10 amino acids in length, about 10 amino acids in length, about 20 amino acids in length, about 30 amino acids in length, about 40 amino acids in length, about 50 amino acids in length, about 60 amino acids in length, about 70 amino acids in length, about 80 amino acids in length, about 90 amino acids in length, about 100 amino acids in length, or more than about 100 amino acids in length. Fragments retain the ability to bind to CD47. Preferably, SIRP-α D1 variant polypeptides and fragments thereof bind to CD47 with a higher affinity than a SIRP-α polypeptide binds to CD47. For example, in some embodiments, a SIRP-α D1 variant polypeptide or fragment thereof binds to CD47 with a KD less than 1×10−8 M, less than 5×10−9 M, less than 1×10−9 M, less 5×10−10 M, less than 1×10−10 M or less than 1×10−11M. In some embodiments, a SIRP-α D1 variant polypeptide or fragment thereof binds to CD47 with a KD between about 500 nM and 100 nM, between about 100 nM and 50 nM, between about 50 nM and 10 nM, between about 10 nM and 5 nM, between about 5 nM and 1 nM, between about 1 nM and 500 pM, between about 500 pM and 100 pM, between about 100 pM and 50 pM, or between about 50 pM and 10 pM.
In another aspect, the disclosure features a polypeptide including a SIRP-α D1 variant having a sequence of:
EEELQX1IQPDKSVSVAAGESAILHCTX2TSLX3PVGPIQWFRGAGPARELIYNQX4EGX5FPRV TTVSEX6TKRENMDFSISISX7ITPADAGTYYCVKFRKGSPDTEFKSGAGTELSVRAKPS (SEQ ID NO: 212), wherein X1 is V, L, or I; X2 is V, I, or L; X3 is I, T, S, or F; X4 is K or R; X5 is H, P, or R; X6 is S, T, of G; X7 is N or A; and wherein the variant has at least one amino acid substitution relative to a wild-type SIRP-α D1 domain having the sequence of any one of SEQ ID NO: 2.
In some embodiments, the polypeptide has the sequence of SEQ ID NO: 212, wherein X1 is V, L, or I. In any of the aforementioned embodiments in this aspect of the disclosure, X2 is V, I, or L. In any of the aforementioned embodiments, X3 is I, T, S, or F. In any of the aforementioned embodiments, X4 is K or R. In any of the aforementioned embodiments, X5 is H or P. In any of the aforementioned embodiments, X6 is S, T, or G. In any of the aforementioned embodiments, X7 is N or A.
In some embodiments, the polypeptide has the sequence of SEQ ID NO: 212, wherein X1 is V or I. In any of the aforementioned embodiments in this aspect of the disclosure, X2 is V or I. In any of the aforementioned embodiments, X3 is I or F. In any of the aforementioned embodiments, X4 is K or R. In any of the aforementioned embodiments, X5 is H or P. In any of the aforementioned embodiments, X6 is S or T. In any of the aforementioned embodiments, X7 is N or A.
In some embodiments, the polypeptide has the sequence of SEQ ID NO: 212, wherein X7 is A. In any of the aforementioned embodiments in this aspect of the disclosure, X7 is A and X1 is V or I. In any of the aforementioned embodiments in this aspect of the disclosure, X7 is A and X2 is V or I. In any of the aforementioned embodiments, X7 is A and X3 is I or F. In any of the aforementioned embodiments, X7 is A and X4 is K or R. In any of the aforementioned embodiments, X7 is A and X5 is H or P. In any of the aforementioned embodiments, X7 is A and X6 is S or T.
In some embodiments, the polypeptide has the sequence of SEQ ID NO: 212, wherein X7 is A. In any of the aforementioned embodiments in this aspect of the disclosure, X7 is A and X1 is I. In any of the aforementioned embodiments in this aspect of the disclosure, X7 is A and X2 is I. In any of the aforementioned embodiments, X7 is A and X3 is F. In any of the aforementioned embodiments, X7 is A and X4 is R. In any of the aforementioned embodiments, X7 is A and X5 is P. In any of the aforementioned embodiments, X7 is A and X6 is T.
In some embodiments, the polypeptide has a high affinity SIRP-α D1 domain having at least 85% sequence identity (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity) to SEQ ID NO: 212, wherein each of X1, X2, X3, X4, X5, X6, and X7 is not a wild-type amino acid.
In some embodiments, the polypeptide of this aspect of the disclosure includes no more than ten amino acid substitutions relative to the wild-type SIRP-α D1 domain having the sequence of any one of SEQ ID NO: 2. In some embodiments, the polypeptide of this aspect of the disclosure includes no more than seven amino acid substitutions relative to the wild-type SIRP-α D1 domain having the sequence of any one of SEQ ID NO: 2.
In some embodiments, the polypeptide binds CD47 with at least 10-fold greater binding affinity than the wild-type SIRP-α D1 domain having the sequence of any one of SEQ ID NO: 2. In some embodiments, the polypeptide binds CD47 with at least 100-fold greater binding affinity than the wild-type SIRP-α D1 domain having the sequence of any one of SEQ ID NO: 2. In some embodiments, the polypeptide binds CD47 with at least 1000-fold greater binding affinity than the wild-type SIRP-α D1 domain having the sequence of any one of SEQ ID NO: 2. In some embodiments, fragments include polypeptides of less than 10 amino acids in length, about 10 amino acids in length, about 20 amino acids in length, about 30 amino acids in length, about 40 amino acids in length, about 50 amino acids in length, about 60 amino acids in length, about 70 amino acids in length, about 80 amino acids in length, about 90 amino acids in length, about 100 amino acids in length, or more than about 100 amino acids in length. Fragments retain the ability to bind to CD47. Preferably, SIRP-α D1 variant polypeptides and fragments thereof bind to CD47 with a higher affinity than a SIRP-α polypeptide binds to CD47. For example, in some embodiments, a SIRP-α D1 variant polypeptide or fragment thereof binds to CD47 with a KD less than 1×10−8 M, less than 5×10−9 M, less than 1×10−9 M, less 5×10−10 M, less than 1×10−10 M or less than 1×10−11M. In some embodiments, a SIRP-α D1 variant polypeptide or fragment thereof binds to CD47 with a KD between about 500 nM and 100 nM, between about 100 nM and 50 nM, between about 50 nM and 10 nM, between about 10 nM and 5 nM, between about 5 nM and 1 nM, between about 1 nM and 500 pM, between about 500 pM and 100 pM, between about 100 pM and 50 pM, or between about 50 pM and 10 pM.
Described herein, in some embodiments, is a polypeptide comprising a SIRP-α D1 variant having a sequence according to:
EEELQX1IQPDKSVLVAAGETATLRCTX2TSLX3PVGPIQWFRGAGPGRX4LIYNQX5X6GX7FP RVTTVSDX8TKRNNMDFSIRIGX9X10X11X12ADAGTYYCX13KFRKGSPDDVEFKSGAGTELS VRAKPS (SEQ ID NO: 218), wherein X1 is V, L, or I; X2 is A, V, L, or I; X3 is I, S, T, or F; X4 is E, L, or V; X5 is K or R; X6 is E or Q; X7 is H, R, or P; X8 is S, G, L, or T; X9 is any amino acid; X10 is any amino acid; X11 is any amino acid; X12 is any amino acid; and X13 is V or I; and wherein the SIRP-α D1 variant has at least two amino acid substitutions relative to a wild-type SIRP-α D1 domain having a sequence according to SEQ ID NO: 1.
In some embodiments, the polypeptide has the sequence of SEQ ID NO: 212, wherein X1, wherein X9 is A. In any of the aforementioned embodiments in this aspect of the disclosure, X9 is N. In any of the aforementioned embodiments in this aspect of the disclosure X10 is I. In any of the aforementioned embodiments in this aspect of the disclosure X9 is N and X10 is P. In any of the aforementioned embodiments in this aspect of the disclosure X9 is N and X11 is any amino acid other than S, T, or C. In any of the aforementioned embodiments in this aspect of the disclosure X11 is T. In any of the aforementioned embodiments in this aspect of the disclosure X11 is an amino acid other than T. In any of the aforementioned embodiments in this aspect of the disclosure X12 is P. In any of the aforementioned embodiments in this aspect of the disclosure X9 is N and X12 is any amino acid other than P.
Described herein, in some embodiments, is a polypeptide comprising a SIRP-α D1 variant having a sequence according to:
EEELQX1IQPDKSVLVAAGETATLRCTX2TSLX3PVGPIQWFRGAGPGRX4LIYNQX5X6GX7FP RVTTVSDX8TKRNNMDFSIRIGX9ITX10ADAGTYYCX11KFRKGSPDDVEFKSGAGTELSVRA KPS (SEQ ID NO: 219), wherein X1 is V, L, or I; X2 is A, V, L, or I; X3 is I, S, T, or F; X4 is E, L, or V; X5 is K or R; X6 is E or Q; X7 is H, R, or P; X8 is S, G, L, or T; X9 is N; X10 is any amino acid other than P; and X11 is V or I; and wherein the SIRP-α D1 variant has at least two amino acid substitutions relative to a wild-type SIRP-α D1 domain having a sequence according to SEQ ID NO: 1.
In another aspect of the disclosure, compositions are disclosed herein which include a SIRP-α D1 variant polypeptide having the amino acid sequence of SEQ ID NO: 48, or a fragment thereof. In some embodiments, the SIRP-α D1 variant polypeptide or fragment thereof binds to CD47 with a higher affinity compared to the affinity that a SIRP-α polypeptide binds to the CD47. In some embodiments, the SIRP-α D1 variant polypeptide binds to CD47 with a KD less than 1×10−8M, or less than 1×10−9M, less than 1×10−10M or less than 1×10−11M. In some embodiments, the above-mentioned SIRP-α D1 variant polypeptides are attached or fused to a second polypeptide. In some embodiments, the second polypeptide includes, without limitation, an Fc polypeptide, an Fc variant, an HSA polypeptide, an albumin peptide, a PEG polymer or a fragment of the foregoing.
Without limiting the foregoing, in some embodiments, a SIRP-α D1 variant polypeptide is selected from any one of SEQ ID NOs: 53-87 and 213 shown in Table 6.
TABLE 6
SIRP-α Variant Polypeptides
SEQ
ID NO: Amino Acid Sequence
 53 EEELQIIQPDKSVSVAAGESAILHCTITSLFPVGPIQWFRGAGPARVLIYNQ
RQGPFPRVTTVSETTKRENMDFSISISNITPADAGTYYCIKFRKGSPDTEFK
SGAGTELSVRAKPS
 54 EEELQVIQPDKSVSVAAGESAILHCTVTSLFPVGPIQWFRGAGPARELIYNQ
RQGPFPRVTTVSESTKRENMDFSISISNITPADAGTYYCVKFRKGSPDTEFK
SGAGTELSVRAKPS
 55 EEELQVIQPDKSVSVAAGESAILHCTITSLFPVGPIQWFRGAGPARVLIYNQ
RQGPFPRVTTVSETTKRENMDFSISISNITPADAGTYYCIKFRKGSPDTEFK
SGAGTELSVRAKPS
 56 EEELQIIQPDKSVSVAAGESAILHCTVTSLFPVGPIQWFRGAGPARVLIYNQ
RQGPFPRVTTVSETTKRENMDFSISISNITPADAGTYYCIKFRKGSPDTEFK
SGAGTELSVRAKPS
 57 EEELQIIQPDKSVSVAAGESAILHCTITSLIPVGPIQWFRGAGPARVLIYNQ
RQGPFPRVTTVSETTKRENMDFSISISNITPADAGTYYCIKFRKGSPDTEFK
SGAGTELSVRAKPS
 58 EEELQIIQPDKSVSVAAGESAILHCTITSLFPVGPIQWFRGAGPARELIYNQ
RQGPFPRVTTVSETTKRENMDFSISISNITPADAGTYYCIKFRKGSPDTEFK
SGAGTELSVRAKPS
 59 EEELQIIQPDKSVSVAAGESAILHCTITSLFPVGPIQWFRGAGPARVLIYNQ
KQGPFPRVTTVSETTKRENMDFSISISNITPADAGTYYCIKFRKGSPDTEFK
SGAGTELSVRAKPS
 60 EEELQIIQPDKSVSVAAGESAILHCTITSLFPVGPIQWFRGAGPARVLIYNQ
REGPFPRVTTVSETTKRENMDFSISISNITPADAGTYYCIKFRKGSPDTEFK
SGAGTELSVRAKPS
 61 EEELQIIQPDKSVSVAAGESAILHCTITSLFPVGPIQWFRGAGPARVLIYNQ
RQGHFPRVTTVSETTKRENMDFSISISNITPADAGTYYCIKFRKGSPDTEFK
SGAGTELSVRAKPS
 62 EEELQIIQPDKSVSVAAGESAILHCTITSLFPVGPIQWFRGAGPARVLIYNQ
RQGPFPRVTTVSESTKRENMDFSISISNITPADAGTYYCIKFRKGSPDTEFK
SGAGTELSVRAKPS
 63 EEELQIIQPDKSVSVAAGESAILHCTITSLFPVGPIQWFRGAGPARVLIYNQ
RQGPFPRVTTVSETTKRENMDFSISISNITPADAGTYYCVKFRKGSPDTEFK
SGAGTELSVRAKPS
 64 EEELQVIQPDKSVSVAAGESAILHCTVTSLIPVGPIQWFRGAGPARELIYNQ
REGPFPRVTTVSESTKRENMDFSISISNITPADAGTYYCVKFRKGSPDTEFK
SGAGTELSVRAKPS
 65 EEELQVIQPDKSVSVAAGESAILHCTVTSLFPVGPIQWFRGAGPARELIYNQ
REGPFPRVTTVSESTKRENMDFSISISNITPADAGTYYCVKFRKGSPDTEFK
SGAGTELSVRAKPS
 66 EEELQVIQPDKSVSVAAGESAILHCTITSLFPVGPIQWFRGAGPARELIYNQ
REGPFPRVTTVSESTKRENMDFSISISNITPADAGTYYCVKFRKGSPDTEFK
SGAGTELSVRAKPS
 67 EEELQVIQPDKSVSVAAGESAILHCTITSLFPVGPIQWFRGAGPARELIYNQ
REGPFPRVTTVSETTKRENMDFSISISNITPADAGTYYCVKFRKGSPDTEFK
SGAGTELSVRAKPS
 68 EEELQIIQPDKSVSVAAGESAILHCTITSLFPVGPIQWFRGAGPARELIYNQ
REGPFPRVTTVSESTKRENMDFSISISNITPADAGTYYCVKFRKGSPDTEFK
SGAGTELSVRAKPS
 69 EEELQVIQPDKSVSVAAGESAILHCTITSLIPVGPIQWFRGAGPARELIYNQ
REGPFPRVTTVSESTKRENMDFSISISNITPADAGTYYCVKFRKGSPDTEFK
SGAGTELSVRAKPS
 70 EEELQIIQPDKSVSVAAGESAILHCTITSLFPVGPIQWFRGAGPARELIYNQ
REGPFPRVTTVSETTKRENMDFSISISNITPADAGTYYCVKFRKGSPDTEFK
SGAGTELSVRAKPS
 71 EEELQVIQPDKSVLVAAGETATLRCTATSLFPVGPIQWFRGAGPGRELIYNQ
RQGPFPRVTTVSDLTKRNNMDFSIRIGNITPADAGTYYCVKFRKGSPDDVEF
KSGAGTELSVRAKPS
 72 EEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQWFRGAGPGRELIYNQ
REGPFPRVTTVSDLTKRNNMDFSIRIGNITPADAGTYYCVKFRKGSPDDVEF
KSGAGTELSVRAKPS
 73 EEELQVIQPDKSVLVAAGETATLRCTITSLFPVGPIQWFRGAGPGRELIYNQ
REGPFPRVTTVSDTTKRNNMDFSIRIGNITPADAGTYYCVKFRKGSPDDVEF
KSGAGTELSVRAKPS
 74 EEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQWFRGAGPGRELIYNQ
REGPFPRVTTVSDTTKRNNMDFSIRIGNITPADAGTYYCVKFRKGSPDDVEF
KSGAGTELSVRAKPS
 75 EEELQVIQPDKSVLVAAGETATLRCTITSLFPVGPIQWFRGAGPGRELIYNQ
REGPFPRVTTVSDLTKRNNMDFSIRIGNITPADAGTYYCVKFRKGSPDDVEF
KSGAGTELSVRAKPS
 76 EEELQVIQPDKSVLVAAGETATLRCTATSLFPVGPIQWFRGAGPGRELIYNQ
REGPFPRVTTVSDLTKRNNMDFSIRIGNITPADAGTYYCVKFRKGSPDDVEF
KSGAGTELSVRAKPS
 77 EEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQWFRGAGPGRVLIYNQ
RQGPFPRVTTVSDTTKRNNMDFSIRIGNITPADAGTYYCIKFRKGSPDDVEF
KSGAGTELSVRAKPS
 78 EEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQWFRGAGPGRVLIYNQ
RQGPFPRVTTVSDTTKRNNMDFSIRIGAITPADAGTYYCIKFRKGSPDDVEF
KSGAGTELSVRAKPS
 79 EEELQVIQPDKSVLVAAGETATLRCTATSLFPVGPIQWFRGAGPGRELIYNQ
RQGPFPRVTTVSDLTKRNNMDFSIRIGAITPADAGTYYCVKFRKGSPDDVEF
KSGAGTELSVRAKPS
 80 EEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQWFRGAGPGRVLIYNQ
REGPFPRVTTVSDTTKRNNMDFSIRIGAITPADAGTYYCIKFRKGSPDDVEF
KSGAGTELSVRAKPS
 81 EEELQVIQPDKSVLVAAGETATLRCTATSLFPVGPIQWFRGAGPGRELIYNQ
REGPFPRVTTVSDLTKRNNMDFSIRIGAITPADAGTYYCVKFRKGSPDDVEF
KSGAGTELSVRAKPS
 82 EEELQVIQPDKSVLVAAGETATLRCTITSLFPVGPIQWFRGAGPGRELIYNQ
REGPFPRVTTVSDLTKRNNMDFSIRIGAITPADAGTYYCVKFRKGSPDDVEF
KSGAGTELSVRAKPS
 83 EEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQWFRGAGPGRELIYNQ
REGPFPRVTTVSDLTKRNNMDFSIRIGAITPADAGTYYCVKFRKGSPDDVEF
KSGAGTELSVRAKPS
 84 EEELQVIQPDKSVLVAAGETATLRCTITSLFPVGPIQWFRGAGPGRELIYNQ
REGPFPRVTTVSDTTKRNNMDFSIRIGAITPADAGTYYCVKFRKGSPDDVEF
KSGAGTELSVRAKPS
 85 EEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQWFRGAGPGRELIYNQ
REGPFPRVTTVSDTTKRNNMDFSIRIGAITPADAGTYYCVKFRKGSPDDVEF
KSGAGTELSVRAKPS
 86 EEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQWFRGAGPGRVLIYNQ
RQGPFPRVTTVSDTTKRNNMDFSIRIGNITPADAGTYYCIKFRKGSPDDVEF
KSGAGTELSVRAKPS
 87 EEELQVIQPDKSVLVAAGETATLRCTATSLIPVGPIQWFRGAGPGRELIYNQ
KEGHFPRVTTVSDLTKRNNMDFSIRIGNITPADAGTYYCVKFRKGSPDDVEF
KSGAGTELSVRAKPS
213 EEELQVIQPDKSVLVAAGETATLRCTATSLFPVGPIQWFRGAGPGRELIYNQ
RQGPFPRVTTVSDLTKRNNMDFSIRIGNITVADAGTYYCVKFRKGSPDDVEF
KSGAGTELSVRAKPS
In some embodiments, the polypeptide includes a high affinity SIRP-α D1 domain that has at least 85% sequence identity (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity) to any variant provided in Table 6.
In some embodiments, the polypeptide includes a high affinity SIRP-α D1 domain that has at least 85% sequence identity (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity) to SEQ ID NOs: 80, 81, or 85 in Table 6.
III. Fc Domain Variants and Fusion Constructs
Disclosed herein, in some embodiments, are polypeptides comprising a signal-regulatory protein α (SIRP-α) D1 variant comprising a SIRP-α D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP-α D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP-α D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92.
Also disclosed herein, in some embodiments, are polypeptides comprising an Fc variant, wherein the Fc variant comprises an Fc domain dimer having two Fc domain monomers, wherein each Fc domain monomer independently is selected from (i) a human IgG1 Fc region consisting of mutations L234A, L235A, G237A, and N297A; (ii) a human IgG2 Fc region consisting of mutations A330S, P331S and N297A; or (iii) a human IgG4 Fc region comprising mutations S228P, E233P, F234V, L235A, delG236, and N297A.
Antibodies that target cell surface antigens can trigger immunostimulatory and effector functions that are associated with Fc receptor (FcR) engagement on immune cells. There are a number of Fc receptors that are specific for particular classes of antibodies, including IgG (gamma receptors), IgE (eta receptors), IgA (alpha receptors) and IgM (mu receptors). Binding of the Fc region to Fc receptors on cell surfaces can trigger a number of biological responses including phagocytosis of antibody-coated particles (antibody-dependent cell-mediated phagocytosis, or ADCP), clearance of immune complexes, lysis of antibody-coated cells by killer cells (antibody-dependent cell-mediated cytotoxicity, or ADCC) and, release of inflammatory mediators, placental transfer, and control of immunoglobulin production. Additionally, binding of the C1 component of complement to antibodies can activate the complement system. Activation of complement can be important for the lysis of cellular pathogens. However, the activation of complement can also stimulate the inflammatory response and can also be involved in autoimmune hypersensitivity or other immunological disorders. Variant Fc regions with reduced or ablated ability to bind certain Fc receptors are useful for developing therapeutic antibodies and Fc-fusion polypeptide constructs which act by targeting, activating, or neutralizing ligand functions while not damaging or destroying local cells or tissues.
In some embodiments, a SIRP-α D1 polypeptide construct comprises a non-naturally occurring high affinity SIRP-α D1 variant linked to an Fc domain monomer which forms an Fc domain having ablated or reduced effector function.
In some embodiments, a Fc domain monomer refers to a polypeptide chain that includes second and third antibody constant domains (e.g., CH2 and CH3). In some embodiments, an Fc domain monomer also includes a hinge domain. In some embodiments, the Fc domain monomer is of any immunoglobulin antibody isotype, including IgG, IgE, IgM, IgA, and IgD. Additionally, in some embodiments, an Fc domain monomer is of any IgG subtype (e.g., IgG1, IgG2, IgG2a, IgG2b, IgG2c, IgG3, and IgG4). In some embodiments, Fc domain monomers include as many as ten changes from a wild-type Fc domain monomer sequence (e.g., 1-10, 1-8, 1-6, 1-4 amino acid substitutions, additions or insertions, deletions, or combinations thereof) that alter the interaction between an Fc domain and an Fc receptor.
As used herein, the term “Fc domain” refers to a dimer of two Fc domain monomers. In a wild-type Fc domain, two Fc domain monomers dimerize by the interaction between the two CH3 antibody constant domains, as well as one or more disulfide bonds that form between the hinge domains of the two dimerized Fc domain monomers. In some embodiments, an Fc domain is mutated to lack effector functions, for example a “dead Fc domain.” In some embodiments, each of the Fc domain monomers in an Fc domain includes amino acid substitutions in the CH2 antibody constant domain to reduce the interaction or binding between the Fc domain and an Fc receptor, such as an Fcγ receptor (FcγR), an Fcα receptor (FcαR), or an Fcε (FcεR).
In some embodiments, a high affinity SIRP-α D1 variant (e.g., any of the variants described in Tables 2, 5, and 6) is fused to an Fc domain monomer of an immunoglobulin or a fragment of an Fc domain monomer. In some embodiments, an Fc domain monomer of an immunoglobulin or a fragment of an Fc domain monomer is capable of forming an Fc domain with another Fc domain monomer. In some embodiments, an Fc domain monomer of an immunoglobulin or a fragment of an Fc domain monomer is not capable of forming an Fc domain with another Fc domain monomer. In some embodiments, an Fc domain monomer or a fragment of an Fc domain is fused to a polypeptide of the disclosure to increase serum half-life of the polypeptide. In some embodiments, an Fc domain monomer or a fragment of an Fc domain monomer fused to a polypeptide of the disclosure dimerizes with a second Fc domain monomer to form an Fc domain which binds an Fc receptor, or alternatively, an Fc domain monomer binds to an Fc receptor. In some embodiments, an Fc domain or a fragment of the Fc domain fused to a polypeptide to increase serum half-life of the polypeptide does not induce any immune system-related response.
In some embodiments, a SIRP-α polypeptide or construct provided herein includes a SIRP-α D1 domain or variant thereof joined to a first Fc domain monomer and an antibody variable domain joined to a second Fc domain monomer, in which the first and second Fc domain monomers combine to form an Fc domain (e.g., a heterodimeric Fc domain). An Fc domain is the protein structure that is found at the C-terminus of an immunoglobulin. An Fc domain includes two Fc domain monomers that are dimerized by the interaction between the CH3 antibody constant domains. A wild-type Fc domain forms the minimum structure that binds to an Fc receptor, e.g., FcγRI, FcγRIIa, FcγRIIb, FcγRIIIa, FcγRIIIb, and FcγRIV.
The Fc domain is not involved directly in binding an antibody to its target, but can be involved in various effector functions, such as participation of the antibody in antibody-dependent cellular toxicity. In some embodiments, the Fc domain in a SIRP-α polypeptide or construct of the disclosure comprise amino acid substitutions, additions or insertions, deletions, or any combinations thereof that lead to decreased effector function such as decreased antibody-dependent cell-mediated cytotoxicity (ADCC), decreased complement-dependent cytolysis (CDC), decreased antibody-dependent cell-mediated phagocytosis (ADCP), or any combinations thereof. In some embodiments, the SIRP-α polypeptides or constructs of the disclosure are characterized by decreased binding (e.g., minimal binding or absence of binding) to a human Fc receptor and decreased binding (e.g., minimal binding or absence of binding) to complement protein C1q. In some embodiments, the SIRP-α constructs of the disclosure are characterized by decreased binding (e.g., minimal binding or absence of binding) to human FcγRI, FcγRIIA, FcγRIIB, FcγRIIIB, or any combinations thereof, and C1q. To alter or reduce an antibody-dependent effector function, such as ADCC, CDC, ADCP, or any combinations thereof, in some embodiments, the Fc domains in SIRP-α constructs of the disclosure are of the IgG class and comprise one or more amino acid substitutions at E233, L234, L235, G236, G237, D265, D270, N297, E318, K320, K322, A327, A330, P331, or P329 (numbering according to the EU index of Kabat (Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991))).
In some embodiments, polypeptide constructs comprising a non-native Fc region described herein exhibit reduced or ablated binding to at least one of Fcγ receptors CD16a, CD32a, CD32b, CD32c, and CD64 as compared to a polypeptide construct comprising a native Fc region. In some cases, the polypeptide constructs described herein exhibit reduced or ablated binding to CD16a, CD32a, CD32b, CD32c, and CD64 Fcγ receptors.
CDC refers to a form of cytotoxicity in which the complement cascade is activated by the complement component C1q binding to antibody Fc. In some embodiments, polypeptide constructs comprising a non-native Fc region described herein exhibit at least a 5%, 10%, 15%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or greater reduction in C1q binding compared to a polypeptide construct comprising a wild-type Fc region. In some cases, polypeptide constructs comprising a non-native Fc region as described herein exhibit reduced CDC as compared to a polypeptide construct comprising a wild-type Fc region. In some embodiments, polypeptide constructs comprising a non-native Fc region as described herein exhibit at least a 5%, 10%, 15%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or greater reduction in CDC compared to a polypeptide construct comprising a wild-type Fc region. In some cases, polypeptide constructs comprising a non-natural Fc variant as described herein exhibit negligible CDC as compared to a polypeptide construct comprising a wild-type Fc region.
In some embodiments, the Fc variants herein are minimally glycosylated or have reduced glycosylation relative to a wild-type sequence. In some embodiments, deglycosylation is accomplished with a mutation of N297A, or by mutating N297 to any amino acid which is not N. In some embodiments, deglycosylation is accomplished by disrupting the motif N-Xaa1-Xaa2-Xaa3, wherein N=asparagine; Xaa1=any amino acid except P (proline); Xaa2=T (threonine), S (serine) or C (cysteine); and Xaa3=any amino acid except P (proline). In one embodiment, the N-Xaa1-Xaa2-Xaa3 motif refers to residues 297-300 as designated according to Kabat et al., 1991. In some embodiments, a mutation to any one or more of N, Xaa1, Xaa2, or Xaa3 results in deglycosylation of the Fc variant.
In some embodiments, variants of antibody IgG constant regions (e.g., Fc variants) possess a reduced capacity to specifically bind Fcγ receptors or have a reduced capacity to induce phagocytosis. In some embodiments, variants of antibody IgG constant regions (e.g., Fc variants) possess a reduced capacity to specifically bind Fcγ receptors and have a reduced capacity to induce phagocytosis. For example, in some embodiments, an Fc domain is mutated to lack effector functions, typical of a “dead” Fc domain. For example, in some embodiments, an Fc domain includes specific amino acid substitutions that are known to minimize the interaction between the Fc domain and an Fcγ receptor. In some embodiments, an Fc domain monomer is from an IgG1 antibody and includes one or more of amino acid substitutions L234A, L235A, G237A, and N297A (as designated according to the EU numbering system per Kabat et al., 1991). In some embodiments, one or more additional mutations are included in such IgG1 Fc variant. Non-limiting examples of such additional mutations for human IgG1 Fc variants include E318A and K322A. In some instances, a human IgG1 Fc variant has up to 12, 11, 10, 9, 8, 7, 6, 5 or 4 or fewer mutations in total as compared to wild-type human IgG1 sequence. In some embodiments, one or more additional deletions are included in such IgG1 Fc variant. For example, in some embodiments, the C-terminal lysine of the Fc IgG1 heavy chain constant region provided in SEQ ID NO: 88 in Table 7 is deleted, for example to increase the homogeneity of the polypeptide when the polypeptide is produced in bacterial or mammalian cells. In some instances, a human IgG1 Fc variant has up to 12, 11, 10, 9, 8, 7, 6, 5 or 4 or fewer deletions in total as compared to wild-type human IgG1 sequence. In some embodiments, a IgG1 Fc variant has a sequence according to any one of SEQ ID NO: 135, SEQ ID NO: 136, or SEQ ID NO: 137.
In some embodiments, an Fc domain monomer is from an IgG2 or IgG4 antibody and includes amino acid substitutions A330S, P331S, or both A330S and P331S. The aforementioned amino acid positions are defined according to Kabat, et al. (1991). The Kabat numbering of amino acid residues can be determined for a given antibody by alignment at regions of homology of the sequence of the antibody with a “standard” Kabat numbered sequence. In some embodiments, the Fc variant comprises a human IgG2 Fc sequence comprising one or more of A330S, P331S and N297A amino acid substitutions (as designated according to the EU numbering system per Kabat, et al. (1991). In some embodiments, one or more additional mutations are included in such IgG2 Fc variants. Non-limiting examples of such additional mutations for human IgG2 Fc variant include V234A, G237A, P238S, V309L and H268A (as designated according to the EU numbering system per Kabat et al. (1991)). In some instances, a human IgG2 Fc variant has up to 12, 11, 10, 9, 8, 7, 6, 5, 4, 3 or fewer mutations in total as compared to wild-type human IgG2 sequence. In some embodiments, one or more additional deletions are included in such IgG2 Fc variant. For example, in some embodiments, the C-terminal lysine of the Fc IgG2 heavy chain constant region provided in SEQ ID NO: 89 in Table 7 is deleted, for example to increase the homogeneity of the polypeptide when the polypeptide is produced in bacterial or mammalian cells. In some instances, a human IgG2 Fc variant has up to 12, 11, 10, 9, 8, 7, 6, 5 or 4 or fewer deletions in total as compared to wild-type human IgG2 sequence.
When the Fc variant is an IgG4 Fc variant, in some embodiments, such Fc variant comprises a S228P mutation (as designated according to Kabat, et al. (1991)). In some instances, a human IgG4 Fc variant has up to 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2 or 1 mutation(s) in total as compared to wild-type human IgG4 sequence.
In some embodiments, the Fc variant includes at least one of the mutations L234A, L235A, G237A or N297A of an IgG1 Fc region or at least one of the mutations A330S, P331S or N297A of an IgG2 Fc region. In some embodiments, the Fc variant includes at least two of the mutations L234A, L235A, G237A or N297A of an IgG1 Fc region or at least two of the mutations A330S, P331S or N297A of an IgG2 Fc region. In some embodiments, the Fc variant includes at least three of the mutations L234A, L235A, G237A or N297A of an IgG1 Fc region or consists of the mutations A330S, P331S and N297A of an IgG2 Fc region. In some embodiments, the Fc variant consists of the mutations L234A, L235A, G237A and N297A.
In some embodiments, the Fc variant exhibits reduced binding to an Fc receptor of the subject compared to the wild-type human IgG Fc region. In some embodiments, the Fc variant exhibits ablated binding to an Fc receptor of the subject compared to the wild-type human IgG Fc region. In some embodiments, the Fc variant exhibits a reduction of phagocytosis compared to the wild-type human IgG Fc region. In some embodiments, the Fc variant exhibits ablated phagocytosis compared to the wild-type human IgG Fc region.
SEQ ID NO: 88 and SEQ ID NO: 89 provide amino acid sequences of Fc IgG1 and IgG2 heavy chain constant regions. In some embodiments, an Fc variant is any variant of SEQ ID NOs: 90-95 as shown in Table 7.
TABLE 7
Amino Acid Sequences of Fc Variants
SEQ
ID NO: Amino Acid Sequence
88 EPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMI
SRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKP
REEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP
APIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTC
LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF
LYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL
SPGK
89 STKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTV
SWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLG
TQTYTCNVDHKPSNTKVDKTVERKCCVECPPCPAPPVA
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQ
FNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVVHQD
WLNGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYT
LPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPE
NNYKTTPPMLDSDGSFFLYSKLTVDKSRWQQGNVFSCS
VMHEALHNHYTQKSLSLSPGK
90 DKTHTCPPCPAPEAAGAPSVFLFPPKPKDTLMISRTPE
VTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY
ASTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEK
TISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGF
YPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKL
TVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
91 DKTHTCPPCPAPEAAGAPSVFLFPPKPKDTLMISRTPE
VTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY
ASTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEK
TISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGF
YPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKL
TVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
92 VECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCV
VVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFASTF
RVVSVLTVVHQDWLNGKEYKCKVSNKGLPSSIEKTISK
TKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSD
IAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDK
SRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
93 VECPPCPAPPVAGPSVFLEPPKPKDTLMISRTPEVTCV
VVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFASTF
RVVSVLTVVHQDWLNGKEYKCKVSNKGLPSSIEKTISK
TKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGEYPSD
IAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDK
SRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
94 ERKSSVECPPCPAPPVAGPSVFLEPPKPKDTLMISRTP
EVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQ
FASTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPSSIE
KTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKG
EYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSK
LTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
95 ERKSSVECPPCPAPPVAGPSVFLEPPKPKDTLMISRTP
EVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQ
FASTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPSSIE
KTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKG
EYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSK
LTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
Antibody-dependent cell-mediated cytotoxicity, which is also referred to herein as ADCC, refers to a form of cytotoxicity in which secreted Ig bound onto Fc receptors (FcRs) present on certain cytotoxic cells (e.g., Natural Killer (NK) cells and neutrophils) enabling these cytotoxic effector cells to bind specifically to an antigen-bearing target cell and subsequently kill the target cell. Antibody-dependent cell-mediated phagocytosis, which is also referred to herein as ADCP, refers to a form of cytotoxicity in which secreted Ig bound onto Fc receptors (FcRs) present on certain phagocytic cells (e.g., macrophages) enabling these phagocytic effector cells to bind specifically to an antigen-bearing target cell and subsequently engulf and digest the target cell. Ligand-specific high-affinity IgG antibodies directed to the surface of target cells can stimulate the cytotoxic or phagocytic cells and can be used for such killing. In some embodiments, polypeptide constructs comprising an Fc variant as described herein exhibit reduced ADCC or ADCP as compared to a polypeptide construct comprising a wild-type Fc region. In some embodiments, polypeptide constructs comprising an Fc variant as described herein exhibit at least a 5%, 10%, 15%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or greater reduction in ADCC or ADCP compared to a polypeptide construct comprising a wild-type Fc region. In some embodiments, polypeptide constructs comprising an Fc variant as described herein exhibit ablated ADCC or ADCP as compared to a polypeptide construct comprising a wild-type Fc region.
Complement-directed cytotoxicity, which is also referred to herein as CDC, refers to a form of cytotoxicity in which the complement cascade is activated by the complement component C1q binding to antibody Fc. In some embodiments, polypeptide constructs comprising an Fc variant as described herein exhibit at least a 5%, 10%, 15%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or greater reduction in C1q binding compared to a polypeptide construct comprising a wild-type Fc region. In some cases, polypeptide constructs comprising an Fc variant as described herein exhibit reduced CDC as compared to a polypeptide construct comprising a wild-type Fc region. In some embodiments, polypeptide constructs comprising an Fc variant as described herein exhibit at least a 5%, 10%, 15%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or greater reduction in CDC compared to a polypeptide construct comprising a wild-type Fc region. In some cases, polypeptide constructs comprising an Fc variant as described herein exhibit negligible CDC as compared to a polypeptide construct comprising a wild-type Fc region.
Fc variants herein include those that exhibit reduced binding to an Fcγ receptor compared to the wild-type human IgG Fc region. For example, in some embodiments, an Fc variant exhibits binding to an Fcγ receptor that is less than the binding exhibited by a wild-type human IgG Fc region to an Fcγ receptor, as described in the Examples. In some instances, an Fc variant has reduced binding to an Fcγ receptor by a factor of 10%, 20% 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, 99% or 100% (fully ablated effector function). In some embodiments, the reduced binding is for any one or more Fcγ receptor, e.g., CD16a, CD32a, CD32b, CD32c, or CD64.
In some instances, the Fc variants disclosed herein exhibit a reduction of phagocytosis compared to its wild-type human IgG Fc region. Such Fc variants exhibit a reduction in phagocytosis compared to its wild-type human IgG Fc region, wherein the reduction of phagocytosis activity is e.g., by a factor of 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, 99% or 100%. In some instances, an Fc variant exhibits ablated phagocytosis compared to its wild-type human IgG Fc region.
In some embodiments, the Fc variants disclosed herein are coupled to one or more fusion partners. In some cases the fusion partner is a therapeutic moiety. In some cases, the fusion partner is selected to enable targeting of an expressed protein, purification, screening, display, and the like. In some embodiments, the fusion partner also affects the degree of binding to Fc receptors or the degree of phagocytosis reduction. As described herein, in some embodiments, when an Fc variant is coupled to a fusion partner, it forms a polypeptide construct as described below.
In some embodiments, fusion partners are linked to the Fc variant sequence via a linker sequence. In some embodiments, the linker sequence generally comprises a small number of amino acids, such as less than ten amino acids, although longer linkers are also utilized. In some cases, the linker has a length less than 10, 9, 8, 7, 6, or 5 amino acids or shorter. In some cases, the linker has a length of at least 10, 11, 12, 13, 14, 15, 20, 25, 30, or 35 amino acids or longer. Optionally, in some embodiments, a cleavable linker is employed.
In some embodiments, a fusion partner is a targeting or signal sequence that directs an Fc variant protein and any associated fusion partners to a desired cellular location or to the extracellular media. In some embodiments, certain signaling sequences target a protein to be either secreted into the growth media, or into the periplasmic space, located between the inner and outer membrane of the cell. In some embodiments, a fusion partner is a sequence that encodes a peptide or protein that enables purification or screening. Such fusion partners include, but are not limited to, polyhistidine tags (His-tags) (for example His6 (SEQ ID NO: 223) and His10 (SEQ ID NO: 224)) or other tags for use with Immobilized Metal Affinity Chromatography (IMAC) systems (e.g., Ni+2 affinity columns), GST fusions, MBP fusions, Strep-tag, the BSP biotinylation target sequence of the bacterial enzyme BirA, and epitope tags which are targeted by antibodies (for example c-myc tags, flag-tags, and the like).
In some embodiments, such tags are useful for purification, for screening, or both. For example, in some embodiments, an Fc variant is purified using a His-tag by immobilizing it to a Ni+2 affinity column, and then after purification the same His-tag is used to immobilize the antibody to a Ni+2 coated plate to perform an ELISA or other binding assay as described elsewhere herein. In some embodiments, a fusion partner enables the use of a selection method to screen Fc variants as described herein.
Various fusion partners that enable a variety of selection methods are available. For example, by fusing the members of an Fc variant library to the gene III protein, phage display can be employed. In some embodiments, fusion partners enable Fc variants to be labeled. Alternatively, in some embodiments, a fusion partner binds to a specific sequence on the expression vector, enabling the fusion partner and associated Fc variant to be linked covalently or noncovalently with the nucleic acid that encodes them.
In some embodiments, when a fusion partner is a therapeutic moiety, the therapeutic moiety is, e.g., a peptide, a protein, an antibody, a siRNA, or a small molecule. Non-limiting examples of therapeutic antibodies that are coupled to the Fc variants of the present disclosure include, but are not limited to antibodies that recognize CD47. Non-limiting examples of therapeutic polypeptides that are coupled to the Fc variants of the present disclosure include, but are not limited to, CD47 binding polypeptides, including SIRP-α polypeptides. In such instances, the CD47 binding polypeptide is attached or fused to an Fc variant of the disclosure. Examples of CD47 binding polypeptides include, but are not limited to, anti-CD47 antibodies or fragments thereof, and ligands of CD47 such as SIRP-α or a fragment thereof. Additional examples of CD47 binding polypeptides include, but are not limited to naturally-occurring forms of SIRP-α as well as mutants thereof.
In some embodiments, disclosed herein is a polypeptide comprising an Fc variant, wherein the Fc variant comprises an Fc domain dimer having two Fc domain monomers, wherein each Fc domain monomer independently is selected from (i) a human IgG1 Fc region consisting of mutations L234A, L235A, G237A, and N297A; (ii) a human IgG2 Fc region consisting of mutations A330S, P331S and N297A; or (iii) a human IgG4 Fc region comprising mutations S228P, E233P, F234V, L235A, delG236, and N297A. In some embodiments, the Fc domain monomers are identical (i.e., homodimer). In some embodiments, the Fc domain monomers are different (i.e., heterodimer). In some embodiments, at least one of the Fc domain monomers in an Fc domain dimer is a human IgG1 Fc region consisting of mutations L234A, L235A, G237A, and N297A. In some embodiments, at least one of the Fc domain monomers in an Fc domain dimer is a human IgG2 Fc region consisting of mutations A330S, P331S and N297A. In some embodiments, the Fc variant exhibits ablated or reduced binding to an Fcγ receptor compared to the wild-type version of the human IgG Fc region. In some embodiments, the Fc variant exhibits ablated or reduced binding to CD16a, CD32a, CD32b, CD32c, and CD64 Fcγ receptors compared to the wild-type version of the human IgG Fc region. In some embodiments, the Fc variant exhibits ablated or reduced binding to C1q compared to the wild-type version of the human IgG Fc fusion. In some embodiments, at least one of the Fc domain monomers in an Fc domain dimer is a human IgG4 Fc region comprising mutations S228P, E233P, F234V, L235A, delG236, and N297A. In some embodiments, the Fc variant exhibits ablated or reduced binding to a Fcγ receptor compared to the wild-type human IgG4 Fc region. In some embodiments, the Fc variant exhibits ablated or reduced binding to CD16a and CD32b Fcγ receptors compared to the wild-type version of its human IgG4 Fc region. In some embodiments, the Fc variant binds to an Fcγ receptor with a KD greater than about 55×10−6 M.
In some embodiments, the Fc variant further comprises a CD47 binding polypeptide. In some embodiments, the Fc variant exhibits ablated or reduced binding to an Fcγ receptor compared to a wild-type version of a human IgG Fc region. In some embodiments, the CD47 binding polypeptide does not cause acute anemia in rodents and non-human primates. In some embodiments, the CD47 binding polypeptide does not cause acute anemia in humans.
In some embodiments, the CD47 binding polypeptide is a signal-regulatory protein α (SIRP-α) polypeptide or a fragment thereof. In some embodiments, the SIRP-α polypeptide comprises a SIRP-α D1 variant comprising the amino acid sequence, EEELQX1IQPDKSVLVAAGETATLRCTX2TSLX3PVGPIQWFRGAGPGRX4LIYNQX5EGX6FPR VTTVSDX7TKRNNMDFSIRIGX8ITPADAGTYYCX9KFRKGSPDDVEFKSGAGTELSVRAKPS (SEQ ID NO: 221), wherein X1 is V or I; X2 is A or I; X3 is I or F; X4 is E or V; X5 is K or R; X6 is H or P; X7 is L or T; X8 is any amino acid other than N; and X9 is V or I. In some embodiments, the SIRP-α polypeptide comprises a SIRP-α D1 variant wherein X1 is V or I; X2 is A or I; X3 is I or F; X4 is E; X5 is K or R; X6 is H or P; X7 is L or T; X8 is not N; and X9 is V.
In some embodiments, disclosed herein, is a polypeptide comprising: a SIRP-α D1 variant, wherein the SIRP-α D1 variant is a non-naturally occurring high affinity SIRP-α D1 domain, wherein the SIRP-α D1 variant binds to human CD47 with an affinity that is at least 10-fold greater than the affinity of a naturally occurring D1 domain; and an Fc domain monomer, wherein the Fc domain monomer is linked to a second polypeptide comprising a second Fc domain monomer to form an Fc domain, wherein the Fc domain has ablated or reduced effector function. In some embodiments, the non-naturally occurring high affinity SIRP-α D1 domain comprises an amino acid mutation at residue 80.
In some embodiments, disclosed herein, is a SIRP-α D1 variant, wherein the SIRP-α D1 variant binds CD47 from a first species with a KD less than 250 nM; and wherein the SIRP-α D1 variant binds CD47 from a second species with a KD less than 250 nM; and the KD for CD47 from the first species and the KD for CD47 from the second species are within 100 fold of each other; wherein the first species and the second species are selected from the group consisting of: human, rodent, and non-human primate. In some embodiments, the SIRP-α D1 variant binds CD47 from at least 3 different species. In some embodiments, the non-human primate is cynomolgus monkey.
In some embodiments, disclosed herein, is a polypeptide comprising (a) a SIRP-α D1 domain that binds human CD47 with a KD less than 250 nM; and (b) an Fc domain monomer linked to the N-terminus or the C-terminus of the SIRP-α D1 domain, wherein the polypeptide does not cause acute anemia in rodents and non-human primates. In some embodiments, the polypeptide is a non-naturally occurring variant of a human SIRP-α. In some embodiments, administration of the polypeptide in vivo results in hemoglobin reduction by less than 50% during the first week after administration. In some embodiments, administration of the polypeptide in humans results in hemoglobin reduction by less than 50% during the first week after administration. In some embodiments, the polypeptide further comprises at least one Fc variant, wherein the Fc variant comprises an Fc domain monomer selected from (i) a human IgG1 Fc region consisting of mutations L234A, L235A, G237A, and N297A; (ii) a human IgG2 Fc region consisting of mutations A330S, P331S and N297A; or (iii) a human IgG4 Fc region comprising mutations S228P, E233P, F234V, L235A, delG236, and N297A. In some embodiments, the Fc domain monomer is a human IgG1 Fc region consisting of mutations L234A, L235A, G237A, and N297A. In some embodiments, the Fc domain monomer is a human IgG2 Fc region consisting of mutations A330S, P331S and N297A.
The SIRP-α constructs of the disclosure include a SIRP-α domain or variant thereof that has its C-terminus joined to the N-terminus of an Fc domain monomer by way of a linker using conventional genetic or chemical means, e.g., chemical conjugation. In some embodiments, a linker (e.g., a spacer) is inserted between the polypeptide and the Fc domain monomer. In some embodiments, a polypeptide of the disclosure including a high affinity SIRP-α D1 variant is fused to an Fc domain monomer that is incapable of forming a dimer. In some embodiments, a polypeptide of the disclosure is fused to an Fc domain monomer that is capable of forming a dimer, e.g., a heterodimer, with another Fc domain monomer. In some embodiments, a polypeptide of the invention is fused to an Fc domain monomer and this fusion protein forms a homodimer. In some embodiments, a polypeptide of the disclosure is fused to a first Fc domain monomer and a different protein or peptide (e.g., an antibody variable region) is fused to a second Fc domain monomer. In some embodiments, a SIRP-α D1 domain or variant thereof is joined to a first Fc domain monomer and a therapeutic protein (e.g., a cytokine, an interleukin, an antigen, a steroid, an anti-inflammatory agent, or an immunomodulatory agent) is joined to a second Fc domain monomer. In some embodiments, the first and second Fc domain monomers form a heterodimer.
Without the limiting the foregoing, in some embodiments, a SIRP-α D1 variant polypeptide (e.g., any of the variants described in Tables 2, 5, and 6) is fused to an Fc polypeptide or Fc variant polypeptide, such as an Fc domain monomer. Examples of polypeptides comprising a SIRP-α D1 variant polypeptide and a fused Fc variant polypeptide include, but are not limited to, SEQ ID NOS: 96-137, 214, and 216 shown in Table 8.
TABLE 8
Polypeptides Comprising
SIRP-α D1 Variants Fused to Fc Variants
SEQ
ID NO: Amino Acid Sequence
 96 EEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQW
FRGAGPGRVLIYNQRQGPFPRVTTVSDTTKRNNMDFSI
RIGNITPADAGTYYCIKFRKGSPDDVEFKSGAGTELSV
RAKPSDKTHTCPPCPAPEAAGAPSVFLFPPKPKDTLMI
SRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKP
REEQYASTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP
APIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTC
LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF
LYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL
SPGK
 97 EEELQVIQPDKSVLVAAGETATLRCTATSLFPVGPIQW
FRGAGPGRELIYNQRQGPFPRVTTVSDLTKRNNMDFSI
RIGNITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSV
RAKPSDKTHTCPPCPAPEAAGAPSVFLFPPKPKDTLMI
SRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKP
REEQYASTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP
APIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTC
LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF
LYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL
SPGK
 98 EEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQW
FRGAGPGRVLIYNQRQGPFPRVTTVSDTTKRNNMDFSI
RIGAITPADAGTYYCIKFRKGSPDDVEFKSGAGTELSV
RAKPSDKTHTCPPCPAPEAAGAPSVFLFPPKPKDTLMI
SRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKP
REEQYASTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP
APIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTC
LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF
LYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL
SPGK
 99 EEELQVIQPDKSVLVAAGETATLRCTATSLEPVGPIQW
ERGAGPGRELIYNQRQGPFPRVTTVSDLTKRNNMDFSI
RIGAITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSV
RAKPSDKTHTCPPCPAPEAAGAPSVFLEPPKPKDTLMI
SRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKP
REEQYASTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP
APIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTC
LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF
LYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL
SPGK
100 EEELQVIQPDKSVLVAAGETATLRCTATSLEPVGPIQW
ERGAGPGRELIYNQREGPFPRVTTVSDLTKRNNMDFSI
RIGAITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSV
RAKPSDKTHTCPPCPAPEAAGAPSVFLEPPKPKDTLMI
SRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKP
REEQYASTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP
APIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTC
LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF
LYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL
SPGK
101 EEELQVIQPDKSVLVAAGETATLRCTITSLEPVGPIQW
ERGAGPGRELIYNQREGPFPRVTTVSDLTKRNNMDFSI
RIGAITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSV
RAKPSDKTHTCPPCPAPEAAGAPSVFLEPPKPKDTLMI
SRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKP
REEQYASTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP
APIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTC
LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF
LYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL
SPGK
102 EEELQIIQPDKSVLVAAGETATLRCTITSLEPVGPIQW
ERGAGPGRELIYNQREGPFPRVTTVSDLTKRNNMDFSI
RIGAITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSV
RAKPSDKTHTCPPCPAPEAAGAPSVFLEPPKPKDTLMI
SRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKP
REEQYASTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP
APIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTC
LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF
LYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL
SPGK
103 EEELQVIQPDKSVLVAAGETATLRCTITSLEPVGPIQW
ERGAGPGRELIYNQREGPFPRVTTVSDTTKRNNMDFSI
RIGAITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSV
RAKPSDKTHTCPPCPAPEAAGAPSVFLEPPKPKDTLMI
SRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKP
REEQYASTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP
APIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTC
LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF
LYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL
SPGK
104 EEELQIIQPDKSVLVAAGETATLRCTITSLEPVGPIQW
ERGAGPGRELIYNQREGPFPRVTTVSDTTKRNNMDFSI
RIGAITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSV
RAKPSDKTHTCPPCPAPEAAGAPSVFLEPPKPKDTLMI
SRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKP
REEQYASTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP
APIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTC
LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF
LYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL
SPGK
105 EEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQW
FRGAGPGRVLIYNQRQGPFPRVTTVSDTTKRNNMDFSI
RIGNITPADAGTYYCIKFRKGSPDDVEFKSGAGTELSV
RAKPSVECPPCPAPPVAGPSVFLEPPKPKDTLMISRTP
EVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQ
FASTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPSSIE
KTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKG
FYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSK
LTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
106 EEELQVIQPDKSVLVAAGETATLRCTATSLFPVGPIQW
FRGAGPGRELIYNQRQGPFPRVTTVSDLTKRNNMDFSI
RIGNITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSV
RAKPSVECPPCPAPPVAGPSVFLEPPKPKDTLMISRTP
EVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQ
FASTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPSSIE
KTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKG
FYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSK
LTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
107 EEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQW
FRGAGPGRVLIYNQRQGPFPRVTTVSDTTKRNNMDFSI
RIGAITPADAGTYYCIKFRKGSPDDVEFKSGAGTELSV
RAKPSVECPPCPAPPVAGPSVFLEPPKPKDTLMISRTP
EVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQ
FASTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPSSIE
KTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKG
FYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSK
LTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
108 EEELQVIQPDKSVLVAAGETATLRCTATSLFPVGPIQW
FRGAGPGRELIYNQRQGPFPRVTTVSDLTKRNNMDFSI
RIGAITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSV
RAKPSVECPPCPAPPVAGPSVFLEPPKPKDTLMISRTP
EVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQ
FASTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPSSIE
KTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKG
FYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSK
LTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
109 EEELQVIQPDKSVLVAAGETATLRCTATSLFPVGPIQW
FRGAGPGRELIYNQREGPFPRVTTVSDLTKRNNMDFSI
RIGAITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSV
RAKPSVECPPCPAPPVAGPSVFLEPPKPKDTLMISRTP
EVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQ
FASTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPSSIE
KTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKG
FYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSK
LTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
110 EEELQVIQPDKSVLVAAGETATLRCTITSLEPVGPIQW
ERGAGPGRELIYNQREGPFPRVTTVSDLTKRNNMDFSI
RIGAITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSV
RAKPSVECPPCPAPPVAGPSVFLEPPKPKDTLMISRTP
EVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQ
FASTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPSSIE
KTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKG
FYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSK
LTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
111 EEELQIIQPDKSVLVAAGETATLRCTITSLEPVGPIQW
ERGAGPGRELIYNQREGPFPRVTTVSDLTKRNNMDFSI
RIGAITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSV
RAKPSVECPPCPAPPVAGPSVFLEPPKPKDTLMISRTP
EVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQ
FASTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPSSIE
KTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKG
FYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSK
LTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
112 EEELQVIQPDKSVLVAAGETATLRCTITSLEPVGPIQW
ERGAGPGRELIYNQREGPFPRVTTVSDTTKRNNMDFSI
RIGAITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSV
RAKPSVECPPCPAPPVAGPSVFLEPPKPKDTLMISRTP
EVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQ
FASTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPSSIE
KTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKG
FYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSK
LTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
113 EEELQIIQPDKSVLVAAGETATLRCTITSLEPVGPIQW
ERGAGPGRELIYNQREGPFPRVTTVSDTTKRNNMDFSI
RIGAITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSV
RAKPSVECPPCPAPPVAGPSVFLEPPKPKDTLMISRTP
EVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQ
FASTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPSSIE
KTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKG
FYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSK
LTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
114 EEELQIIQPDKSVLVAAGETATLRCTITSLEPVGPIQW
ERGAGPGRVLIYNQRQGPFPRVTTVSDTTKRNNMDFSI
RIGNITPADAGTYYCIKFRKGSPDDVEFKSGAGTELSV
RAKPSERKSSVECPPCPAPPVAGPSVFLEPPKPKDTLM
ISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTK
PREEQFASTFRVVSVLTVVHQDWLNGKEYKCKVSNKGL
PSSIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLT
CLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSF
FLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLS
LSPGK
115 EEELQVIQPDKSVLVAAGETATLRCTATSLEPVGPIQW
ERGAGPGRELIYNQRQGPFPRVTTVSDLTKRNNMDFSI
RIGNITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSV
RAKPSERKSSVECPPCPAPPVAGPSVFLEPPKPKDTLM
ISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTK
PREEQFASTFRVVSVLTVVHQDWLNGKEYKCKVSNKGL
PSSIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLT
CLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSF
FLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLS
LSPGK
116 EEELQIIQPDKSVLVAAGETATLRCTITSLEPVGPIQW
ERGAGPGRVLIYNQRQGPFPRVTTVSDTTKRNNMDFSI
RIGAITPADAGTYYCIKFRKGSPDDVEFKSGAGTELSV
RAKPSERKSSVECPPCPAPPVAGPSVFLEPPKPKDTLM
ISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTK
PREEQFASTFRVVSVLTVVHQDWLNGKEYKCKVSNKGL
PSSIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLT
CLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSF
FLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLS
LSPGK
117 EEELQVIQPDKSVLVAAGETATLRCTATSLEPVGPIQW
ERGAGPGRELIYNQRQGPFPRVTTVSDLTKRNNMDFSI
RIGAITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSV
RAKPSERKSSVECPPCPAPPVAGPSVFLEPPKPKDTLM
ISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTK
PREEQFASTFRVVSVLTVVHQDWLNGKEYKCKVSNKGL
PSSIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLT
CLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSF
FLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLS
LSPGK
118 EEELQVIQPDKSVLVAAGETATLRCTATSLEPVGPIQW
ERGAGPGRELIYNQREGPFPRVTTVSDLTKRNNMDFSI
RIGAITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSV
RAKPSERKSSVECPPCPAPPVAGPSVFLEPPKPKDTLM
ISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTK
PREEQFASTFRVVSVLTVVHQDWLNGKEYKCKVSNKGL
PSSIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLT
CLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSF
FLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLS
LSPGK
119 EEELQVIQPDKSVLVAAGETATLRCTITSLEPVGPIQW
ERGAGPGRELIYNQREGPFPRVTTVSDLTKRNNMDFSI
RIGAITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSV
RAKPSERKSSVECPPCPAPPVAGPSVFLEPPKPKDTLM
ISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTK
PREEQFASTFRVVSVLTVVHQDWLNGKEYKCKVSNKGL
PSSIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLT
CLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSF
FLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLS
LSPGK
120 EEELQIIQPDKSVLVAAGETATLRCTITSLEPVGPIQW
ERGAGPGRELIYNQREGPFPRVTTVSDLTKRNNMDFSI
RIGAITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSV
RAKPSERKSSVECPPCPAPPVAGPSVFLEPPKPKDTLM
ISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTK
PREEQFASTFRVVSVLTVVHQDWLNGKEYKCKVSNKGL
PSSIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLT
CLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSF
FLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLS
LSPGK
121 EEELQVIQPDKSVLVAAGETATLRCTITSLEPVGPIQW
ERGAGPGRELIYNQREGPFPRVTTVSDTTKRNNMDFSI
RIGAITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSV
RAKPSERKSSVECPPCPAPPVAGPSVFLEPPKPKDTLM
ISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTK
PREEQFASTFRVVSVLTVVHQDWLNGKEYKCKVSNKGL
PSSIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLT
CLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSF
FLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLS
LSPGK
122 EEELQIIQPDKSVLVAAGETATLRCTITSLEPVGPIQW
ERGAGPGRELIYNQREGPFPRVTTVSDTTKRNNMDFSI
RIGAITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSV
RAKPSERKSSVECPPCPAPPVAGPSVFLEPPKPKDTLM
ISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTK
PREEQFASTFRVVSVLTVVHQDWLNGKEYKCKVSNKGL
PSSIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLT
CLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSF
FLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLS
LSPGK
123 EEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQW
FRGAGPGRVLIYNQRQGPFPRVTTVSDTTKRNNMDFSI
RIGNITPADAGTYYCIKFRKGSPDDVEFKSGAGTELSV
RAKPSDKTHTCPPCPAPELLGGPSVFLEPPKPKDTLMI
SRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKP
REEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP
APIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTC
LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF
LYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL
SPGK
124 EEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQW
FRGAGPGRVLIYNQRQGPFPRVTTVSDTTKRNNMDFSI
RIGNITPADAGTYYCIKFRKGSPDDVEFKSGAGTELSV
RAKPSDKTHTCPPCPAPEAAGAPSVFLEPPKPKDTLMI
SRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKP
REEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP
APIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTC
LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF
LYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL
SPGK
125 EEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQW
FRGAGPGRVLIYNQRQGPFPRVTTVSDTTKRNNMDFSI
RIGNITPADAGTYYCIKFRKGSPDDVEFKSGAGTELSV
RAKPSDKTHTCPPCPAPELLGGPSVFLEPPKPKDTLMI
SRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKP
REEQYASTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP
APIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTC
LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF
LYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL
SPGK
126 EEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQW
FRGAGPGRVLIYNQRQGPFPRVTTVSDTTKRNNMDFSI
RIGNITPADAGTYYCIKFRKGSPDDVEFKSGAGTELSV
RAKPSERKCCVECPPCPAPPVAGPSVFLEPPKPKDTLM
ISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTK
PREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGL
PAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLT
CLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSF
FLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLS
LSPGK
127 EEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQW
FRGAGPGRVLIYNQRQGPFPRVTTVSDTTKRNNMDFSI
RIGNITPADAGTYYCIKFRKGSPDDVEFKSGAGTELSV
RAKPSERKCCVECPPCPAPPVAGPSVFLEPPKPKDTLM
ISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTK
PREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGL
PSSIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLT
CLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSF
FLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLS
LSPGK
128 EEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQW
FRGAGPGRVLIYNQRQGPFPRVTTVSDTTKRNNMDFSI
RIGNITPADAGTYYCIKFRKGSPDDVEFKSGAGTELSV
RAKPSERKCCVECPPCPAPPVAGPSVFLEPPKPKDTLM
ISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTK
PREEQFASTFRVVSVLTVVHQDWLNGKEYKCKVSNKGL
PAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLT
CLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSF
FLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLS
LSPGK
129 EEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQW
FRGAGPGRVLIYNQRQGPFPRVTTVSDTTKRNNMDFSI
RIGNITPADAGTYYCIKFRKGSPDDVEFKSGAGTELSV
RAKPSERKCCVECPPCPAPPVAGPSVFLEPPKPKDTLM
ISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTK
PREEQFASTFRVVSVLTVVHQDWLNGKEYKCKVSNKGL
PSSIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLT
CLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSF
FLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLS
LSPGK
130 EEELQVIQPDKSVSVAAGESAILHCTVTSLIPVGPIQW
FRGAGPARELIYNQKEGHFPRVTTVSESTKRENMDFSI
SISNITPADAGTYYCVKFRKGSPDTEFKSGAGTELSVR
AKPSESKYGPPCPSCPAPEFLGGPSVFLEPPKPKDTLM
ISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTK
PREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGL
PSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLT
CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSF
FLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLS
LSLGK
131 EEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQW
FRGAGPGRELIYNQREGPFPRVTTVSDTTKRNNMDFSI
RIGAITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSV
RAKPSESKYGPPCPPCPAPEFLGGPSVFLEPPKPKDTL
MISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKT
KPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKG
LPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSL
TCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGS
FFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSL
SLSLGK
132 EEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQW
FRGAGPGRELIYNQREGPFPRVTTVSDTTKRNNMDFSI
RIGAITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSV
RAKPSESKYGPPCPPCPAPEFEGGPSVFLEPPKPKDTL
MISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKT
KPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKG
LPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSL
TCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGS
FFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSL
SLSLGK
133 EEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQW
FRGAGPGRELIYNQREGPFPRVTTVSDTTKRNNMDFSI
RIGAITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSV
RAKPSESKYGPPCPPCPAPPVAGPSVFLEPPKPKDTLM
ISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTK
PREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGL
PSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLT
CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSF
FLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLS
LSLGK
134 EEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQW
FRGAGPGRVLIYNQRQGPFPRVTTVSDTTKRNNMDFSI
RIGNITPADAGTYYCIKFRKGSPDDVEFKSGAGTELSV
RAKPSAAAPPCPPCPAPEFLGGPSVFLEPPKPKDTLMI
SRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKP
REEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLP
SSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTC
LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF
LYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSL
SPGK
135 EEELQVIQPDKSVLVAAGETATLRCTATSLFPVGPIQW
FRGAGPGRELIYNQREGPFPRVTTVSDLTKRNNMDFSI
RIGAITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSV
RAKPSDKTHTCPPCPAPEAAGAPSVFLEPPKPKDTLMI
SRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKP
REEQYASTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP
APIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTC
LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF
LYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL
SPG
136 EEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQW
FRGAGPGRELIYNQREGPFPRVTTVSDTTKRNNMDFSI
RIGAITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSV
RAKPSDKTHTCPPCPAPEAAGAPSVFLEPPKPKDTLMI
SRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKP
REEQYASTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP
APIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTC
LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF
LYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL
SPG
137 EEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQW
FRGAGPGRVLIYNQREGPFPRVTTVSDTTKRNNMDFSI
RIGAITPADAGTYYCIKFRKGSPDDVEFKSGAGTELSV
RAKPSDKTHTCPPCPAPEAAGAPSVFLEPPKPKDTLMI
SRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKP
REEQYASTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP
APIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTC
LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF
LYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL
SPG
214 EEELQVIQPDKSVLVAAGETATLRCTATSLFPVGPIQW
FRGAGPGRELIYNQREGPFPRVTTVSDLTKRNNMDFSI
RIGAITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSV
RAKPSERKSSVECPPCPAPPVAGPSVFLEPPKPKDTLM
ISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTK
PREEQFASTFRVVSVLTVVHQDWLNGKEYKCKVSNKGL
PSSIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLT
CLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSF
FLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLS
LSPG
216 EEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQW
FRGAGPGRVLIYNQRQGPFPRVTTVSDTTKRNNMDFSI
RIGNITPADAGTYYCIKFRKGSPDDVEFKSGAGTELSV
RAKPSDKTHTCPPCPAPELLGGPSVFLEPPKPKDTLMI
SRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKP
REEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP
APIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTC
LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF
LYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL
SPGK
In some embodiments, the polypeptide comprises a high affinity SIRP-α D1 domain that has at least 85% sequence identity (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity) to any variant provided in Table 8.
In some embodiments, the polypeptide comprises a high affinity SIRP-α D1 domain that has at least 85% sequence identity (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity) to SEQ ID NOs: 98-104, 107-113, 116-122, or 135-137 in Table 8.
In some embodiments, the polypeptide comprises (a) a signal-regulatory protein α (SIRP-α) D1 variant, wherein the SIRP-α D1 variant comprises the amino acid sequence, EEX1X2QX3IQPDKX4VX5VAAGEX6X7X8LX9CTX10TSLX11PVGPIQWFRGAGPX12RX13LIYNQ X14X15GX16FPRVTTVSX17X18TX19RX20NMDFX21IX22IX23X24ITX25ADAGTYYCX26KX27RKGS PDX28X29EX30KSGAGTELSVRX31KPS (SEQ ID NO: 47), wherein X1 is E, or G; X2 is L, I, or V; X3 is V, L, or I; X4 is S, or F; X5 is L, or S; X6 is S, or T; X7 is A, or V; X8 is I, or T; X9 is H, R, or L; X10 is A, V, I, or L; X11 is I, T, S, or F; X12 is A, or G; X13 is E, V, or L; X14 is K, or R; X15 is E, or Q; X16 is H, P, or R; X17 is D, or E; X18 is S, L, T, or G; X19 is K, or R; X20 is E, or N; X21 is S, or P; X22 is S, or R; X23 is S, or G; X24 is any amino acid; X25 is any amino acid; X26 is V, or I; X27 is F, L, or V; X28 is D or absent; X29 is T, or V; X30 is F, or V; and X31 is A, or G; and wherein the SIRP-α D1 variant has at least two amino acid substitutions relative to a wild-type SIRP-α D1 domain having a sequence according to any one of SEQ ID NOs: 1 to 10; and (b) an Fc variant comprising an Fc domain dimer having two Fc domain monomers, wherein each Fc domain monomer independently is (i) a human IgG1 Fc region comprising a N297A mutation; (ii) a human IgG1 Fc region comprising L234A, L235A, and G237A mutations; (iii) a human IgG1 Fc region comprising L234A, L235A, G237A, and N297A mutations; (iv) a human IgG2 Fc region comprising a N297A mutation; (v) a human IgG2 Fc region comprising A330S and P331S mutations; (vi) a human IgG2 Fc region comprising A330S, P331S, and N297A mutations; (vii) a human IgG4 Fc region comprising S228P, E233P, F234V, L235A, and delG236 mutations; or (viii) a human IgG4 Fc region comprising S228P, E233P, F234V, L235A, delG236, and N297A mutations.
In some embodiments, the polypeptide comprises a SIRP-α D1 variant wherein the SIRP-α D1 variant comprises an amino acid sequence according to SEQ ID NO: 47; an Fc variant comprising an Fc domain dimer having two Fc domain monomers, wherein one of the Fc domain monomers in the Fc domain dimer comprises a human IgG1 Fc region comprising L234A, L235A, G237A, and N297A mutations.
Dimerization of Fc Domain Monomers
In some embodiments, a SIRP-α D1 variant polypeptide (e.g., any of the variants described in Tables 2, 5, and 6) is fused to a first Fc domain monomer either at the N-terminus or at the C-terminus. In some embodiments, the first Fc domain monomer is incapable of forming an Fc domain or a dimer. In some embodiments, the first Fc domain monomer combines with a second Fc domain monomer to form an Fc domain or a dimer. In some embodiments, the first and second Fc domain monomers include amino acid substitutions that promote heterodimerization between the first and second domain monomers.
In some embodiments, each of the two Fc domain monomers in an Fc domain includes amino acid substitutions that promote the heterodimerization of the two monomers. In some embodiments, a SIRP-α construct is formed, for example, from a first subunit including a SIRP-α D1 variant polypeptide fused to a first Fc domain monomer and a second subunit including a second Fc domain monomer (e.g., without a SIRP-α D1 variant polypeptide or any other polypeptide). In some embodiments, a construct has a single SIRP-α D1 variant polypeptide linked to an Fc domain (e.g., single arm). In some embodiments, a construct has two SIRP-α D1 variant polypeptides linked to an Fc domain (e.g., double arm). In some embodiments, a SIRP-α D1 variant having a KD of about 500 nM is particularly useful in a double arm construct. In some embodiments, a SIRP-α D1 variant having a KD of about 50 nM is particularly useful in a double arm construct. In some embodiments, a SIRP-α D1 variant having a KD of about 5 nM is useful in a double arm construct and a single arm construct. In some embodiments, a SIRP-α D1 variant having a KD of about 500 pM is useful in a double arm construct and a single arm construct. In some embodiments, a SIRP-α D1 variant having a KD of about 100 pM is useful in a double arm construct and a single arm construct. In some embodiments, a SIRP-α D1 variant having a KD of about 50 pM is useful in a double arm construct and a single arm construct. In some embodiments, a SIRP-α D1 variant having a KD of about 10 pM is useful in a double arm construct and a single arm construct.
In some embodiments, heterodimerization of Fc domain monomers is promoted by introducing different, but compatible, substitutions in the two Fc domain monomers, such as “knob-into-hole” residue pairs and charge residue pairs. The knob and hole interaction favors heterodimer formation, whereas the knob-knob and the hole-hole interaction hinder homodimer formation due to steric clash and deletion of favorable interactions. A hole refers to a void that is created when an original amino acid in a protein is replaced with a different amino acid having a smaller side-chain volume. A knob refers to a bump that is created when an original amino acid in a protein is replaced with a different amino acid having a larger side-chain volume. For example, in some embodiments, an amino acid being replaced is in the CH3 antibody constant domain of an Fc domain monomer and involved in the dimerization of two Fc domain monomers. In some embodiments, a hole in one CH3 antibody constant domain is created to accommodate a knob in another CH3 antibody constant domain, such that the knob and hole amino acids act to promote or favor the heterodimerization of the two Fc domain monomers. In some embodiments, a hole in one CH3 antibody constant domain is created to better accommodate an original amino acid in another CH3 antibody constant domain. In some embodiments, a knob in one CH3 antibody constant domain is created to form additional interactions with original amino acids in another CH3 antibody constant domain.
In some embodiments, a hole is constructed by replacing amino acids having larger side chains such as tyrosine or tryptophan with amino acids having smaller side chains such as alanine, valine, or threonine, for example a Y407V mutation in the CH3 antibody constant domain. Similarly, in some embodiments, a knob is constructed by replacing amino acids having smaller side chains with amino acids having larger side chains, for example a T366W mutation in the CH3 antibody constant domain. In some embodiments, one Fc domain monomer includes the knob mutation T366W and the other Fc domain monomer includes hole mutations T366S, L358A, and Y407V. In some embodiments, a polypeptide of the disclosure including a high affinity SIRP-α D1 variant is fused to an Fc domain monomer including the knob mutation T366W to limit unwanted knob-knob homodimer formation. Examples of knob-into-hole amino acid pairs are included, without limitation, in Table 9 and examples of knob-into-hole Fc variants and SIRP-α-Fc fusions are provided in Table 10.
TABLE 9
Knob-into-Hole Amino Acid Pairs
Fc domain Y407T Y407A F405A T394S T366S T394W T394S T366W
monomer
1 L358A Y407T Y407A T394S
Y407V
Fc domain T366Y T366W T394W F405W T366W T366Y T366W F405W
monomer
2 F405A F405W Y407A
TABLE 10
Examples of Fc Variants and SIRP-α - Fc Fusions
SEQ
ID
NO: Amino Acid Sequence
138 EEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQWFRGAGP
GRVLIYNQRQGPFPRVTTVSDTTKRNNMDFSIRIGAITPADAGT
YYCIKFRKGSPDDVEFKSGAGTELSVRAKPSDKTHTCPPCPAPE
AAGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNW
YVDGVEVHNAKTKPREEQYASTYRVVSVLTVLHQDWLNGKEYKC
KVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSL
WCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSK
LTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
139 DKTHTCPPCPAPEAAGAPSVFLFPPKPKDTLMISRTPEVTCVVV
DVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYASTYRVVSVLTV
LHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLP
PSREEMTKNQVSLSCAVKGFYPSDIAVEWESNGQPENNYKTTPP
VLDSDGSFFLVSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKS
LSLSPGK
140 EEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQWFRGAGP
GRVLIYNQRQGPFPRVTTVSDTTKRNNMDFSIRIGAITPADAGT
YYCIKFRKGSPDDVEFKSGAGTELSVRAKPSDKTHTCPPCPAPE
AAGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNW
YVDGVEVHNAKTKPREEQYASTYRVVSVLTVLHQDWLNGKEYKC
KVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSL
SCAVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLVSK
LTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
141 DKTHTCPPCPAPEAAGAPSVFLFPPKPKDTLMISRTPEVTCVVV
DVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYASTYRVVSVLTV
LHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLP
PSREEMTKNQVSLWCLVKGFYPSDIAVEWESNGQPENNYKTTPP
VLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKS
LSLSPGK
142 EEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQWFRGAGP
GRELIYNQREGPFPRVTTVSDTTKRNNMDFSIRIGAITPADAGT
YYCVKFRKGSPDDVEFKSGAGTELSVRAKPSDKTHTCPPCPAPE
AAGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNW
YVDGVEVHNAKTKPREEQYASTYRVVSVLTVLHQDWLNGKEYKC
KVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSL
WCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSK
LTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
143 EEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQWFRGAGP
GRELIYNQREGPFPRVTTVSDTTKRNNMDFSIRIGAITPADAGT
YYCVKFRKGSPDDVEFKSGAGTELSVRAKPSDKTHTCPPCPAPE
AAGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNW
YVDGVEVHNAKTKPREEQYASTYRVVSVLTVLHQDWLNGKEYKC
KVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSL
SCAVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLVSK
LTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
145 EEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQWFRGAGP
GRELIYNQREGPFPRVTTVSDTTKRNNMDFSIRIGAITPADAGT
YYCVKFRKGSPDDVEFKSGAGTELSVRAKPSEKTHTCPECPAPE
AAGAPSVFLEPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNW
YVDGVEVHNAKTKPREEQYASTYRVVSVLTVLHQDWLNGKEYKC
KVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSL
TCEVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSK
LTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
146 EEELQVIQPDKSVLVAAGETATLRCTATSLFPVGPIQWFRGAGP
GRELIYNQRQGPFPRVTTVSDLTKRNNMDFSIRIGNITPADAGT
YYCVKFRKGSPDDVEFKSGAGTELSVRAKPSDKTHTCPPCPAPE
AAGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNW
YVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKC
KVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSL
WCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSK
LTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
147 DKTHTCPPCPAPEAAGAPSVFLFPPKPKDTLMISRTPEVTCVVV
DVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTV
LHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLP
PSREEMTKNQVSLSCAVKGFYPSDIAVEWESNGQPENNYKTTPP
VLDSDGSFFLVSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKS
LSLSPGK
148 EEELQVIQPDKSVLVAAGETATLRCTATSLFPVGPIQWFRGAGP
GRELIYNQRQGPFPRVTTVSDLTKRNNMDFSIRIGNITPADAGT
YYCVKFRKGSPDDVEFKSGAGTELSVRAKPSDKTHTCPPCPAPE
AAGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNW
YVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKC
KVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSL
SCAVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLVSK
LTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
149 DKTHTCPPCPAPEAAGAPSVFLFPPKPKDTLMISRTPEVTCVVV
DVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTV
LHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLP
PSREEMTKNQVSLWCLVKGFYPSDIAVEWESNGQPENNYKTTPP
VLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKS
LSLSPGK
In addition to the knob-into-hole strategy, in some embodiments, electrostatic steering is also used to control the dimerization of Fc domain monomers. Electrostatic steering refers to the utilization of favorable electrostatic interactions between oppositely charged amino acids in peptides, protein domains, and proteins to control the formation of higher ordered protein molecules. In particular, to control the dimerization of Fc domain monomers using electrostatic steering, one or more amino acid residues that make up the CH3-CH3 interface are replaced with positively- or negatively-charged amino acid residues such that the interaction becomes electrostatically favorable or unfavorable depending on the specific charged amino acids introduced. In some embodiments, a positively-charged amino acid in the interface, such as lysine, arginine, or histidine, is replaced with a negatively-charged amino acid such as aspartic acid or glutamic acid. In some embodiments, a negatively-charged amino acid in the interface is replaced with a positively-charged amino acid. In some embodiments, the charged amino acids are introduced to one of the interacting CH3 antibody constant domains, or both. In some embodiments, introducing charged amino acids to the interacting CH3 antibody constant domains of the two Fc domain monomers promotes the selective formation of heterodimers of Fc domain monomers as controlled by the electrostatic steering effects resulting from the interaction between charged amino acids. Examples of electrostatic steering amino acid pairs are included, without limitation, in Table 11.
TABLE 11
Electrostatic Steering Amino Acid Pairs
Fc domain K409D K409D K409E K409E K392D K392D K392E K392E K409D K370E
monomer
1 K392D K409D
K439E
Fc domain D399K D399R D399K D399R D399K D399R D399K D399R D399K D356K
monomer
2 D356K E357K
D399K
Other methods used to control the heterodimerization of Fc domain monomers, especially in the context of constructing a bispecific antibody, are available.
In some embodiments, a first Fc domain monomer and a second Fc domain monomer each includes one or more of the following amino acid substitutions: T366W, T366S, L368A, Y407V, T366Y, T394W, F405W, Y349T, Y349E, Y349V, L351T, L351H, L351N, L351K, P353S, S354D, D356K, D356R, D356S, E357K, E357R, E357Q, S364A, T366E, L368T, L368Y, L368E, K370E, K370D, K370Q, K392E, K392D, T394N, P395N, P396T, V397T, V397Q, L398T, D399K, D399R, D399N, F405T, F405H, F405R, Y407T, Y407H, Y407I, K409E, K409D, K409T, and K409I, relative to the sequence of human IgG1.
In some embodiments an Fc domain monomer comprises: (a) one of the following amino acid substitutions relative to wild type human IgG1: T366W, T366S, L368A, Y407V, T366Y, T394W, F405W, Y349T, Y349E, Y349V, L351T, L351H, L351N, L351K, P353S, S354D, D356K, D356R, D356S, E357K, E357R, E357Q, S364A, T366E, L368T, L368Y, L368E, K370E, K370D, K370Q, K392E, K392D, T394N, P395N, P396T, V397T, V397Q, L398T, D399K, D399R, D399N, F405T, F405H, F405R, Y407T, Y407H, Y407I, K409E, K409D, K409T, or K409I; or (b) (i) a N297A mutation relative to a human IgG1 Fc region; (ii) a L234A, L235A, and G237A mutation relative to a human IgG1 Fc region; (iii) a L234A, L235A, G237A, and N297A mutation relative to a human IgG1 Fc region; (iv) a N297A mutation relative to a human IgG2 Fc region; (v) a A330S and P331S mutation relative to a human IgG2 Fc region; (vi) a A330S, P331S, and N297A mutation relative to a human IgG2 Fc region; (vii) a S228P, E233P, F234V, L235A, and delG236 mutation relative to a human IgG4 Fc region; or (viii) a S228P, E233P, F234V, L235A, delG236, and N297A mutation relative to a human IgG4 Fc region. In some embodiments an Fc domain monomer comprises: (a) one of the following amino acid substitutions relative to wild type human IgG1: T366W, T366S, L368A, Y407V, T366Y, T394W, F405W, Y349T, Y349E, Y349V, L351T, L351H, L351N, L351K, P353S, S354D, D356K, D356R, D356S, E357K, E357R, E357Q, S364A, T366E, L368T, L368Y, L368E, K370E, K370D, K370Q, K392E, K392D, T394N, P395N, P396T, V397T, V397Q, L398T, D399K, D399R, D399N, F405T, F405H, F405R, Y407T, Y407H, Y407I, K409E, K409D, K409T, or K409I; and (b) further comprises (i) a N297A mutation relative to a human IgG1 Fc region; (ii) a L234A, L235A, and G237A mutation relative to a human IgG1 Fc region; (iii) a L234A, L235A, G237A, and N297A mutation relative to a human IgG1 Fc region; (iv) a N297A mutation relative to a human IgG2 Fc region; (v) a A330S and P331S mutation relative to a human IgG2 Fc region; (vi) a A330S, P331 S, and N297A mutation relative to a human IgG2 Fc region; (vii) a S228P, E233P, F234V, L235A, and delG236 mutation relative to a human IgG4 Fc region; or (viii) a S228P, E233P, F234V, L235A, delG236, and N297A mutation relative to a human IgG4 Fc region.
In some embodiments, the first and second Fc domain monomers include different amino acid substitutions. In some embodiments, the first Fc domain monomer includes T366W. In some embodiments, the second Fc domain monomer includes T366S, L368A, and Y407V. In some embodiments, the first Fc domain monomer includes D399K. In some embodiments, the second Fc domain monomer includes K409D.
IV. Serum Albumin
Disclosed herein, in some embodiments, are polypeptides comprising a signal-regulatory protein α (SIRP-α) D1 variant comprising a SIRP-α D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP-α D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP-α D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92.
Also disclosed herein, in some embodiments, are polypeptides comprising an Fc variant, wherein the Fc variant comprises an Fc domain dimer having two Fc domain monomers, wherein each Fc domain monomer independently is selected from (i) a human IgG1 Fc region consisting of mutations L234A, L235A, G237A, and N297A; (ii) a human IgG2 Fc region consisting of mutations A330S, P331S and N297A; or (iii) a human IgG4 Fc region comprising mutations S228P, E233P, F234V, L235A, delG236, and N297A.
Fusion to serum albumins can improve the pharmacokinetics of protein pharmaceuticals, and in some embodiments, polypeptides of the disclosure, including a high affinity SIRP-α D1 variant described herein, is joined with a serum albumin.
Serum albumin is a globular protein that is abundant in blood in mammals. Serum albumin is produced in the liver and can constitute about half of the blood serum proteins. It is monomeric and soluble in the blood. Some of the most crucial functions of serum albumin include transporting hormones, fatty acids, and other proteins in the body, buffering pH, and maintaining osmotic pressure needed for proper distribution of bodily fluids between blood vessels and body tissues. In preferred embodiments, serum albumin is human serum albumin (HSA). In some embodiments, an HSA is joined to the C-terminus of the polypeptide of the disclosure to increase the serum half-life of the polypeptide. In some embodiments, the N-terminus of an HSA is joined to the C-terminus of the polypeptide of the disclosure. In some embodiments, a HSA is joined, either directly or through a linker, to the C-terminus of the polypeptide. In some embodiments, an HSA is joined, either directly or through a linker, to the N-terminus of the polypeptide.
In some embodiments, a human serum albumin comprises the sequence of amino acids (aa) 25-609 of UniProt ID NO: P02768 (SEQ ID NO: 12) as shown in Table 12. In some embodiments, the HSA joined to a high affinity SIRP-α D1 variant (e.g., any SIRP-α D1 variant described in Tables 2, 5, and 6) includes amino acids 25-609 (SEQ ID NO: 12) of the sequence of UniProt ID NO: P02768. In some embodiments, the HSA includes C34S or K573P substitutions, relative to SEQ ID NO: 12. In some embodiments, the HSA includes C34S and K573P substitutions, relative to SEQ ID NO: 12.
TABLE 12
Sequence of HSA
SEQ
ID Descrip-
NO: tion Amino Acid Sequence
12 UniProt DAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQCP
ID NO: FEDHVKLVNEVTEFAKTCVADESAENCDKSLHTLF
P02768, GDKLCTVATLRETYGEMADCCAKQEPERNECFLQ
AA 25- HKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKY
609 LYEIARRHPYFYAPELLFFAKRYKAAFTECCQAAD
KAACLLPKLDELRDEGKASSAKQRLKCASLQKFGE
RAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVH
TECCHGDLLECADDRADLAKYICENQDSISSKLKE
CCEKPLLEKSHCIAEVENDEMPADLPSLAADFVESK
DVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLL
RLAKTYETTLEKCCAAADPHECYAKVFDEFKPLVE
EPQNLIKQNCELFEQLGEYKFQNALLVRYTKKVPQ
VSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAED
YLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRP
CFSALEVDETYVPKEFNAETFTFHADICTLSEKERQI
KKQTALVELVKHKPKATKEQLKAVMDDFAAFVE
KCCKADDKETCFAEEGKKLVAASQAALGL
In some embodiments, a serum albumin is fused genetically to a polypeptide of the disclosure or joined to the polypeptide through chemical means, e.g., chemical conjugation. In some embodiments, a spacer is inserted between the polypeptide and the HSA. Some examples of spacers are described in detail elsewhere herein. In some embodiments, a spacer is A or AAAL SEQ ID NO: 178). In some embodiments, the fusion of an HSA in a polypeptide of the disclosure leads to prolonged retention of the polypeptide as well as increases in half-life.
Polypeptides comprising a SIRP-α D1 variant polypeptide and a fused HSA include, but are not limited to, SEQ ID NOS: 150-159 provided in Table 13.
TABLE 13
Polypeptides Comprising SIRP-α Variants Fused to
HSA
SEQ
ID
NO: Amino Acid Sequence
150 EEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQWFRGAGPG
RVLIYNQRQGPFPRVTTVSDTTKRNNMDFSIRIGNITPADAGTYY
CIKFRKGSPDDVEFKSGAGTELSVRAKPSDAHKSEVAHRFKDLGE
ENFKALVLIAFAQYLQQSPFEDHVKLVNEVTEFAKTCVADESAEN
CDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNECFLQHK
DDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFYA
PELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQ
RLKCASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKV
HTECCHGDLLECADDRADLAKYICENQDSISSKLKECCEKPLLEK
SHCIAEVENDEMPADLPSLAADFVESKDVCKNYAEAKDVFLGMFL
YEYARRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAKVFDE
FKPLVEEPQNLIKQNCELFEQLGEYKFQNALLVRYTKKVPQVSTP
TLVEVSRNLGKVGSKCCKHPEAKRMPCAEDYLSVVLNQLCVLHEK
TPVSDRVTKCCTESLVNRRPCFSALEVDETYVPKEFNAETFTFHA
DICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDDFAAFVE
KCCKADDKETCFAEEGKKLVAASQAALGL
151 EEELQVIQPDKSVLVAAGETATLRCTATSLFPVGPIQWFRGAGPG
RELIYNQRQGPFPRVTTVSDLTKRNNMDFSIRIGNITPADAGTYY
CVKFRKGSPDDVEFKSGAGTELSVRAKPSDAHKSEVAHRFKDLGE
ENFKALVLIAFAQYLQQSPFEDHVKLVNEVTEFAKTCVADESAEN
CDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNECFLQHK
DDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFYA
PELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQ
RLKCASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKV
HTECCHGDLLECADDRADLAKYICENQDSISSKLKECCEKPLLEK
SHCIAEVENDEMPADLPSLAADFVESKDVCKNYAEAKDVFLGMFL
YEYARRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAKVFDE
FKPLVEEPQNLIKQNCELFEQLGEYKFQNALLVRYTKKVPQVSTP
TLVEVSRNLGKVGSKCCKHPEAKRMPCAEDYLSVVLNQLCVLHEK
TPVSDRVTKCCTESLVNRRPCFSALEVDETYVPKEFNAETFTFHA
DICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDDFAAFVE
KCCKADDKETCFAEEGKKLVAASQAALGL
152 EEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQWFRGAGPG
RVLIYNQRQGPFPRVTTVSDTTKRNNMDFSIRIGAITPADAGTYY
CIKFRKGSPDDVEFKSGAGTELSVRAKPSDAHKSEVAHRFKDLGE
ENFKALVLIAFAQYLQQSPFEDHVKLVNEVTEFAKTCVADESAEN
CDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNECFLQHK
DDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFYA
PELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQ
RLKCASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKV
HTECCHGDLLECADDRADLAKYICENQDSISSKLKECCEKPLLEK
SHCIAEVENDEMPADLPSLAADFVESKDVCKNYAEAKDVFLGMFL
YEYARRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAKVFDE
FKPLVEEPQNLIKQNCELFEQLGEYKFQNALLVRYTKKVPQVSTP
TLVEVSRNLGKVGSKCCKHPEAKRMPCAEDYLSVVLNQLCVLHEK
TPVSDRVTKCCTESLVNRRPCFSALEVDETYVPKEFNAETFTFHA
DICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDDFAAFVE
KCCKADDKETCFAEEGKKLVAASQAALGL
153 EEELQVIQPDKSVLVAAGETATLRCTATSLFPVGPIQWFRGAGPG
RELIYNQRQGPFPRVTTVSDLTKRNNMDFSIRIGAITPADAGTYY
CVKFRKGSPDDVEFKSGAGTELSVRAKPSDAHKSEVAHRFKDLGE
ENFKALVLIAFAQYLQQSPFEDHVKLVNEVTEFAKTCVADESAEN
CDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNECFLQHK
DDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFYA
PELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQ
RLKCASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKV
HTECCHGDLLECADDRADLAKYICENQDSISSKLKECCEKPLLEK
SHCIAEVENDEMPADLPSLAADFVESKDVCKNYAEAKDVFLGMFL
YEYARRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAKVFDE
FKPLVEEPQNLIKQNCELFEQLGEYKFQNALLVRYTKKVPQVSTP
TLVEVSRNLGKVGSKCCKHPEAKRMPCAEDYLSVVLNQLCVLHEK
TPVSDRVTKCCTESLVNRRPCFSALEVDETYVPKEFNAETFTFHA
DICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDDFAAFVE
KCCKADDKETCFAEEGKKLVAASQAALGL
154 EEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQWFRGAGPG
RVLIYNQREGPFPRVTTVSDTTKRNNMDFSIRIGAITPADAGTYY
CIKFRKGSPDDVEFKSGAGTELSVRAKPSDAHKSEVAHRFKDLGE
ENFKALVLIAFAQYLQQSPFEDHVKLVNEVTEFAKTCVADESAEN
CDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNECFLQHK
DDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFYA
PELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQ
RLKCASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKV
HTECCHGDLLECADDRADLAKYICENQDSISSKLKECCEKPLLEK
SHCIAEVENDEMPADLPSLAADFVESKDVCKNYAEAKDVFLGMFL
YEYARRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAKVFDE
FKPLVEEPQNLIKQNCELFEQLGEYKFQNALLVRYTKKVPQVSTP
TLVEVSRNLGKVGSKCCKHPEAKRMPCAEDYLSVVLNQLCVLHEK
TPVSDRVTKCCTESLVNRRPCFSALEVDETYVPKEFNAETFTFHA
DICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDDFAAFVE
KCCKADDKETCFAEEGKKLVAASQAALGL
155 EEELQVIQPDKSVLVAAGETATLRCTATSLFPVGPIQWFRGAGPG
RELIYNQREGPFPRVTTVSDLTKRNNMDFSIRIGAITPADAGTYY
CVKFRKGSPDDVEFKSGAGTELSVRAKPSDAHKSEVAHRFKDLGE
ENFKALVLIAFAQYLQQSPFEDHVKLVNEVTEFAKTCVADESAEN
CDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNECFLQHK
DDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFYA
PELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQ
RLKCASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKV
HTECCHGDLLECADDRADLAKYICENQDSISSKLKECCEKPLLEK
SHCIAEVENDEMPADLPSLAADFVESKDVCKNYAEAKDVFLGMFL
YEYARRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAKVFDE
FKPLVEEPQNLIKQNCELFEQLGEYKFQNALLVRYTKKVPQVSTP
TLVEVSRNLGKVGSKCCKHPEAKRMPCAEDYLSVVLNQLCVLHEK
TPVSDRVTKCCTESLVNRRPCFSALEVDETYVPKEFNAETFTFHA
DICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDDFAAFVE
KCCKADDKETCFAEEGKKLVAASQAALGL
156 EEELQVIQPDKSVLVAAGETATLRCTITSLFPVGPIQWFRGAGPG
RELIYNQREGPFPRVTTVSDLTKRNNMDFSIRIGAITPADAGTYY
CVKFRKGSPDDVEFKSGAGTELSVRAKPSDAHKSEVAHRFKDLGE
ENFKALVLIAFAQYLQQSPFEDHVKLVNEVTEFAKTCVADESAEN
CDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNECFLQHK
DDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFYA
PELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQ
RLKCASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKV
HTECCHGDLLECADDRADLAKYICENQDSISSKLKECCEKPLLEK
SHCIAEVENDEMPADLPSLAADFVESKDVCKNYAEAKDVFLGMFL
YEYARRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAKVFDE
FKPLVEEPQNLIKQNCELFEQLGEYKFQNALLVRYTKKVPQVSTP
TLVEVSRNLGKVGSKCCKHPEAKRMPCAEDYLSVVLNQLCVLHEK
TPVSDRVTKCCTESLVNRRPCFSALEVDETYVPKEFNAETFTFHA
DICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDDFAAFVE
KCCKADDKETCFAEEGKKLVAASQAALGL
157 EEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQWFRGAGPG
RELIYNQREGPFPRVTTVSDLTKRNNMDFSIRIGAITPADAGTYY
CVKFRKGSPDDVEFKSGAGTELSVRAKPSDAHKSEVAHRFKDLGE
ENFKALVLIAFAQYLQQSPFEDHVKLVNEVTEFAKTCVADESAEN
CDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNECFLQHK
DDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFYA
PELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQ
RLKCASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKV
HTECCHGDLLECADDRADLAKYICENQDSISSKLKECCEKPLLEK
SHCIAEVENDEMPADLPSLAADFVESKDVCKNYAEAKDVFLGMFL
YEYARRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAKVFDE
FKPLVEEPQNLIKQNCELFEQLGEYKFQNALLVRYTKKVPQVSTP
TLVEVSRNLGKVGSKCCKHPEAKRMPCAEDYLSVVLNQLCVLHEK
TPVSDRVTKCCTESLVNRRPCFSALEVDETYVPKEFNAETFTFHA
DICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDDFAAFVE
KCCKADDKETCFAEEGKKLVAASQAALGL
158 EEELQVIQPDKSVLVAAGETATLRCTITSLFPVGPIQWFRGAGPG
RELIYNQREGPFPRVTTVSDTTKRNNMDFSIRIGAITPADAGTYY
CVKFRKGSPDDVEFKSGAGTELSVRAKPSDAHKSEVAHRFKDLGE
ENFKALVLIAFAQYLQQSPFEDHVKLVNEVTEFAKTCVADESAEN
CDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNECFLQHK
DDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFYA
PELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQ
RLKCASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKV
HTECCHGDLLECADDRADLAKYICENQDSISSKLKECCEKPLLEK
SHCIAEVENDEMPADLPSLAADFVESKDVCKNYAEAKDVFLGMFL
YEYARRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAKVFDE
FKPLVEEPQNLIKQNCELFEQLGEYKFQNALLVRYTKKVPQVSTP
TLVEVSRNLGKVGSKCCKHPEAKRMPCAEDYLSVVLNQLCVLHEK
TPVSDRVTKCCTESLVNRRPCFSALEVDETYVPKEFNAETFTFHA
DICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDDFAAFVE
KCCKADDKETCFAEEGKKLVAASQAALGL
159 EEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQWFRGAGPG
RELIYNQREGPFPRVTTVSDTTKRNNMDFSIRIGAITPADAGTYY
CVKFRKGSPDDVEFKSGAGTELSVRAKPSDAHKSEVAHRFKDLGE
ENFKALVLIAFAQYLQQSPFEDHVKLVNEVTEFAKTCVADESAEN
CDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNECFLQHK
DDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFYA
PELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQ
RLKCASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKV
HTECCHGDLLECADDRADLAKYICENQDSISSKLKECCEKPLLEK
SHCIAEVENDEMPADLPSLAADFVESKDVCKNYAEAKDVFLGMFL
YEYARRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAKVFDE
FKPLVEEPQNLIKQNCELFEQLGEYKFQNALLVRYTKKVPQVSTP
TLVEVSRNLGKVGSKCCKHPEAKRMPCAEDYLSVVLNQLCVLHEK
TPVSDRVTKCCTESLVNRRPCFSALEVDETYVPKEFNAETFTFHA
DICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDDFAAFVE
KCCKADDKETCFAEEGKKLVAASQAALGL
In some embodiments, the polypeptide includes a high affinity SIRP-α D1 domain that has at least 85% sequence identity (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity) to any variant provided in Table 13.
In some embodiments, the polypeptide includes a high affinity SIRP-α D1 domain that has at least 85% sequence identity (e.g., at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity) to SEQ ID NO: 154, 155, and 159 in Table 13.
V. Albumin-Binding Peptide
Disclosed herein, in some embodiments, are polypeptides comprising a signal-regulatory protein α (SIRP-α) D1 variant comprising a SIRP-α D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP-α D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP-α D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92.
Also disclosed herein, in some embodiments, are polypeptides comprising an Fc variant, wherein the Fc variant comprises an Fc domain dimer having two Fc domain monomers, wherein each Fc domain monomer independently is selected from (i) a human IgG1 Fc region consisting of mutations L234A, L235A, G237A, and N297A; (ii) a human IgG2 Fc region consisting of mutations A330S, P331S and N297A; or (iii) a human IgG4 Fc region comprising mutations S228P, E233P, F234V, L235A, delG236, and N297A.
Binding to serum proteins can improve the pharmacokinetics of protein pharmaceuticals, and in particular, in some embodiments, the polypeptides described herein are fused with serum protein-binding peptides or proteins.
As used herein, the term “albumin-binding peptide” refers to an amino acid sequence of about 12 to 16 amino acids that has affinity for and functions to bind a serum albumin protein. In some embodiments, an albumin-binding peptide originates from human, mouse, or rat.
In some embodiments, a polypeptide of the disclosure including a high affinity SIRP-α D1 variant (e.g., any variant provided in Tables 2, 5, and 6) is fused to an albumin-binding peptide that displays binding activity to serum albumin to increase the half-life of the polypeptide. Various albumin-binding peptides that can be used in the methods and compositions described here are available. In some embodiments, the albumin binding peptide includes the sequence DICLPRWGCLW (SEQ ID NO: 160). In some embodiments, an albumin-binding peptide is fused genetically to a polypeptide of the disclosure or attached to the polypeptide through chemical means, e.g., chemical conjugation.
In some embodiments, a linker (e.g., a spacer) is inserted between the polypeptide and the albumin-binding peptide to allow for additional structural and spatial flexibility of the fusion protein. Specific linkers (e.g., a spacer) and their amino acid sequences are described in detail further herein. In some embodiments, an albumin-binding peptide is fused to the N- or C-terminus of a polypeptide of the disclosure. In one example, the N-terminus of the albumin-binding peptide is directly fused to the C-terminus of a polypeptide of the disclosure through a peptide bond. In another example, the C-terminus of the albumin-binding peptide is directly fused to the N-terminus of a polypeptide of the disclosure through a peptide bond. In some embodiments, the fusion of an albumin-binding peptide to a polypeptide of the disclosure leads to prolonged retention of the polypeptide through its binding to serum albumin.
VI. Polyethylene Glycol (PEG) Polymer
Disclosed herein, in some embodiments, are polypeptides comprising a signal-regulatory protein α (SIRP-α) D1 variant comprising a SIRP-α D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP-α D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP-α D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92.
Also disclosed herein, in some embodiments, are polypeptides comprising an Fc variant, wherein the Fc variant comprises an Fc domain dimer having two Fc domain monomers, wherein each Fc domain monomer independently is selected from (i) a human IgG1 Fc region consisting of mutations L234A, L235A, G237A, and N297A; (ii) a human IgG2 Fc region consisting of mutations A330S, P331S and N297A; or (iii) a human IgG4 Fc region comprising mutations S228P, E233P, F234V, L235A, delG236, and N297A.
In some embodiments, a polypeptide including a high affinity SIRP-α D1 domain (e.g., any variant provided in Tables 2, 5, and 6) is fused to a polymer (e.g., polyethylene glycol, PEG). In some embodiments, the attachment of a polymer to a protein pharmaceutical “masks” the protein pharmaceutical from the host's immune system. In addition, in some embodiments, certain polymers, such as hydrophilic polymers, provide water solubility to hydrophobic proteins and drugs. For example, in some embodiments, such polymers include PEG, polysialic acid chain, and PAS chain molecules. In some embodiments, a polymer such as PEG, is covalently attached to a cysteine substitution or addition in the polypeptide. In some embodiments, the cysteine substitution in the polypeptide is I7C, A16C, S20C, T20C, A45C, G45C, G79C, S79C, or A84C, relative to the sequence of any one of the sequences provided in Tables 2, 5, and 6. In some embodiments, the addition of a cysteine residue in the polypeptide is introduced using peptide synthesis, genetic modification, molecular cloning, or any combinations thereof. In some embodiments, the polymer, for example PEG, is attached to the cysteine residue using cysteine-maleimide conjugation. In some embodiments, a polymer such as PEG, is covalently attached to the polypeptide including a high affinity SIRP-α D1 variant either at the N- or C-terminus or at an internal location, using conventional chemical methods such as chemical conjugation.
VII. Bispecific Construct
Disclosed herein, in some embodiments, are polypeptides comprising a signal-regulatory protein α (SIRP-α) D1 variant comprising a SIRP-α D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP-α D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP-α D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92.
Also disclosed herein, in some embodiments, are polypeptides comprising an Fc variant, wherein the Fc variant comprises an Fc domain dimer having two Fc domain monomers, wherein each Fc domain monomer independently is selected from (i) a human IgG1 Fc region consisting of mutations L234A, L235A, G237A, and N297A; (ii) a human IgG2 Fc region consisting of mutations A330S, P331S and N297A; or (iii) a human IgG4 Fc region comprising mutations S228P, E233P, F234V, L235A, delG236, and N297A.
In some embodiments, a polypeptide having a high affinity SIRP-α D1 variant (e.g., any of the variants provided in Tables 2, 5, and 6) comprises a bispecific construct. A bispecific construct refers to a construct that has two target-interacting domains. In some embodiments, a bispecific construct includes an Fc domain and two target-interacting domains: (1) a SIRP-α D1 domain or variant thereof (e.g., any of the variants provided in Tables 2, 5, and 6) and (2) an antibody variable domain. In some embodiments, a bispecific construct includes a first polypeptide and a second polypeptide. In some embodiments, the first polypeptide has the formula A-L-B, wherein A includes a SIRP-α D1 domain or variant thereof, L is a linker, and B includes a first Fc domain monomer. In some embodiments, the second polypeptide has the formula A′-L′-B′, wherein A′ includes an antibody variable domain, L′ is a linker; and B′ includes a second Fc domain monomer. In some embodiments, the orientation of the first and second polypeptides is B-L-A and B′-L′-A′, respectively. In some embodiments, the first and second Fc domain monomers combine to form the Fc domain in the bispecific construct. In some embodiments, a bispecific construct is of any immunoglobulin antibody isotypes (e.g., IgG, IgE, IgM, IgA, and IgD). A variant of a SIRP-α D1 domain includes the D domain of a wild-type human SIRP-α and one or more amino acid substitutions relative to the wild-type D1 domains (e.g., any SIRP-α D1 variant as described in Tables 2, 5, and 6). In some embodiments, a SIRP-α D1 variant binds with higher binding affinity to CD47 than does a wild-type human SIRP-α D1 domain. In some embodiments, the antibody variable domain in a bispecific construct targets a cell antigen (e.g., a cell antigen on a cancer cell).
An antibody variable domain refers to the portions of the light and heavy chains of an antibody that include amino acid sequences of complementary determining regions (CDRs, e.g., CDR L1, CDR L2, CDR L3, CDR H1, CDR H2, and CDR H3) and framework regions (FRs). The variable domain of the antibody can confer on the antibody the ability to bind to specific antigens. Many different antibody variable domain molecules can be constructed. In some embodiments, the antibody variable domain molecules used includes, but is not limited to, single-chain Fv.
In some embodiments, the antibody variable domain in a bispecific construct targets a cell antigen (e.g., a cell antigen on a cancer cell or on an immune cell). Some proteins are expressed at higher levels in cancer cells than in non-cancer cells. For example, a cancer antigen is a protein that is expressed preferentially by cancer cells (e.g., it is expressed at higher levels on cancer cells than on non-cancer cells) and in some instances it is expressed solely by cancer cells. In some embodiments, proteins, e.g., proteins expressed by cancer cells, that are targeted by an antibody variable domain forming an Fc domain with a high affinity SIRP-α domain or variant thereof include, but are not limited to: 5T4, AGS-16, ALK1, ANG-2, B7-H3, B7-H4, c-fms, c-Met, CA6, CD123, CD19, CD20, CD22, EpCAM, CD30, CD32b, CD33, CD37, CD38, CD40, CD52, CD70, CD74, CD79b, CD98, CEA, CEACAM5, CLDN18.2, CLDN6, CS1, CXCR4, DLL-4, EGFR, EGP-1, ENPP3, EphA3, ETBR, FGFR2, fibronectin, FR-alpha, GCC, GD2, glypican-3, GPNMB, HER-2, HER3, HLA-DR, ICAM-1, IGF-1R, IL-3R, LIV-1, mesothelin, MUC16, MUC1, NaPi2b, Nectin-4, Notch 2, Notch 1, PD-L1, PD-L2, PDGFR-a, PS, PSMA, SLTRK6, STEAP1, TEM1, VEGFR, CD25, CD27L, DKK-1, or CSF-1R. In some embodiments, the antibody variable domain in the bispecific construct is not engineered to bind a human protein.
In some embodiments, each of the first and second Fc domain monomers in the Fc domain of the bispecific construct includes one or more amino acid substitutions that promote the heterodimerization of the first and second Fc domain monomers. Methods of promoting heterodimerization of Fc domain monomers are described in detail further herein, see, e.g., knob-into-hole strategy and electrostatic steering strategy.
In some embodiments, the Fc domain of the bispecific construct is mutated to lack one or more effector functions, typical of a “dead Fc domain.” In some embodiments, the Fc domain of the bispecific construct is from an IgG1 antibody and includes amino acid substitutions L14A, L15A, and G17A, relative to the sequence of SEQ ID NO: 161 (Table 14) to reduce the interaction or binding between the Fc domain and an Fcγ receptor. In some embodiments, an Fc domain monomer is from an IgG1 antibody and includes one or more of amino acid substitutions L234A, L235A, G237A, and N297A (as designated according to the EU numbering system per Kabat et al., 1991. In some embodiments, the Fc variants described herein are minimally glycosylated or have reduced glycosylation. In some embodiments, deglycosylation is accomplished with a mutation of N297A, or by mutating N297 to any amino acid which is not N (as designated according to the EU numbering system per Kabat, et al. (1991)). In some embodiments, the bispecific construct is designed such that it has preferential binding to proteins (e.g., receptors such as Fc receptors) expressed by different cell types. Studies have demonstrated that amino acid substitutions in the hinge, constant domains (e.g., CH2 and CH3 constant domains), or hinge and constant domains of an antibody can efficiently alter the binding affinities of the antibody towards specific receptors (e.g., Fc receptors) expressed on different types of cells (e.g., regulatory T-cells and effector T-cells). IgG2 having amino acid substitutions A111S and P112S (relative to SEQ ID NO: 162, Table 14) display significantly reduced binding to FcγRIIIa 131 H compared to wild-type IgG2. In some embodiments, the Fc variants herein are minimally glycosylated or have reduced glycosylation. In some embodiments, deglycosylation is accomplished with a mutation of N297A, or by mutating N297 to any amino acid which is not N (as designated according to the EU numbering system per Kabat, et al. (1991)). In some embodiments, a bispecific construct includes an Fc domain of the IgG2 or IgG4 subclass. In some embodiments, a bispecific construct including an Fc domain of an IgG2 subclass includes amino acid substitutions A111S and P112S, relative to SEQ ID NO: 162 (Table 14). In some embodiments, the Fc variant comprises a human IgG2 Fc sequence comprising one or more of A330S, P331S and N297A amino acid substitutions (as designated according to the EU numbering system per Kabat, et al. (1991)).
TABLE 14
IgG Amino Acid Sequences
SEQ
ID
NO: Amino Acid Sequence
161 DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD
VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLH
QDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR
EEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDS
DGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSP
G
162 ERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVV
DVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVV
HQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPS
REEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLD
SDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
PGK
An example of a SIRP-α construct comprising a SIRP-α D1 domain or variant thereof joined to a first Fc domain monomer by way of a linker and a second Fc domain monomer, in which the first and second Fc domain monomers combine to form an Fc domain is shown in FIG. 1 . In some embodiments, there is no protein or antibody variable domain attached to the second Fc monomer. In some embodiments, a SIRP-α construct includes a SIRP-α D1 domain or variant thereof joined to a first Fc domain monomer by way of a linker and an antibody variable domain joined to a second Fc domain monomer by way of a linker, in which the first and second Fc domain monomers combine to form an Fc domain (as shown in FIG. 2 ). In some embodiments, a SIRP-α construct includes a SIRP-α D1 domain or variant thereof joined to a first Fc domain monomer by way of a linker and a therapeutic protein (e.g., a cytokine, an interleukin, an antigen, a steroid, an anti-inflammatory agent, or an immunomodulatory agent) joined to a second Fc domain monomer by way of a linker, in which the first and second Fc domain monomers combine to form an Fc domain (as shown in FIG. 3 ). In some embodiments, each of the two Fc domain monomers in the Fc domain of the SIRP-α constructs described previously (e.g., the SIRP-α constructs as shown in FIGS. 1-3 ), include amino acid substitutions that promote the heterodimerization of the two monomers. Different strategies (e.g., knob-into-hole strategy, electrostatic steering strategy) and Fc domain amino acid substitutions that promote the heterodimerization of two Fc domain monomers are described in detail herein. For example, FIG. 4A illustrates a SIRP-α construct having a SIRP-α D1 domain or variant thereof joined to an Fc domain monomer including a knob mutation, e.g., T366W, to limit unwanted knob-knob homodimer formation. FIG. 4B illustrates a SIRP-α construct having a having a SIRP-α D1 domain or variant thereof joined to an Fc domain monomer including hole mutations, e.g., T366S, L358A, and Y407V. In some embodiments, similar Fc domain heterodimerization strategies are applied to the Fc domains in the constructs described in FIGS. 2 and 3 . In some embodiments, a SIRP-α construct includes a fusion protein of a SIRP-α D1 domain or variant thereof joined to an Fc domain monomer (as shown in FIG. 5A). In some embodiments, this fusion protein forms a homodimer (as shown in FIG. 5B).
Fc variants of the disclosure coupled with a fusion partner preferably exhibit reduced or ablated binding to at least one of Fcγ receptors CD16a, CD32a, CD32b, CD32c, and CD64 as compared to a similar polypeptide construct comprising the native or wild-type (non-mutated) antibody Fc region. In some cases, the Fc variant or fusion partner described herein exhibits reduced or ablated binding to the CD16a, CD32a, CD32b, CD32c, and CD64 Fcγ receptors.
In some embodiments, Fc variants of the disclosure coupled with a fusion partner exhibit reduced binding to complement component C1q and CDC compared to a similar polypeptide construct comprising the native or wild-type (non-mutated) Fc region. In some cases, the Fc variant exhibits at least a 5%, 10%, 15%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or greater reduction in C1q binding compared to a polypeptide construct comprising a wild-type Fc region. In some cases, the Fc variant exhibits reduced CDC compared to a polypeptide construct comprising the native or wild-type (non-mutated) Fc region. In some embodiments, the Fc variant exhibits at least a 5%, 10%, 15%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or greater reduction in CDC compared to a polypeptide construct comprising a wild-type Fc region.
VIII. Linkers
Disclosed herein, in some embodiments, are polypeptides comprising a signal-regulatory protein α (SIRP-α) D1 variant comprising a SIRP-α D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP-α D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP-α D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92.
Also disclosed herein, in some embodiments, are polypeptides comprising an Fc variant, wherein the Fc variant comprises an Fc domain dimer having two Fc domain monomers, wherein each Fc domain monomer independently is selected from (i) a human IgG1 Fc region consisting of mutations L234A, L235A, G237A, and N297A; (ii) a human IgG2 Fc region consisting of mutations A330S, P331S and N297A; or (iii) a human IgG4 Fc region comprising mutations S228P, E233P, F234V, L235A, delG236, and N297A.
In the present disclosure, a linker is used to describe a linkage or connection between polypeptides or protein domains or associated non-protein moieties. In some embodiments, a linker is a linkage or connection between an Fc domain monomer, an albumin-binding peptide, or an HSA, and a high affinity SIRP-α D1 variant. In some embodiments, the linker connects the C-terminus of the SIRP-α D1 variant and the N-terminus of the Fc domain monomer, the albumin-binding peptide, or the HSA, such that the two polypeptides are joined to each other in tandem series.
In some embodiments, a linker is a simple covalent bond, e.g., a peptide bond, a synthetic polymer such as a polyethylene glycol (PEG) polymer, or any kind of bond created from a chemical reaction, e.g. chemical conjugation. When a linker is a peptide bond, in some embodiments, the carboxylic acid group at the C-terminus of one protein domain reacts with the amino group at the N-terminus of another protein domain in a condensation reaction to form a peptide bond. In some embodiments, the peptide bond is formed from synthetic means through a conventional organic chemistry reaction, or by natural production from a host cell, wherein a nucleic acid molecule encoding the DNA sequences of both proteins (e.g., an Fc domain monomer and a high affinity SIRP-α D1 variant) in tandem series can be directly transcribed and translated into a contiguous polypeptide encoding both proteins by the necessary molecular machineries (e.g., DNA polymerase and ribosome) in the host cell.
When a linker is a synthetic polymer (e.g., a PEG polymer), in some embodiments, the polymer is functionalized with reactive chemical functional groups at each end to react with the terminal amino acids at the connecting ends of two proteins.
When a linker (except peptide bond mentioned above) is made from a chemical reaction, in some embodiments, chemical functional groups (e.g., amine, carboxylic acid, ester, azide, or other functional groups), are attached synthetically to the C-terminus of one protein and the N-terminus of another protein, respectively. In some embodiments, the two functional groups then react through synthetic chemistry means to form a chemical bond, thus connecting the two proteins together.
Spacers
In the present disclosure, in some embodiments, a linker between an Fc domain monomer, an albumin-binding peptide, or an HSA, and a polypeptide of the disclosure, is an amino acid spacer including about 1-200 amino acids. Suitable peptide spacers include peptide linkers containing flexible amino acid residues such as glycine and serine. Examples of linker sequences are provided in Table 15. In some embodiments, a spacer contains motifs, e.g., multiple or repeating motifs, of GS, GG, GGS, GGG, GGGGS (SEQ ID NO: 163), GGSG (SEQ ID NO: 164), or SGGG (SEQ ID NO: 165). In some embodiments, a spacer contains 2 to 12 amino acids including motifs of GS, e.g., GS, GSGS (SEQ ID NO: 166), GSGSGS (SEQ ID NO: 167), GSGSGSGS (SEQ ID NO: 168), GSGSGSGSGS (SEQ ID NO: 169), or GSGSGSGSGSGS (SEQ ID NO: 170). In some embodiments, a spacer contains 3 to 12 amino acids including motifs of GGS, e.g., GGS, GGSGGS (SEQ ID NO: 171), GGSGGSGGS (SEQ ID NO: 172), and GGSGGSGGSGGS (SEQ ID NO: 173). In some embodiments, a spacer contains 4 to 12 amino acids including motifs of GGSG (SEQ ID NO: 164), e.g., GGSG (SEQ ID NO: 164), GGSGGGSG (SEQ ID NO: 174), or GGSGGGSGGGSG (SEQ ID NO: 175). In some embodiments, a spacer contains motifs of GGGGS (SEQ ID NO: 163), e.g., GGGGSGGGGSGGGGS (SEQ ID NO: 176). In some embodiments, a spacer contains amino acids other than glycine and serine, e.g., AAS (SEQ ID NO: 177), AAAL (SEQ ID NO: 178), AAAK (SEQ ID NO: 179), AAAR (SEQ ID NO: 180), EGKSSGSGSESKST (SEQ ID NO: 181), GSAGSAAGSGEF (SEQ ID NO: 182), AEAAAKEAAAKA (SEQ ID NO: 183), KESGSVSSEQLAQFRSLD (SEQ ID NO: 184), GGGGAGGGG (SEQ ID NO: 185), GENLYFQSGG (SEQ ID NO: 186), SACYCELS (SEQ ID NO: 187), RSIAT (SEQ ID NO: 188), RPACKIPNDLKQKVMNH (SEQ ID NO: 189), GGSAGGSGSGSSGGSSGASGTGTAGGTGSGSGTGSG (SEQ ID NO: 190), AAANSSIDLISVPVDSR (SEQ ID NO: 191), or GGSGGGSEGGGSEGGGSEGGGSEGGGSEGGGSGGGS (SEQ ID NO: 192).
In some embodiments, a spacer contains motifs, e.g., multiple or repeating motifs, of EAAAK (SEQ ID NO: 193). In some embodiments, a spacer contains motifs, e.g., multiple or repeating motifs, of proline-rich sequences such as (XP)n, in which X is any amino acid (e.g., A, K, or E) and n is from 1-5, and PAPAP (SEQ ID NO: 194).
TABLE 15
Linker Sequences
SEQ
ID
NO: Amino Acid Sequence
163 GGGGS
164 GGSG
165 SGGG
166 GSGS
167 GSGSGS
168 GSGSGSGS
169 GSGSGSGSGS
170 GSGSGSGSGSGS
171 GGSGGS
172 GGSGGSGGS
173 GGSGGSGGSGGS
174 GGSGGGSG
175 GGSGGGSGGGSG
176 GGGGSGGGGSGGGGS
177 AAS
178 AAAL
179 AAAK
180 AAAR
181 EGKSSGSGSESKST
182 GSAGSAAGSGEF
183 AEAAAKEAAAKA
184 KESGSVSSEQLAQFRSLD
185 GGGGAGGGG
186 GENLYFQSGG
187 SACYCELS
188 RSIAT
189 RPACKIPNDLKQKVMNH
190 GGSAGGSGSGSSGGSSGASGTGTAGGTGSGSGTGSG
191 AAANSSIDLISVPVDSR
192 GGSGGGSEGGGSEGGGSEGGGSEGGGSEGGGSGGGS
193 EAAAK
194 PAPAP
In some embodiments, the length of the peptide spacer and the amino acids used is adjusted depending on the two proteins involved and the degree of flexibility desired in the final protein fusion polypeptide. In some embodiments, the length of the spacer is adjusted to ensure proper protein folding and avoid aggregate formation. In some embodiments, a spacer such as a spacer between an HSA and a polypeptide disclosed herein, is A or AAAL (SEQ ID NO: 178).
IX. Vectors, Host Cells, and Protein Production
Disclosed herein, in some embodiments, are polypeptides comprising a signal-regulatory protein α (SIRP-α) D1 variant comprising a SIRP-α D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP-α D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP-α D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92.
Also disclosed herein, in some embodiments, are polypeptides comprising an Fc variant, wherein the Fc variant comprises an Fc domain dimer having two Fc domain monomers, wherein each Fc domain monomer independently is selected from (i) a human IgG1 Fc region consisting of mutations L234A, L235A, G237A, and N297A; (ii) a human IgG2 Fc region consisting of mutations A330S, P331S and N297A; or (iii) a human IgG4 Fc region comprising mutations S228P, E233P, F234V, L235A, delG236, and N297A.
In some embodiments, the polypeptides of the disclosure are produced from a host cell. A host cell refers to a vehicle that includes the necessary cellular components, e.g., organelles, needed to express the polypeptides and fusion polypeptides described herein from their corresponding nucleic acids. In some embodiments, the nucleic acids are included in nucleic acid vectors introduced into the host cell by transformation, transfection, electroporation, calcium phosphate precipitation, direct microinjection, infection, etc. In some embodiments, the choice of nucleic acid vectors depend on the host cell to be used. In some embodiments, host cells are of either prokaryotic (e.g., bacterial) or eukaryotic (e.g., mammalian) origin.
In some embodiments, a polypeptide, for example a polypeptide construct comprising a SIRP-α D1 variant (e.g., any variant provided in Tables 2, 5, and 6) and a fusion partner such as an Fc variant, HSA, and an albumin binding peptide, are produced by culturing a host cell transformed with a nucleic acid, preferably an expression vector, containing a nucleic acid encoding the polypeptide construct (e.g., Fc variant, linker, and fusion partner) under the appropriate conditions to induce or cause expression of the polypeptide construct. In some embodiments, the conditions appropriate for expression varies with the expression vector and the host cell chosen. In some embodiments, a wide variety of appropriate host cells are used, including, but not limited to, mammalian cells, bacteria, insect cells, and yeast. For example, a variety of cell lines that find use in the present disclosure are described in the ATCC® cell line catalog, available from the American Type Culture Collection. In some embodiments, Fc variants of this disclosure are expressed in a cell that is optimized not to glycosylate proteins that are expressed by such cell, either by genetic engineering of the cell line or modifications of cell culture conditions such as addition of kifunensine or by using a naturally non-glycosylating host such as a prokaryote (E. coli, etc.), and in some cases, modification of the glycosylation sequence in the Fc is not be needed.
Nucleic Acid Vector Construction and Host Cells
A nucleic acid sequence encoding the amino acid sequence of a polypeptide of the disclosure can be prepared by a variety of methods. These methods include, but are not limited to, oligonucleotide-mediated (or site-directed) mutagenesis and PCR mutagenesis. In some embodiments, a nucleic acid molecule encoding a polypeptide of the disclosure is obtained using standard techniques, e.g., gene synthesis. Alternatively, a nucleic acid molecule encoding a wild-type SIRP-α D1 domain is mutated to include specific amino acid substitutions using standard techniques, e.g., QuikChange™ mutagenesis. In some cases, nucleic acid molecules are synthesized using a nucleotide synthesizer or PCR techniques.
In some embodiments, the nucleic acids that encode a polypeptide construct, for example a polypeptide construct comprising a SIRP-α D1 variant (e.g., any variant provided in Tables 2, 5, and 6) and a fusion partner such as an Fc variant, HSA, and an albumin binding peptide, are incorporated into an expression vector in order to express the protein. A variety of expression vectors can be utilized for protein expression. Expression vectors can comprise self-replicating, extra-chromosomal vectors or vectors which integrate into a host genome. A vector can also include various components or elements. For example, in some embodiments, the vector components include, but are not limited to, transcriptional and translational regulatory sequences such as a promoter sequence, a ribosomal binding site, a signal sequence, transcriptional start and stop sequences, translational start and stop sequences, 3′ and 5′ untranslated regions (UTRs), and enhancer or activator sequences; an origin of replication; a selection marker gene; and the nucleic acid sequence encoding the polypeptide of interest, and a transcription termination sequence. In some embodiments, expression vectors comprise a protein operably linked with control or regulatory sequences, selectable markers, any fusion partners, additional elements, or any combinations thereof. The term “operably linked” means that the nucleic acid is placed into a functional relationship with another nucleic acid sequence. Generally, these expression vectors include transcriptional and translational regulatory nucleic acid operably linked to the nucleic acid encoding the Fc variant, and are typically appropriate to the host cell used to express the protein. A selection gene or marker, such as, but not limited to, an antibiotic resistance gene or fluorescent protein gene, can be used to select for host cells containing the expression vector, for example by antibiotic or fluorescence expression. Various selection genes are available.
In some embodiments, the components or elements of a vector are optimized such that expression vectors are compatible with the host cell type. Expression vectors which find use in the present disclosure include, but are not limited to, those which enable protein expression in mammalian cells, bacteria, insect cells, yeast, and in in vitro systems.
In some embodiments, mammalian cells are used as host cells to produce polypeptides of the disclosure. Examples of mammalian cell types include, but are not limited to, human embryonic kidney (HEK) (e.g., HEK293, HEK293F), Chinese hamster ovary (CHO), HeLa, COS, PC3, Vero, MC3T3, NS0, Sp2/0, VERY, BHK, MDCK, W138, BT483, Hs578T, HTB2, BT20, T47D, NS0 (a murine myeloma cell line that does not endogenously produce any immunoglobulin chains), CRL7O30, and HsS78Bst cells. In some embodiments, E. coli cells are used as host cells to produce polypeptides of the disclosure. Examples of E. coli strains include, but are not limited to, E. coli 294 (ATCC® 31,446), E. coli λ 1776 (ATCC® 31,537, E. coli BL21 (DE3) (ATCC® BAA-1025), and E. coli RV308 (ATCC® 31,608).
Different host cells have characteristic and specific mechanisms for the posttranslational processing and modification of protein products (e.g., glycosylation). In some embodiments, appropriate cell lines or host systems are chosen to ensure the correct modification and processing of the polypeptide expressed. Once the vectors are introduced into host cells for protein production, host cells are cultured in conventional nutrient media modified as appropriate for inducing promoters, selecting transformants, or amplifying the genes encoding the desired sequences.
In some embodiments, a polypeptide construct, for example a polypeptide construct comprising a SIRP-α D1 variant (e.g., any variant provided in Tables 2, 5, and 6) and a fusion partner such as an Fc variant, HSA, and an albumin binding peptide, are expressed in mammalian expression systems, including systems in which the expression constructs are introduced into the mammalian cells using virus such as retrovirus or adenovirus. In some embodiments, human, mouse, rat, hamster, or primate cells are utilized. Suitable cells also include known research cells, including but not limited to Jurkat T cells, NIH3T3, CHO, COS, and 293 cells. Alternately, in some embodiments, proteins are expressed in bacterial cells. Bacterial expression systems are well known in the art, and include Escherichia coli (E. coli), Bacillus subtilis, Streptococcus cremoris, and Streptococcus lividans. In some cases, polypeptide constructs comprising Fc variants are produced in insect cells such as but not limited to Sf9 and Sf21 cells or yeast cells such as but not limited to organisms from the genera Saccharomyces, Pichia, Kluyveromyces, Hansenula and Yarrowia. In some cases, polypeptide constructs comprising Fc variants are expressed in vitro using cell free translation systems. In vitro translation systems derived from both prokaryotic (e.g., E. coli) and eukaryotic (e.g., wheat germ, rabbit reticulocytes) cells are available and, in some embodiments, chosen based on the expression levels and functional properties of the protein of interest. For example, as appreciated by those skilled in the art, in vitro translation is required for some display technologies, for example ribosome display. In addition, in some embodiments, the Fc variants are produced by chemical synthesis methods such as, but not limited to, liquid-phase peptide synthesis and solid-phase peptide synthesis. In the case of in vitro transcription using a non-glycosylating system such as bacterial extracts, the Fc will not be glycosylated even in presence of the natural glycosylation site and therefore inactivation of the Fc will be equivalently obtained.
In some embodiments, a polypeptide construct includes non-natural amino acids, amino acid analogues, amino acid mimetics, or any combinations thereof that function in a manner similar to the naturally occurring amino acids. Naturally encoded amino acids generally refer to the 20 common amino acids (alanine, arginine, asparagine, aspartic acid, cysteine, glutamine, glutamic acid, glycine, histidine, isoleucine, leucine, lysine, methionine, phenylalanine, proline, serine, threonine, tryptophan, tyrosine, and valine) and pyrrolysine and selenocysteine. Amino acid analogs refers to compounds that have the same basic chemical structure as a naturally occurring amino acid, e.g., a carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, such as, homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium. In some embodiments, such analogs have modified R groups (such as, norleucine) or modified peptide backbones, but generally retain the same basic chemical structure as a naturally occurring amino acid.
Protein Production, Recovery, and Purification
In some embodiments, host cells used to produce polypeptides of the disclosure are grown in media suitable for culturing of the selected host cells. Examples of suitable media for mammalian host cells include Minimal Essential Medium (MEM), Dulbecco's Modified Eagle's Medium (DMEM), Expi293™ Expression Medium, DMEM with supplemented fetal bovine serum (FBS), and RPMI-1640. Examples of suitable media for bacterial host cells include Luria broth (LB) plus necessary supplements, such as a selection agent, e.g., ampicillin. In some embodiments, host cells are cultured at suitable temperatures, such as from about 20° C. to about 39° C., e.g., from about 25° C. to about 37° C., preferably 37° C., and C02 levels, such as about 5% to 10%. In some embodiments, the pH of the medium is from about pH 6.8 to pH 7.4, e.g., pH 7.0, depending mainly on the host organism. If an inducible promoter is used in the expression vector, protein expression can be induced under conditions suitable for the activation of the promoter.
In some embodiments, protein recovery involves disrupting the host cell, for example by osmotic shock, sonication, or lysis. Once the cells are disrupted, cell debris is removed by centrifugation or filtration. The proteins can then be further purified. In some embodiments, a polypeptide of the disclosure is purified by various methods of protein purification, for example, by chromatography (e.g., ion exchange chromatography, affinity chromatography, and size-exclusion column chromatography), centrifugation, differential solubility, or by any other standard technique for the purification of proteins. For example, in some embodiments, the protein is isolated and purified by appropriately selecting and combining affinity columns such as Protein A column (e.g., POROS Protein A chromatography) with chromatography columns (e.g., POROS HS-50 cation exchange chromatography), filtration, ultra-filtration, de-salting and dialysis procedures. In some embodiments, a polypeptide is conjugated to marker sequences, such as a peptide to facilitate purification. An example of a marker amino acid sequence is a hexa-histidine peptide (His6-tag (SEQ ID NO: 223)), which can bind to a nickel-functionalized agarose affinity column with micromolar affinity. As an alternative, a hemagglutinin “HA” tag, which corresponds to an epitope derived from the influenza hemagglutinin protein can be used.
In some embodiments, polypeptides of the disclosure, for example a polypeptide construct comprising a SIRP-α D1 variant (e.g., any variant provided in Tables 2, 5, and 6) and a fusion partner such as an Fc variant, HSA, and an albumin binding peptide, are produced by the cells of a subject (e.g., a human), e.g., in the context of gene therapy, by administrating a vector such as a viral vector (e.g., a retroviral vector, adenoviral vector, poxviral vector (e.g., vaccinia viral vector, such as Modified Vaccinia Ankara (MVA)), adeno-associated viral vector, and alphaviral vector) containing a nucleic acid molecule encoding a polypeptide of the disclosure. The vector, once inside a cell of the subject (e.g., by transformation, transfection, electroporation, calcium phosphate precipitation, direct microinjection, infection, etc) can be used for the expression of a polypeptide disclosed herein. In some cases, the polypeptide is secreted from the cell. In some embodiments, if treatment of a disease or disorder is the desired outcome, no further action is required. In some embodiments, if collection of the protein is desired, blood is collected from the subject and the protein purified from the blood by various methods.
X. Pharmaceutical Compositions and Preparations
Disclosed herein, in some embodiments, are polypeptides comprising a signal-regulatory protein α (SIRP-α) D1 variant comprising a SIRP-α D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP-α D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP-α D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92.
Also disclosed herein, in some embodiments, are polypeptides comprising an Fc variant, wherein the Fc variant comprises an Fc domain dimer having two Fc domain monomers, wherein each Fc domain monomer independently is selected from (i) a human IgG1 Fc region consisting of mutations L234A, L235A, G237A, and N297A; (ii) a human IgG2 Fc region consisting of mutations A330S, P331S and N297A; or (iii) a human IgG4 Fc region comprising mutations S228P, E233P, F234V, L235A, delG236, and N297A.
The disclosure features pharmaceutical compositions that include polypeptides described herein, such as polypeptides having a high affinity SIRP-α D1 variant. In some embodiments, a pharmaceutical composition of the disclosure includes a polypeptide of the disclosure as the therapeutic protein. In some embodiments, a pharmaceutical composition of the disclosure including a polypeptide described herein is used in combination with other agents or compositions (e.g., therapeutic agents, biologics, small molecules, or any combinations thereof) in a therapy. In some embodiments, one or more additional therapeutically active agents, such as for example a small molecule, chemical compound or a biological compound such as polynucleotides and polypeptides including, but not limited to, siRNA, short polypeptides, and antibodies with therapeutic activity, are optionally formulated in pharmaceutical compositions of polypeptides described herein. In some embodiments, formulations of polypeptide constructs described herein are prepared for storage by mixing a polypeptide construct described herein having the desired degree of purity with optional, pharmaceutically acceptable carriers, excipients or stabilizers in the form of lyophilized formulations or aqueous solutions. In some embodiments, a pharmaceutical composition of the disclosure includes a nucleic acid molecule (DNA or RNA, e.g., mRNA) encoding a polypeptide of the disclosure, or a vector containing such a nucleic acid molecule.
Acceptable carriers, excipients, or stabilizers in a pharmaceutical composition are preferably nontoxic to recipients at the dosages and concentrations administered. In some embodiments, acceptable carriers, excipients, and stabilizers include buffers such as phosphate, citrate, HEPES, TAE, and other organic acids; antioxidants such as ascorbic acid and methionine; preservatives (e.g., hexamethonium chloride; octadecyldimethylbenzyl ammonium chloride; benzalkonium chloride, benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (e.g., less than about 10 residues) polypeptides; proteins such as human serum albumin, gelatin, dextran, and immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, histidine, and lysine; monosaccharides, disaccharides, and other carbohydrates such as glucose, mannose, sucrose, and sorbitol; chelating agents such as EDTA sugars such as sucrose, mannitol, trehalose or sorbitol; sweeteners and other flavoring agents; fillers such as microcrystalline cellulose, lactose, corn and other starches; binding agents; additives; coloring agents; salt-forming counter-ions such as sodium; metal complexes (e.g., Zn-protein complexes); non-ionic surfactants such as TWEEN™ PLURONICS,™ and polyethylene glycol (PEG); or any combinations thereof.
In some embodiments, pharmaceutical compositions that comprise polypeptides described herein are in a water-soluble form, such as being present as pharmaceutically acceptable salts, which is meant to include both acid and base addition salts. The term “pharmaceutically acceptable acid addition salt” refers to those salts that retain the biological effectiveness of the free bases and that are not otherwise undesirable, formed with inorganic acids such as hydrochloric acid, hydrobromic acid, sulfuric acid, nitric acid, phosphoric acid and the like, and organic acids such as acetic acid, propionic acid, glycolic acid, pyruvic acid, oxalic acid, maleic acid, malonic acid, succinic acid, fumaric acid, tartaric acid, citric acid, benzoic acid, cinnamic acid, mandelic acid, methanesulfonic acid, ethanesulfonic acid, p-toluenesulfonic acid, salicylic acid and the like. The term “pharmaceutically acceptable base addition salts” includes those derived from inorganic bases such as sodium, potassium, lithium, ammonium, calcium, magnesium, iron, zinc, copper, manganese, aluminum salts and the like. Particularly preferred are the ammonium, potassium, sodium, calcium, and magnesium salts. Salts derived from pharmaceutically acceptable organic non-toxic bases include salts of primary, secondary, and tertiary amines, substituted amines including naturally occurring substituted amines, cyclic amines and basic ion exchange resins, such as isopropylamine, trimethylamine, diethylamine, triethylamine, tripropylamine, and ethanolamine. The formulations to be used for in vivo administration are preferably sterile. This can be accomplished by filtration through sterile filtration membranes or other methods.
In some embodiments, pharmaceutical compositions of the disclosure are administered parenterally in the form of an injectable formulation. In some embodiments, pharmaceutical compositions for injection are formulated using a sterile solution or any pharmaceutically acceptable liquid as a vehicle. Pharmaceutically acceptable vehicles include, but are not limited to, sterile water, physiological saline, and cell culture media (e.g., Dulbecco's Modified Eagle Medium (DMEM), α-Modified Eagles Medium (α-MEM), and F-12 medium). Various formulation methods are available.
In some embodiments, the polypeptides described herein are formulated as immunoliposomes. A liposome is a small vesicle comprising various types of lipids, phospholipids or surfactants that is useful for delivery of a therapeutic agent to a mammal. Liposomes containing the antibody or Fc fusion can be prepared by various methods known in the art. In some embodiments, the components of the liposome are arranged in a bilayer formation, similar to the lipid arrangement of biological membranes. In some embodiments, liposomes are generated by the reverse phase evaporation method with a lipid composition comprising phosphatidylcholine, cholesterol and PEG-derivatized phosphatidylethanolamine (PEG-PE). In some embodiments, liposomes are extruded through filters of defined pore size to yield liposomes with the desired diameter. In some embodiments, a chemotherapeutic agent or other therapeutically active agent is optionally contained within the liposome.
In some embodiments, polypeptide constructs described herein and other therapeutically active agents are entrapped in microcapsules prepared by methods including, but not limited to, coacervation techniques, interfacial polymerization (for example using hydroxymethylcellulose or gelatin-microcapsules, or poly-(methylmethacylate) microcapsules), colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules), and macroemulsions.
In some embodiments, sustained-release preparations are prepared. Suitable examples of sustained-release preparations include semipermeable matrices of solid hydrophobic polymer, which matrices are in the form of shaped articles, e.g., films, or microcapsules. Examples of sustained-release matrices include polyesters, hydrogels (for example poly(2-hydroxyethyl-methacrylate), or poly(vinylalcohol)), polylactides, copolymers of L-glutamic acid and gamma ethyl-L-glutamate, non-degradable ethylene-vinyl acetate, degradable lactic acid-glycolic acid copolymers such as the LUPRON DEPOT™ (which are injectable microspheres composed of lactic acid-glycolic acid copolymer and leuprolide acetate), poly-D-(−)-3-hydroxybutyric acid, and ProLease® (commercially available from Alkermes), which is a microsphere-based delivery system composed of the desired bioactive molecule incorporated into a matrix of poly-DL-lactide-co-glycolide (PLG). Some sustained-release formulations enable release of molecules over a few months, e.g., one to six months, while other formulations release pharmaceutical compositions of the disclosure for shorter time periods, e.g., days to weeks.
In some embodiments, the concentration of the polypeptide described herein in a pharmaceutical formulation varies from about 0.1 to 100 weight %. In some cases, the concentration of the polypeptide described herein is in the range of 0.003 to 1.0 molar. In some cases, the concentration of the polypeptide in a pharmaceutical formulation varies from about 5 mg/mL to about 50 mg/mL (e.g., from about 10 mg/mL to about 40 mg/mL or from about 20 mg/mL to about 30 mg/mL). In some embodiments, in order to treat a patient, a therapeutically effective dose of a polypeptide described herein is administered. The term “therapeutically effective dose” refers to a dose that produces the effects for which it is administered. The exact dose will depend on the purpose of the treatment. In some embodiments, dosages range from 0.01 to 100 mg/kg of body weight or greater, for example 0.1, 1, 5, 10, 15, 20, 25, 30, 35, 40, 45 or 50 mg/kg of body weight. In some embodiments, adjustments for polypeptide construct degradation, systemic versus localized delivery, and rate of new protease synthesis, as well as the age, body weight, general health, sex, diet, time of administration, drug interaction and the severity of the condition is necessary.
In some embodiments, the compositions and formulations described herein are administered to a subject in need thereof. In some embodiments, such administration is carried out in vivo. In some embodiments, such administration is carried out ex vivo. In some embodiments, administration of the pharmaceutical composition comprising a polypeptide described herein, is done in a variety of ways, including, but not limited to orally, subcutaneously, intravenously, intranasally, intraotically, transdermally, topically (e.g., gels, salves, lotions, creams, etc.), intraperitoneally, intramuscularly, intrapulmonary (e.g., AERx® inhalable technology commercially available from Aradigm, or Inhance™ pulmonary delivery system commercially available from Inhale Therapeutics), vaginally, parenterally, rectally, or intraocularly. In some embodiments, the pharmaceutical composition is formulated accordingly depending upon the manner of introduction.
In some embodiments, the pharmaceutical composition for gene therapy is in an acceptable diluent, or includes a slow release matrix in which the gene delivery vehicle is imbedded. In some embodiments, vectors used as in vivo gene delivery vehicles include, but are not limited to, retroviral vectors, adenoviral vectors, poxviral vectors (e.g., vaccinia viral vectors, such as Modified Vaccinia Ankara), adeno-associated viral vectors, and alphaviral vectors.
XI. Routes, Dosage, and Administration
Disclosed herein, in some embodiments, are polypeptides comprising a signal-regulatory protein α (SIRP-α) D1 variant comprising a SIRP-α D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP-α D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP-α D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92.
Also disclosed herein, in some embodiments, are polypeptides comprising an Fc variant, wherein the Fc variant comprises an Fc domain dimer having two Fc domain monomers, wherein each Fc domain monomer independently is selected from (i) a human IgG1 Fc region consisting of mutations L234A, L235A, G237A, and N297A; (ii) a human IgG2 Fc region consisting of mutations A330S, P331S and N297A; or (iii) a human IgG4 Fc region comprising mutations S228P, E233P, F234V, L235A, delG236, and N297A.
In some embodiments, pharmaceutical compositions that include polypeptides of the disclosure as the therapeutic proteins are formulated for, e.g., intravenous administration, parenteral administration, subcutaneous administration, intramuscular administration, intra-arterial administration, intrathecal administration, or intraperitoneal administration. In some embodiments, the pharmaceutical composition is formulated for, or administered via, oral, nasal, spray, aerosol, rectal, or vaginal administration. For injectable formulations, various effective pharmaceutical carriers are available.
In some embodiments, a pharmaceutical composition that includes a nucleic acid molecule encoding a polypeptide of the disclosure or a vector containing such nucleic acid molecule is administered by way of gene delivery. Various methods of gene delivery are available. In some embodiments, vectors used for in vivo gene delivery and expression include, but are not limited to, retroviral vectors, adenoviral vectors, poxviral vectors (e.g., vaccinia viral vectors, such as Modified Vaccinia Ankara (MVA)), adeno-associated viral vectors, and alphaviral vectors. In some embodiments, mRNA molecules encoding polypeptides of the disclosure are administered directly to a subject.
The dosage of the pharmaceutical compositions of the disclosure depends on factors including the route of administration, the disease to be treated, and physical characteristics, e.g., age, weight, general health, of the subject. In some embodiments, the amount of a polypeptide of the disclosure contained within a single dose is an amount that effectively prevents, delays, or treats the disease without inducing significant toxicity. In some embodiments, a pharmaceutical composition of the disclosure includes a dosage of a polypeptide of the disclosure ranging from 0.01 to 500 mg/kg (e.g., 0.01, 0.1, 0.2, 0.3, 0.4, 0.5, 1, 2, 3, 4, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 100, 150, 200, 250, 300, 350, 400, 450, or 500 mg/kg) and, in a more specific embodiment, about 0.1 to about 50 mg/kg and, in a more specific embodiment, about 1 to about 30 mg/kg. In some embodiments, the dosage is adapted by a physician in accordance with the extent of the disease and different parameters of the subject.
In some embodiments, toxicity of therapeutic agents and polypeptides described herein is determined by standard pharmaceutical procedures in cell cultures or experimental animals, e.g., by determining the LD50 (the dose lethal to 50% of the population) or the LD100 (the dose lethal to 100% of the population). In some embodiments, the data obtained from these cell culture assays and animal studies is used in formulating a dosage range that is not toxic for use in human. The dosage of the proteins described herein lies preferably within a range of circulating concentrations that include the effective dose with little or no toxicity. In some embodiments, the dosage is varied within this range depending upon the dosage form employed and the route of administration utilized. In some embodiments, the exact formulation, route of administration and dosage is chosen by an individual physician in view of the patient's condition.
In some embodiments, the pharmaceutical compositions are administered in a manner compatible with the dosage formulation and in such amount as is therapeutically effective to result in an improvement or remediation of symptoms of a disease or disorder. In some embodiments, the pharmaceutical compositions are administered in a variety of dosage forms, e.g., intravenous dosage forms, subcutaneous dosage forms, and oral dosage forms (e.g., ingestible solutions, drug release capsules). Generally, therapeutic proteins are dosed at 0.1-100 mg/kg, e.g., 1-50 mg/kg. In some embodiments, pharmaceutical compositions that include a polypeptide of the disclosure are administered to a subject in need thereof, for example, one or more times (e.g., 1-10 times or more) daily, weekly, monthly, biannually, annually, or as medically necessary. Dosages can be provided in either a single or multiple dosage regimens. In some embodiments, the timing between administrations is decreased as the medical condition improves or increased as the health of the patient declines.
XII. Methods of Treatment
Disclosed herein, in some embodiments, are polypeptides comprising a signal-regulatory protein α (SIRP-α) D1 variant comprising a SIRP-α D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP-α D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP-α D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92.
Also disclosed herein, in some embodiments, are polypeptides comprising an Fc variant, wherein the Fc variant comprises an Fc domain dimer having two Fc domain monomers, wherein each Fc domain monomer independently is selected from (i) a human IgG1 Fc region consisting of mutations L234A, L235A, G237A, and N297A; (ii) a human IgG2 Fc region consisting of mutations A330S, P331S and N297A; or (iii) a human IgG4 Fc region comprising mutations S228P, E233P, F234V, L235A, delG236, and N297A.
Further disclosed herein, in some embodiments, are methods of treatment comprising administering polypeptides comprising a signal-regulatory protein α (SIRP-α) D1 variant comprising a SIRP-α D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP-α D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP-α D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92.
In some embodiments, the disclosure provides pharmaceutical compositions and methods of treatment that are used to treat patients who are suffering from diseases and disorders associated with SIRP-α or CD47 activity, such as cancers and immunological diseases (e.g., autoimmune diseases and inflammatory diseases). In some embodiments, the polypeptides described herein are administered to a subject in a method of increasing phagocytosis of a target cell (e.g., a cancer cell) in the subject. In some embodiments, the polypeptides are administered to a subject in a method to kill cancer cells in the subject. In some embodiments, the polypeptides are administered to a subject in a method of eliminating regulatory T-cells in the subject. In some embodiments, the polypeptides described herein are administered to a subject in a method of increasing hematopoietic stem cell engraftment in the subject, wherein the method includes modulating the interaction between SIRP-α and CD47 in the subject. In some embodiments, the polypeptides described herein are administered to a subject in a method of altering an immune response (e.g., suppressing the immune response) in the subject. In some embodiments, the foregoing methods are coupled with other methods for treating a disease. In some embodiments, disclosed herein, are a combination of a polypeptide (e.g., a SIRP-α D1 variant) and a second therapeutic agent. In some embodiments, the combination comprises a polypeptide (e.g., a SIRP-α D1 variant) and a second therapeutic agent, wherein the second therapeutic agent is an antibody. In some embodiments, the combination comprises a SIRP-α D1 variant comprising a SIRP-α D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP-α D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP-α D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92; and an antibody. In some embodiments, the combination comprises a polypeptide having a sequence according to any one of SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159; and an antibody.
In some embodiments, the foregoing methods are employed with strategies for treating a disease wherein administration of a polypeptide is a therapeutic option. Non-limiting examples of the foregoing include use of an antibody or a protein fragment. For example, in some embodiments, an antibody or protein fragment is administered in combination with the Fc variant polypeptides disclosed herein. In some embodiments, the polypeptide constructs disclosed herein are used to improve the phagocytosis of other agents.
Methods of treatment include administering to a subject having a disease (e.g., cancer) (i) a polypeptide including a SIRP-α D1 variant and optionally (ii) an antibody. In some embodiments, before treating a disease (e.g., cancer) in a subject, the amino acid sequence(s) of SIRP-α in the subject are determined, for example, from each of the two alleles encoding the SIRP-α gene. In this method of treatment, the amino acid sequence(s) of SIRP-α polypeptides in a biological sample from the subject are first determined. The subject is then administered a therapeutically effective amount of a polypeptide of the disclosure. In some embodiments, the high affinity SIRP-α D1 variant administered has the same amino acid sequence as that of SIRP-α polypeptides in the biological sample of the subject, except for the introduction of amino acids changes which increase the affinity of the SIRP-α polypeptide to CD47. The high affinity SIRP-α D1 variant in the polypeptide preferably has minimal immunogenicity in the subject after the polypeptide is administered.
In some embodiments, an antibody is administered in addition to the polypeptides disclosed herein. In some embodiments, the antibody is co-administered with the polypeptide. In some embodiments, the antibody is administered simultaneously, for example in a pharmaceutical composition having both the polypeptide and the antibody. Alternatively, the antibody is administered either before or after the administration of the polypeptide. In some embodiments, the polypeptide and the antibody are administered substantially simultaneously (e.g., within one week, 6, 5, 4, 3, 2, 1 days, 12, 6, 3, 2, 1 hours of each other, or substantially simultaneously), followed by administering the antibody alone. In some embodiments, the antibody is administered first, followed by administering of the polypeptide and the antibody substantially simultaneously (i.e., within one week, 6, 5, 4, 3, 2, 1 days, 12, 6, 3, 2, 1 hours of each other, or substantially simultaneously).
An antibody co-administered or provided in a composition or method disclosed herein, refers to an antibody that targets a cell, such as a cancer cell or a cell of the immune system, such as a T-cell (e.g., a regulatory T-cell). An antibody can be of any immunoglobulin antibody isotypes, e.g., IgG, IgE, IgM, IgA, or IgD. In some embodiments, the antibody is a human IgG1 isotype antibody. In some embodiments, the antibody is a human IgG2 isotype antibody. In some embodiments, the antibody is a human IgG4 isotype antibody.
The term “antibody” herein is used in the broadest sense and encompasses various antibody structures, including but not limited to monoclonal antibodies, polyclonal antibodies, multi-specific antibodies (e.g., bispecific antibodies), antibody fragments, and antibody-like proteins so long as they exhibit the desired activity. “Antibody fragments” include a portion of an intact antibody, preferably the antigen binding or variable region of the intact antibody. Examples of antibody fragments include Fab, Fab′, F(ab′)2, and Fv fragments, diabodies, linear antibodies, single-chain antibody molecules, and multi-specific antibodies. Monoclonal antibody refers to an antibody obtained from a population of substantially homogeneous antibodies, e.g., individual antibodies in the population have the same primary sequence except for possible naturally occurring mutations that can be present in minor amounts. Monoclonal antibodies can be highly specific and directed against a single antigenic site (e.g., an epitope on a cancer antigen). In contrast to polyclonal antibody preparations which typically include different antibodies directed against different epitopes, each monoclonal antibody is generally directed against a single epitope on the antigen. The modifier “monoclonal” indicates the character of the antibody as being obtained from a substantially homogenous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method. In some embodiments, an antibody in a composition of the present disclosure causes antibody-dependent cellular phagocytosis (ADCP) or antibody-dependent cellular cytotoxicity (ADCC). Non-limiting examples of diseases that are treated using such strategies include cancers such hematological cancers, for example leukemias (e.g., acute myeloid leukemia); immune disorders (e.g., to enhance a subject's impaired or diminished immune response, or alternately to limit a subject's over-active immune response); and pathogenic infections.
In some embodiments, the methods disclosed herein comprise administering a polypeptide described herein (e.g., a SIRP-α D1 variant) and an antibody that targets a cancer antigen. In some embodiments, a cancer antigen targeted by an antibody or antibody-like protein are exposed peptides derived from intracellular tumor-associated antigens (TAAs) in complex with human leukocyte antigen (HLA) class I molecules on the surface (also known as MHC/peptide complex). Non-limiting examples of such cancer antigens, e.g. peptides in complex with HLA molecules exposed on the surface of cancer cells, that are targeted by an antibody or anti-body-like proteins in a composition of the disclosure include: NY-ESO-1/LAGE1, SSX-2, MAGE family (MAGE-A3), gp100/pmel17, Melan-A/MART-1, gp75/TRP1, tyrosinase, TRP2, CEA, PSA, TAG-72, Immature laminin receptor, MOK/RAGE-1, WT-1, Her2/neu, EphA3, SAP-1, BING-4, Ep-CAM, MUC1, PRAME, survivin, Mesothelin, BRCA1/2 (mutated), CDK4, CML66, MART-2, p53 (mutated), Ras (mutated), β-catenin (mutated), TGF-βRII (mutated), HPV E6, E7. Examples of such antibodies include ESK1 (WT-1), RL1B (Her2-E75), Pr20 (PRAME), and 3.2G1 (hCGβ).
In some embodiments, the methods disclosed herein comprise administering a polypeptide comprising a SIRP-α D1 variant comprising a SIRP-α D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP-α D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP-α D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92; and an antibody that targets a cancer antigen. In some embodiments, the methods disclosed herein comprise administering a polypeptide comprising a SIRP-α D1 variant comprising a SIRP-α D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP-α D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP-α D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92; and an antibody that targets NY-ESO-1/LAGE1, SSX-2, MAGE family (MAGE-A3), gp100/pmel17, Melan-A/MART-1, gp75/TRP1, tyrosinase, TRP2, CEA, PSA, TAG-72, Immature laminin receptor, MOK/RAGE-1, WT-1, Her2/neu, EphA3, SAP-1, BING-4, Ep-CAM, MUC1, PRAME, survivin, Mesothelin, BRCA1/2 (mutated), CDK4, CML66, MART-2, p53 (mutated), Ras (mutated), β-catenin (mutated), TGF-βRII (mutated), HPV E6, E7. In some embodiments, the methods disclosed herein comprise administering a polypeptide comprising a SIRP-α D1 variant comprising a SIRP-α D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP-α D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP-α D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92; and an antibody, wherein the antibody is ESK1 (WT-1), RL1B (Her2-E75), Pr20 (PRAME), and 3.2G1 (hCGβ).
In some embodiments, the methods disclosed herein comprise administering a polypeptide having a sequence according to SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159. and an antibody that targets a cancer antigen. In some embodiments, the methods disclosed herein comprise administering a polypeptide having a sequence according to any one of SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159; and an antibody that targets NY-ESO-1/LAGE1, SSX-2, MAGE family (MAGE-A3), gp100/pmel17, Melan-A/MART-1, gp75/TRP1, tyrosinase, TRP2, CEA, PSA, TAG-72, Immature laminin receptor, MOK/RAGE-1, WT-1, Her2/neu, EphA3, SAP-1, BING-4, Ep-CAM, MUC1, PRAME, survivin, Mesothelin, BRCA1/2 (mutated), CDK4, CML66, MART-2, p53 (mutated), Ras (mutated), β-catenin (mutated), TGF-βRII (mutated), HPV E6, E7. In some embodiments, the methods disclosed herein comprise administering a polypeptide having a sequence according to any one of SEQ ID NOs: SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159; and an antibody, wherein the antibody is ESK1 (WT-1), RL1B (Her2-E75), Pr20 (PRAME), and 3.2G1 (hCGβ).
In some embodiments, an antibody targets cancer cells, for example, by binding to proteins expressed by cancer cells. Some proteins are expressed at higher levels in cancer cells than in non-cancer cells. For example, a cancer antigen is a protein that is expressed preferentially by cancer cells (e.g., it is expressed at higher levels in cancer cells than on non-cancer cells) and in some instances it is expressed solely by cancer cells. Non-limiting examples of proteins, e.g., proteins expressed by cancer cells, that are be targeted by an antibody in a composition of the disclosure include: 4-1BB, 5T4, AGS-16, ALK1, ANG-2, B7-H3, B7-H4, c-fms, c-Met, CA6, CCR4, CD123, CD19, CD20, CD22, CD27, EpCAM, CD30, CD32b, CD33, CD37, CD38, CD40, CD52, CD70, CD74, CD79b, CD98, CEA, CEACAM5, CLDN18.2, CLDN6, CS1, CTLA-4, CXCR4, DLL-4, EGFR, EGP-1, ENPP3, EphA3, ETBR, FGFR2, fibronectin, FR-alpha, Frizzled receptor, GCC, GD2, glypican-3, GPNMB, HER-2, HER3, HLA-DR, ICAM-1, IGF-1R, IL-3R, LAG-3, LIV-1, mesothelin, MUC16, MUC1, NaPi2b, Nectin-4, Notch 2, Notch 1, OX40, PD-1, PD-L1, PD-L2, PDGFR-α, PS, PSMA, SLTRK6, STEAP1, TEM1, VEGFR, CD25, CD27L, DKK-1, CSF-1R, or any combinations thereof. In some embodiments, the polypeptides described herein are administered in combination with a checkpoint inhibitor, such as an antibody inhibitor of CTLA-4 (e.g., ipilimumab, tremelimumab), PD-1 (e.g., nivolumab, Pidilizumab, MK3475 also known as pembrolizumab, BMS936559, and MPDL3280A), and LAG-3 (e.g., BMS986016).
In some embodiments, the methods disclosed herein comprise administering a polypeptide comprising a SIRP-α D1 variant comprising a SIRP-α D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP-α D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP-α D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92; and an antibody that targets a protein expressed a by a cancer cell. In some embodiments, the methods disclosed herein comprise administering a polypeptide comprising a SIRP-α D1 variant comprising a SIRP-α D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP-α D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP-α D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92; and an antibody that targets 4-1BB, 5T4, AGS-16, ALK1, ANG-2, B7-H3, B7-H4, c-fms, c-Met, CA6, CCR4, CD123, CD19, CD20, CD22, CD27, EpCAM, CD30, CD32b, CD33, CD37, CD38, CD40, CD52, CD70, CD74, CD79b, CD98, CEA, CEACAM5, CLDN18.2, CLDN6, CS1, CTLA-4, CXCR4, DLL-4, EGFR, EGP-1, ENPP3, EphA3, ETBR, FGFR2, fibronectin, FR-alpha, Frizzled receptor, GCC, GD2, glypican-3, GPNMB, HER-2, HER3, HLA-DR, ICAM-1, IGF-1R, IL-3R, LIV-1, mesothelin, MUC16, MUC1, NaPi2b, Nectin-4, Notch 2, Notch 1, OX40, PD-1, PD-L1, PD-L2, PDGFR-α, PS, PSMA, SLTRK6, STEAP1, TEM1, VEGFR, CD25, CD27L, DKK-1, CSF-1R, or any combination thereof. In some embodiments, the methods disclosed herein comprise administering a polypeptide comprising a SIRP-α D1 variant comprising a SIRP-α D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP-α D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP-α D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92; and an antibody, wherein the antibody is an antibody inhibitor of CTLA-4 (e.g., ipilimumab, tremelimumab), PD-1 (e.g., nivolumab, Pidilizumab, MK3475 also known as pembrolizumab, BMS936559, and MPDL3280A), or LAG-3 (e.g., BMS986016).
In some embodiments, the methods disclosed herein comprise administering a polypeptide having a sequence according to any one of SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159; and an antibody that targets a protein expressed a by a cancer cell. In some embodiments, the methods disclosed herein comprise administering a polypeptide having a sequence according to any one of SEQ ID NOs: SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159; and an antibody that targets 4-1BB, 5T4, AGS-16, ALK1, ANG-2, B7-H3, B7-H4, c-fms, c-Met, CA6, CCR4, CD123, CD19, CD20, CD22, CD27, EpCAM, CD30, CD32b, CD33, CD37, CD38, CD40, CD52, CD70, CD74, CD79b, CD98, CEA, CEACAM5, CLDN18.2, CLDN6, CS1, CTLA-4, CXCR4, DLL-4, EGFR, EGP-1, ENPP3, EphA3, ETBR, FGFR2, fibronectin, FR-alpha, Frizzled receptor, GCC, GD2, glypican-3, GPNMB, HER-2, HER3, HLA-DR, ICAM-1, IGF-1R, IL-3R, LAG-3, LIV-1, mesothelin, MUC16, MUC1, NaPi2b, Nectin-4, Notch 2, Notch 1, OX40, PD-1, PD-L1, PD-L2, PDGFR-α, PS, PSMA, SLTRK6, STEAP1, TEM1, VEGFR, CD25, CD27L, DKK-1, CSF-1R, or any combinations thereof. In some embodiments, the methods disclosed herein comprise administering a polypeptide having a sequence according to any one of SEQ ID NOs: SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159; and an antibody, wherein the antibody is an antibody inhibitor of CTLA-4 (e.g., ipilimumab, tremelimumab), PD-1 (e.g., nivolumab, pidilizumab, MK3475 also known as pembrolizumab, BMS936559, and MPDL3280A), or LAG-3 (e.g., BMS986016).
In some embodiments, the methods disclosed herein comprise administering a polypeptide described herein (e.g., a SIRP-α D1 variant) and an immuno-oncology antibody. In some embodiments, antibodies that are used in compositions of the disclosure include, but are not limited to: cetuximab, necitumumab, pembrolizumab, nivolumab, pidilizumab, MEDI0680, MED16469, atezolizumab, avelumab, durvalumab, MEDI6383, RG7888, ipilimumab, tremelimumab, urelumab, PF-05082566, enoblituzumab, vantictumab, varlilumab, mogamalizumab, SAR650984, daratumumab, trastuzumab, trastuzumab emtansine, pertuzumab, elotuzumab, rituximab, ofatumumab, obinutuzumab, RG7155, FPA008, panitumumab, brentuximab vedotin, MSB0010718C, belimumab, bevacizumab, denosumab, panitumumab, ramucirumab, necitumumab, nivolumab, pembrolizumab, avelumab, atezolizumab, durvalumab, MEDI0680, pidilizumab, or BMS-93659, anti-HER2 antibody, anti-CD20 antibody, anti-CD19 antibody, anti-CS1 antibody, anti-CD38 antibody, anti-EGFR antibody, anti-PD1 antibody, anti-RANKL antibody, anti-OX40 antibody, anti-PD-1 antibody, anti-PD-L1 antibody, anti-CD274 antibody, anti-CTLA-4 antibody, anti-CD137 antibody, anti-4-1BB antibody, anti-B7-H3 antibody, anti-FZD7 antibody, anti-CD27 antibody, anti-CCR4 antibody, anti-CD38 antibody, anti-CSF1R antibody, anti-CSF antibody, anti-CD30 antibody, anti-BAFF antibody, anti-VEGF antibody, or anti-VEGFR2 antibody. In some embodiments, the methods disclosed herein comprise administering a polypeptide comprising a SIRP-α D1 variant comprising a SIRP-α D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP-α D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP-α D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92; and an antibody, wherein the antibody is, an anti-HER2 antibody, anti-CD20 antibody, anti-CD19 antibody, anti-CS1 antibody, anti-CD38 antibody, anti-EGFR antibody, anti-PD1 antibody, anti-RANKL antibody, anti-OX40 antibody, anti-PD-1 antibody, anti-PD-L1 antibody, anti-CD274 antibody, anti-CTLA-4 antibody, anti-CD137 antibody, anti-4-1BB antibody, anti-B7-H3 antibody, anti-FZD7 antibody, anti-CD27 antibody, anti-CCR4 antibody, anti-CD38 antibody, anti-CSF1R antibody, anti-CSF antibody, anti-CD30 antibody, anti-BAFF antibody, anti-VEGF antibody, or anti-VEGFR2 antibody. In some embodiments, the methods disclosed herein comprise administering a polypeptide comprising a SIRP-α D1 variant comprising a SIRP-α D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP-α D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP-α D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92; and an antibody, wherein the antibody is cetuximab, necitumumab, pembrolizumab, nivolumab, pidilizumab, MEDI0680, MED16469, atezolizumab, avelumab, durvalumab, MEDI6383, RG7888, ipilimumab, tremelimumab, urelumab, PF-05082566, enoblituzumab, vantictumab, varlilumab, mogamalizumab, SAR650984, daratumumab, trastuzumab, trastuzumab emtansine, pertuzumab, elotuzumab, rituximab, ofatumumab, obinutuzumab, RG7155, FPA008, panitumumab, brentuximab vedotin, MSB0010718C, belimumab, bevacizumab, denosumab, panitumumab, ramucirumab, necitumumab, nivolumab, pembrolizumab, avelumab, atezolizumab, durvalumab, MEDI0680, pidilizumab, or BMS-93659.
In some embodiments, the methods disclosed herein comprise administering a polypeptide comprising a SIRP-α D1 variant comprising a SIRP-α D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP-α D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP-α D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92; and an antibody, wherein the antibody is trastuzumab.
In some embodiments, the methods disclosed herein comprise administering a polypeptide comprising a SIRP-α D1 variant comprising a SIRP-α D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP-α D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP-α D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92; and an antibody, wherein the antibody is rituximab.
In some embodiments, the methods disclosed herein comprise administering a polypeptide comprising a SIRP-α D1 variant comprising a SIRP-α D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP-α D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP-α D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92; and an antibody, wherein the antibody is cetuximab.
In some embodiments, the methods disclosed herein comprise administering a polypeptide comprising a SIRP-α D1 variant comprising a SIRP-α D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP-α D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP-α D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92; and an antibody, wherein the antibody is daratumumab.
In some embodiments, the methods disclosed herein comprise administering a polypeptide comprising a SIRP-α D1 variant comprising a SIRP-α D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP-α D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP-α D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92; and an antibody, wherein the antibody is belimumab.
In some embodiments, the methods disclosed herein comprise administering a polypeptide comprising a SIRP-α D1 variant comprising a SIRP-α D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP-α D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP-α D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92; and an antibody, wherein the antibody is bevacizumab.
In some embodiments, the methods disclosed herein comprise administering a polypeptide comprising a SIRP-α D1 variant comprising a SIRP-α D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP-α D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP-α D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92; and an antibody, wherein the antibody is denosumab.
In some embodiments, the methods disclosed herein comprise administering a polypeptide comprising a SIRP-α D1 variant comprising a SIRP-α D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP-α D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP-α D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92; and an antibody, wherein the antibody is pantimumab.
In some embodiments, the methods disclosed herein comprise administering a polypeptide comprising a SIRP-α D1 variant comprising a SIRP-α D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP-α D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP-α D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92; and an antibody, wherein the antibody is ramucirumab.
In some embodiments, the methods disclosed herein comprise administering a polypeptide comprising a SIRP-α D1 variant comprising a SIRP-α D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP-α D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP-α D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92; and an antibody, wherein the antibody is necitumumab.
In some embodiments, the methods disclosed herein comprise administering a polypeptide comprising a SIRP-α D1 variant comprising a SIRP-α D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP-α D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP-α D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92; and an antibody, wherein the antibody is nivolumab.
In some embodiments, the methods disclosed herein comprise administering a polypeptide comprising a SIRP-α D1 variant comprising a SIRP-α D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP-α D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP-α D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92; and an antibody, wherein the antibody is pembrolizumab.
In some embodiments, the methods disclosed herein comprise administering a polypeptide comprising a SIRP-α D1 variant comprising a SIRP-α D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP-α D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP-α D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92; and an antibody, wherein the antibody is avelumab.
In some embodiments, the methods disclosed herein comprise administering a polypeptide comprising a SIRP-α D1 variant comprising a SIRP-α D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP-α D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP-α D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92; and an antibody, wherein the antibody is atezolizumab.
In some embodiments, the methods disclosed herein comprise administering a polypeptide comprising a SIRP-α D1 variant comprising a SIRP-α D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP-α D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP-α D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92; and an antibody, wherein the antibody is durvalumab.
In some embodiments, the methods disclosed herein comprise administering a polypeptide comprising a SIRP-α D1 variant comprising a SIRP-α D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP-α D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP-α D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92; and an antibody, wherein the antibody is MEDI0680.
In some embodiments, the methods disclosed herein comprise administering a polypeptide comprising a SIRP-α D1 variant comprising a SIRP-α D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP-α D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP-α D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92; and an antibody, wherein the antibody is pidilizumab.
In some embodiments, the methods disclosed herein comprise administering a polypeptide comprising a SIRP-α D1 variant comprising a SIRP-α D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP-α D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP-α D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92; and an antibody, wherein the antibody is BMS-93659.
In some embodiments, the methods disclosed herein comprise administering a polypeptide having a sequence according to any one of SEQ ID NOs: SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159; and an antibody, wherein the antibody is, an anti-HER2 antibody, anti-CD20 antibody, anti-CD19 antibody, anti-CS1 antibody, anti-CD38 antibody, anti-EGFR antibody, anti-PD1 antibody, anti-RANKL antibody, anti-OX40 antibody, anti-PD-1 antibody, anti-PD-L1 antibody, anti-CD274 antibody, anti-CTLA-4 antibody, anti-CD137 antibody, anti-4-1BB antibody, anti-B7-H3 antibody, anti-FZD7 antibody, anti-CD27 antibody, anti-CCR4 antibody, anti-CD38 antibody, anti-CSF1R antibody, anti-CSF antibody, anti-CD30 antibody, anti-BAFF antibody, anti-VEGF antibody, or anti-VEGFR2 antibody. In some embodiments, the methods disclosed herein comprise administering a polypeptide having a sequence according to SEQ ID NOs: SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159; and an antibody, wherein the antibody is cetuximab, necitumumab, pembrolizumab, nivolumab, pidilizumab, MEDI0680, MED16469, atezolizumab, avelumab, durvalumab, MEDI6383, RG7888, ipilimumab, tremelimumab, urelumab, PF-05082566, enoblituzumab, vantictumab, varlilumab, mogamalizumab, SAR650984, daratumumab, trastuzumab, trastuzumab emtansine, pertuzumab, elotuzumab, rituximab, ofatumumab, obinutuzumab, RG7155, FPA008, panitumumab, brentuximab vedotin, MSB0010718C, belimumab, bevacizumab, denosumab, panitumumab, ramucirumab, necitumumab, nivolumab, pembrolizumab, avelumab, atezolizumab, durvalumab, MEDI0680, pidilizumab, or BMS-93659.
In some embodiments, the methods disclosed herein comprise administering a polypeptide having a sequence according to any one of SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159; and an antibody, wherein the antibody is trastuzumab.
In some embodiments, the methods disclosed herein comprise administering a polypeptide having a sequence according to any one of SEQ ID NOs: 7 SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159; and an antibody, wherein the antibody is rituximab.
In some embodiments, the methods disclosed herein comprise administering a polypeptide having a sequence according to any one of SEQ ID NOs: SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159; and an antibody, wherein the antibody is cetuximab.
In some embodiments, the methods disclosed herein comprise administering a polypeptide having a sequence according to any one of SEQ ID NOs: SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159; and an antibody, wherein the antibody is daratumumab.
In some embodiments, the methods disclosed herein comprise administering a polypeptide having a sequence according to any one of SEQ ID NOs: SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159; and an antibody, wherein the antibody is belimumab.
In some embodiments, the methods disclosed herein comprise administering a polypeptide having a sequence according to any one of SEQ ID NOs: SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159; and an antibody, wherein the antibody is bevacizumab.
In some embodiments, the methods disclosed herein comprise administering a polypeptide having a sequence according to any one of SEQ ID NOs: SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159; and an antibody, wherein the antibody is denosumab.
In some embodiments, the methods disclosed herein comprise administering a polypeptide having a sequence according to any one of SEQ ID NOs: SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159; and an antibody, wherein the antibody is pantimumab.
In some embodiments, the methods disclosed herein comprise administering a polypeptide having a sequence according to any one of SEQ ID NOs: SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159; and an antibody, wherein the antibody is ramucirumab.
In some embodiments, the methods disclosed herein comprise administering a polypeptide having a sequence according to any one of SEQ ID NOs: SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159; and an antibody, wherein the antibody is necitumumab.
In some embodiments, the methods disclosed herein comprise a polypeptide having a sequence according to any one of SEQ ID NOs: SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159; and an antibody, wherein the antibody is nivolumab.
In some embodiments, the methods disclosed herein comprise administering a polypeptide having a sequence according to any one of SEQ ID NOs: SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159; and an antibody, wherein the antibody is pembrolizumab.
In some embodiments, the methods disclosed herein comprise administering a polypeptide having a sequence according to any one of SEQ ID NOs: SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159; and an antibody, wherein the antibody is avelumab.
In some embodiments, the methods disclosed herein comprise administering a polypeptide having a sequence according to any one of SEQ ID NOs: SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159; and an antibody, wherein the antibody is atezolizumab.
In some embodiments, the methods disclosed herein comprise administering a polypeptide having a sequence according to any one of SEQ ID NOs: SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159; and an antibody, wherein the antibody is durvalumab.
In some embodiments, the methods disclosed herein comprise administering a polypeptide having a sequence according to any one of SEQ ID NOs: SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159; and an antibody, wherein the antibody is MEDI0680.
In some embodiments, the methods disclosed herein comprise a polypeptide having a sequence according to any one of SEQ ID NOs: SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159; and an antibody, wherein the antibody is pidilizumab.
In some embodiments, the methods disclosed herein comprise administering a polypeptide having a sequence according to any one of SEQ ID NOs: SEQ ID NOs: 78-85, 98-104, 107-113, 116-122, 135-137, or 152-159; and an antibody, wherein the antibody is BMS-93659.
In some embodiments, the polypeptides disclosed herein enhance the anti-tumor activity of rituximab. In some embodiments, the polypeptides disclosed herein enhance the anti-tumor activity of rituximab in the Raji-NSG xenograft model. In some embodiments, the polypeptides disclosed herein enhance rituximab-mediated B-cell depletion in non-human primates (NHP).
In some embodiments, the polypeptides and pharmaceutical compositions of the disclosure are used in various cancer therapies. The cancers amenable to treatment according to the disclosure include, but are not limited to, solid tumor cancer, hematological cancer, acute myeloid leukemia, chronic lymphocytic leukemia, chronic myeloid leukemia, acute lymphoblastic leukemia, non-Hodgkin lymphoma, Hodgkin lymphoma, multiple myeloma, bladder cancer, pancreatic cancer, cervical cancer, endometrial cancer, lung cancer, bronchus cancer, liver cancer, ovarian cancer, colon and rectal cancer, stomach cancer, gastric cancer, gallbladder cancer, gastrointestinal stromal tumor cancer, thyroid cancer, head and neck cancer, oropharyngeal cancer, esophageal cancer, melanoma, non-melanoma skin cancer, Merkel cell carcinoma, virally induced cancer, neuroblastoma, breast cancer, prostate cancer, renal cancer, renal cell cancer, renal pelvis cancer, leukemia, lymphoma, sarcoma, glioma, brain tumor, and carcinoma. In some embodiments, cancerous conditions amenable to treatment according to the disclosure include metastatic cancers. In some embodiments, the cancer amenable to treatment according to the disclosure is a solid tumor or hematological cancer.
In some embodiments, an antibody targets cells of the immune system, such as T-cells, e.g., regulatory T-cells, by binding to proteins expressed by cells of the immune system. In some embodiments, the methods disclosed herein comprise administering a polypeptide described herein (e.g., a SIRP-α D1 variant) and an antibody that targets cells of the immune system. Examples of proteins expressed by cells of the immune system include, but are not limited to, 41BB, CD40, CD40L, CD163, CD206, CTLA4, PD1, TIM-3, BTLA, VISTA, LAG-3, CD28, OX40, GITR, CD137, CD27, HVEM, CCR4, CD25, CD103, KIrg1, Nrp1, CD278, Gpr83, TIGIT, CD154, CD160, and PD1H. In some embodiments, an antibody is designed such that it has preferential binding to proteins (e.g., receptors) expressed by T-cells (e.g., regulatory T-cells) as compared to other cells of the immune system. In some embodiments, an antibody in a composition of the disclosure includes an Fc domain of the IgG1, IgG2 or IgG4 subclass.
In some embodiments, the methods of the disclosure include altering an immune response in a subject. The methods include administering the subject a polypeptide including a high affinity SIRP-α D1 variant and an antibody, thereby altering the immune response in the subject. In some embodiments, altering the immune response includes suppressing the immune response.
In some embodiments, the polypeptides and pharmaceutical compositions of the disclosure are used in various therapies to treat immunological diseases. Autoimmune diseases and inflammatory diseases amenable to treatment according to the disclosure include, but are not limited to, multiple sclerosis, rheumatoid arthritis, a spondyloarthropathy, systemic lupus erythematosus, an antibody-mediated inflammatory or autoimmune disease, graft versus host disease, sepsis, diabetes, psoriasis, atherosclerosis, Sjogren's syndrome, progressive systemic sclerosis, scleroderma, acute coronary syndrome, ischemic reperfusion, Crohn's Disease, endometriosis, glomerulonephritis, myasthenia gravis, idiopathic pulmonary fibrosis, asthma, acute respiratory distress syndrome (ARDS), vasculitis, and inflammatory autoimmune myositis.
In some embodiments, delivering a polypeptide to a cell involves contacting the cell with one or more of the compositions described herein.
Effective doses for such treatment options vary depending upon many different factors, including means of administration, target site, physiological state of the patient, whether the patient is human or an animal, other medications administered, and whether treatment is prophylactic or therapeutic. In some embodiments, the patient is a human, but nonhuman mammals are also be treated, e.g., companion animals such as dogs, cats, horses, etc., laboratory mammals such as rabbits, mice, rats, etc., and the like. In some embodiments, treatment dosages are titrated to optimize safety and efficacy.
In some embodiments, therapeutic dosage range from about 0.0001 to 100 mg/kg, and more usually 0.01 to 30 mg/kg, of the host body weight. In some embodiments, for example, dosages are 1 mg/kg body weight or 30 mg/kg body weight or within the range of 1-30 mg/kg. In some embodiments, an exemplary treatment regime entails administration once every week or once every two weeks or once a month or once every 3 to 6 months. In some embodiments, therapeutic agents and polypeptide constructs described herein are administered on multiple occasions. In some embodiments, intervals between single dosages are weekly, monthly or yearly. In some embodiments, intervals are also irregular as indicated by measuring blood levels of the therapeutic entity in the patient. Alternatively, the therapeutic agents or polypeptide constructs described herein are administered as a sustained release formulation, in which case less frequent administration is possible. In some embodiments, dosage and frequency varies depending on the half-life of the polypeptide in the patient.
In prophylactic applications, in some embodiments, a relatively low dosage is administered at relatively infrequent intervals over a long period of time. In some embodiments, patients continue to receive treatment for the rest of their lives. In other therapeutic applications, a relatively high dosage at relatively short intervals is required until progression of the disease is reduced or terminated, and preferably until the patient shows partial or complete amelioration of symptoms of disease. Thereafter, in some embodiments, the patent is administered a prophylactic regime.
As used herein, the terms “treatment”, “treating”, and the like, refer to administering an agent, or carrying out a procedure, for the purposes of obtaining an effect. In some embodiments, the effect is prophylactic in terms of completely or partially preventing a disease or symptom thereof. In some embodiments, the effect is therapeutic in terms of affecting a partial or complete cure for a disease or symptoms of the disease.
XIII. Kits
Disclosed herein, in some embodiments, are polypeptides comprising a signal-regulatory protein α (SIRP-α) D1 variant comprising a SIRP-α D1 domain, or a fragment thereof, having an amino acid mutation at residue 80 relative to a wild-type SIRP-α D1 domain; and at least one additional amino acid mutation relative to a wild-type SIRP-α D1 domain at a residue selected from the group consisting of: residue 6, residue 27, residue 31, residue 47, residue 53, residue 54, residue 56, residue 66, and residue 92.
Also disclosed herein, in some embodiments, are polypeptides comprising an Fc variant, wherein the Fc variant comprises an Fc domain dimer having two Fc domain monomers, wherein each Fc domain monomer independently is selected from (i) a human IgG1 Fc region consisting of mutations L234A, L235A, G237A, and N297A; (ii) a human IgG2 Fc region consisting of mutations A330S, P331S and N297A; or (iii) a human IgG4 Fc region comprising mutations S228P, E233P, F234V, L235A, delG236, and N297A.
Also provided are kits which include polypeptides described herein and instructions for use of the same. Optionally, the kits can further include at least one additional reagent. As a non-limiting example, a chemotherapeutic agent or anti-tumor antibody could serve as at least one additional agent. In some embodiments, kits include a label indicating the intended use of the contents of the kit. The term label includes any writing, or recorded material supplied on or with the kit, or which otherwise accompanies the kit.
In some embodiments, a kit includes (i) a polypeptide including a high affinity SIRP-α D1 variant; optionally (ii) an antibody; and (iii) instructions for administering (i) and (ii) (if provided) to a subject having a disease. In some embodiments, kits include (i) a polypeptide including a high affinity SIRP-α D1 variant; and (ii) instructions for administering (i) with an antibody, for example, an antibody that is not provided in the kit, to a subject having a disease. In some embodiments, kits include (i) an antibody; and (ii) instructions for administering (i) with a polypeptide including a high affinity SIRP-α D1 variant to a subject having a disease.
In some embodiments, the kits are used to treat a subject having cancer, such as solid tumor cancer, hematological cancer, acute myeloid leukemia, chronic lymphocytic leukemia, chronic myeloid leukemia, acute lymphoblastic leukemia, non-Hodgkin lymphoma, Hodgkin lymphoma, multiple myeloma, bladder cancer, pancreatic cancer, cervical cancer, endometrial cancer, lung cancer, bronchus cancer, liver cancer, ovarian cancer, colon and rectal cancer, stomach cancer, gastric cancer, gallbladder cancer, gastrointestinal stromal tumor cancer, thyroid cancer, head and neck cancer, oropharyngeal cancer, esophageal cancer, melanoma, non-melanoma skin cancer, Merkel cell carcinoma, virally induced cancer, neuroblastoma, breast cancer, prostate cancer, renal cancer, renal cell cancer, renal pelvis cancer, leukemia, lymphoma, sarcoma, glioma, brain tumor, carcinoma, or any combinations thereof. In some embodiments, the kits are used to treat a subject having a solid tumor cancer or a hematological cancer.
In some embodiments, the kits are used to treat a subject having immunological diseases. In some embodiments, the immunological disease is an autoimmune disease or an inflammatory disease, such as multiple sclerosis, rheumatoid arthritis, a spondyloarthropathy, systemic lupus erythematosus, an antibody-mediated inflammatory or autoimmune disease, graft versus host disease, sepsis, diabetes, psoriasis, atherosclerosis, Sjogren's syndrome, progressive systemic sclerosis, scleroderma, acute coronary syndrome, ischemic reperfusion, Crohn's Disease, endometriosis, glomerulonephritis, myasthenia gravis, idiopathic pulmonary fibrosis, asthma, acute respiratory distress syndrome (ARDS), vasculitis, inflammatory autoimmune myositis, or any combinations thereof.
EXAMPLES Example 1—SIRP-α D1 Variant Polypeptides
Generating Polypeptides of the Disclosure
A polypeptide of the disclosure including a high affinity SIRP-α D1 variant is generated using conventional molecular cloning and protein expression techniques. Possible amino acid substitutions in a SIRP-α D1 variant relative to a wild-type SIRP-α D1 domain are listed in Tables 2 and 5. A nucleic acid molecule encoding a polypeptide of the disclosure is cloned into a vector optimized for expression in bacterial or mammalian cells using well known molecular biology techniques. After induction of protein expression, cells are collected and the expressed polypeptides are purified from the cell culture supernatant using affinity column chromatography. Purified polypeptides are then analyzed by SDS-PAGE, followed by Coomassie Blue staining to confirm the presence of protein bands of expected size.
Purified polypeptides are screened for binding to CD47 using available techniques in the art, such as phage display, yeast display, surface plasmon resonance (SPR), scintillation proximity assays, ELISA, ORIGEN immunoassay (IGEN), fluorescence quenching, fluorescence transfer, or any suitable bioassay. The desired polypeptides bind with higher affinity to CD47, e.g., human CD47, than a wild-type SIRP-α.
Binding Affinity of SIRP-α D1 Variant Polypeptides
In a series of experiments, polypeptides of wild-type SIRP-α D1 domains and high affinity SIRP-α D1 variants were generated using conventional molecular cloning and protein expression techniques. Binding to human CD47 was determined using SPR as follows: briefly, binding of human CD47 (R and D Systems, catalog number 4670-CD or in-house produced as monomeric extracellular domain, ECD) to wild-type SIRP-α and SIRP-α D1 variant polypeptides variants was analyzed on a Biacore T100 instrument (GE Healthcare) or Proteon XPR36 (Bio-rad, Hercules, Calif.) using phosphate buffered saline (PBS, pH 7.4) supplemented with 0.01% Tween-20 (PBST) as running buffer. 200 to 1000 RU of ligand were immobilized in 10 mM sodium acetate buffer (pH 4.5) on a Biacore chip CM4 sensor or Proteon GLC chip by standard amine coupling following manufacturer recommendations. Several concentrations of analyte (or SIRP-α D1 variant polypeptides), e.g., ranging from at least 0.1× to 10×KD value, were injected for two minutes with a flow rate 100 L/min, followed by ten minutes of dissociation time. After each analyte injection, the surface was regenerated using a 2:1 mixture of Pierce IgG elution buffer (Life Technologies, catalog number 21004) and 4 M NaCl injected for 30 seconds. Complete regeneration of the surface was confirmed by baseline analysis and injecting the same analyte at the beginning and end of the experiment. All sensorgrams were double-referenced using reference surface and a buffer injection and fitted to 1:1 Langmuir. The analyte was primarily monomeric, either CD47 ECD or SIRP-α without Fc. Ligand on the chip can be either monomeric or an Fc fusion. Binding data is provided in Table 16. All SPR assays were performed at 25° C.
TABLE 16
SIRP-α Variant Polypeptide and Associated KD Values
Human CD47
SEQ ID NO: KD (M)
2  0.5 × 10−6
53   4.5 × 10−10
54  2.7 × 10−9
55   6.2 × 10−10
56   2.0 × 10−10
57   3.6 × 10−10
58   1.6 × 10−10
59  1.4 × 10−8
60   3.8 × 10−10
61   3.8 × 10−10
62   1.3 × 10−10
63   8.9 × 10−11
64 5.45 × 10−9
65  8.00 × 10−10
66  4.70 × 10−10
67  2.06 × 10−10
68  2.51 × 10−10
69 2.40 × 10−9
71 4.94 × 10−9
72  7.38 × 10−10
73  4.48 × 10−10
74  2.76 × 10−10
75 1.33 × 10−9
76 7.41 × 10−9
77  1.14 × 10−10
78  1.44 × 10−11
79  2.17 × 10−10
80  4.72 × 10−11
85  1.19 × 10−10
It has also been determined that having a glutamate or aspartate residue at position 54 improves the binding of SIRP-α D1 variant polypeptides to mouse CD47. As a non-limiting example, the SIRP-α D1 variant polypeptides identified in Table 17 below demonstrate high affinity binding to mouse CD47. The binding affinity to human CD47 of several SIRP-α D1 variant polypeptides was compared to the binding affinity to mouse CD47 using SPR as previously described, with mouse CD47 protein being used in place of human CD47 where appropriate. The results are presented in Table 18.
TABLE 17
SIRP-α Variant Polypeptide Sequences having
Improved Binding to Mouse CD47
SEQ
ID
NO: Amino Acid Sequence
195 EEELQIIQPDKSVLVAAGETATLRCTMTSLFPVGPIQWFRGAGPG
RELIYNQREGPFPRVTTVSDTTKRNNMDFSIRIGAITPADAGTYY
CVKFRKGSPDDVEFKSGAGTELSVRAKPS
196 EEELQIIQPDKSVLVAAGETATLRCTITSLKPVGPIQWFRGAGPG
RELIYNQREGPFPRVTTVSDTTKRNNMDFSIRIGAITPADAGTYY
CVKFRKGSPDDVEFKSGAGTELSVRAKPS
197 EEELQIIQPDKSVLVAAGETATLRCTITSLRPVGPIQWFRGAGPG
RELIYNQREGPFPRVTTVSDTTKRNNMDFSIRIGAITPADAGTYY
CVKFRKGSPDDVEFKSGAGTELSVRAKPS
198 EEELQIIQPDKSVLVAAGETATLRCTITSLYPVGPIQWFRGAGPG
RELIYNQREGPFPRVTTVSDTTKRNNMDFSIRIGAITPADAGTYY
CVKFRKGSPDDVEFKSGAGTELSVRAKPS
199 EEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQWFRGAGPG
RELIYNQRDGPFPRVTTVSDTTKRNNMDFSIRIGAITPADAGTYY
CVKFRKGSPDDVEFKSGAGTELSVRAKPS
200 EEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQWFRGAGPG
RELIYNQREGPFPRVTTVSDTTKRNNMDFSIRIGAITPADAGTYY
CVKFRKGIPDDVEFKSGAGTELSVRAKPS
201 EEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQWFRGAGPG
RELIYNQREGPFPRVTTVSDTTKRNNMDFSIRIGAITPADAGTYY
CVKFRKGMPDDVEFKSGAGTELSVRAKPS
202 EEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQWFRGAGPG
RELIYNQREGPFPRVTTVSDTTKRNNMDFSIRIGAITPADAGTYY
CVKFRKGSPDVEFKSGAGTELSVRAKPS
203 EEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQWFRGAGPG
RELIYNQREGPFPRVTTVSDTTKRNNMDFSIRIGAITPADAGTYY
CVKFRKGSSEPDVEFKSGAGTELSVRAKPS
204 EEELQIIQPDKSVLVAAGETATLRCTITSLRPVGPIQWFRGAGPG
RELIYNQRDGPFPRVTTVSDTTKRNNMDFSIRIGAITPADAGTYY
CVKFRKGSPDDVEFKSGAGTELSVRAKPS
205 EEELQIIQPDKSVLVAAGETATLRCTITSLRPVGPIQWFRGAGPG
RELIYNQREGPFPRVTTVSDTTKRNNMDFSIRIGAITPADAGTYY
CVKFRKGIPDDVEFKSGAGTELSVRAKPS
206 EEELQIIQPDKSVLVAAGETATLRCTITSLRPVGPIQWFRGAGPG
RELIYNQRDGPFPRVTTVSDTTKRNNMDFSIRIGAITPADAGTYY
CVKFRKGIPDDVEFKSGAGTELSVRAKPS
207 EEELQIIQPDKSVLVAAGETATLRCTITSLYPVGPIQWFRGAGPG
RELIYNQRDGPFPRVTTVSDTTKRNNMDFSIRIGAITPADAGTYY
CVKFRKGSPDDVEFKSGAGTELSVRAKPS
208 EEELQIIQPDKSVLVAAGETATLRCTITSLYPVGPIQWFRGAGPG
RELIYNQREGPFPRVTTVSDTTKRNNMDFSIRIGAITPADAGTYY
CVKFRKGIPDDVEFKSGAGTELSVRAKPS
209 EEELQIIQPDKSVLVAAGETATLRCTITSLYPVGPIQWFRGAGPG
RELIYNQRDGPFPRVTTVSDTTKRNNMDFSIRIGAITPADAGTYY
CVKFRKGIPDDVEFKSGAGTELSVRAKPS
210 EEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQWFRGAGPG
RELIYNQRDGPFPRVTTVSDTTKRNNMDFSIRIGAITPADAGTYY
CVKFRKGIPDDVEFKSGAGTELSVRAKPS
TABLE 18
Binding of SIRP-α Variant Polypeptides to Human and Mouse CD47
SEQ ID NO: KD (M) − Human KD (M) − Mouse
96 1.04 × 10−11 3.32 × 10−8
97 1.55 × 10−9 >100 nM
100 2.69 × 10−9 6.32 × 10−8
104 9.19 × 10−11 8.04 × 10−9
86 1.44 × 10−11 4.30 × 10−8
85 8.23 × 10−11 1.14 × 10−8
204 3.49 × 10−09 5.21 × 10−9
206 5.26 × 10−09 3.33 × 10−9
209 4.46 × 10−09 4.11 × 10−9
210 6.79 × 10−09 6.01 × 10−9
It has also been determined that the N80A mutation, which can minimize or abrogate partial glycosylation present in certain SIRP-α D1 variant polypeptides, confers a functional benefit of increasing the homogeneity associated with SIRP-α D1 variant polypeptides containing such mutation. When SIRP-α variant polypeptides are expressed in E. coli, no glycosylation of N80 will occur due to lack of glycosylation system in E. coli compared to a mammalian system. Table 19 shows that effective binding between a SIRP-α D1 variant polypeptide produced in E. coli and human CD47 can still occur, thus demonstrating that deglycosylation does not affect the binding affinity with which SIRP-α D1 variants can still bind to CD47. In addition to the N80A mutation, deglycosylation can be accomplished by mutating N80 to any amino acid which is not N or by disrupting the motif N-Xaa1-Xaa2 wherein N=asparagine; Xaa1=any amino acid except P (proline); Xaa2=T (threonine), S (serine) or C (cysteine), wherein the motif refers to residues 80-82 of a SIRP-α D1 variant polypeptide. By mutating P83 to valine or other residue which is not P, increased glycosylation at N80 can occur and homogenously glycosylated SIRP-α D1 variant polypeptides can be generated.
The amino acid P83 can also affect the degree of glycosylation. Changing P83 to any amino acid can increase the efficiency of glycosylation at N80. A SIRP-α D1 variant having a valine (V) at position 83 (SEQ ID NO: 213) was expressed in HEK293FS mammalian cells. The size of the expressed protein was compared to a SIRP-α D1 variant having the wild-type amino acid residue (e.g., proline, P) at position 83 (SEQ ID NO: 71). Molecular weight analysis of the expressed protein on a protein gel (FIG. 18 ) shows that the variant having a P83V mutation (SEQ ID NO: 213, Lane 2) has a higher molecular weight (e.g., ˜22 kDa) compared to the variant that is unmutated at position 83 (Lane 1). As shown in FIG. 18 , when residue 83 is mutated to Val, the SIRP-α variant polypeptide expressed in a mammalian cell host is primarily a molecule at higher molecular weight (˜22 kDa), indicating efficiency for glycosylation at N80 can be increased.
TABLE 19
Representative Binding Data for SIRP-α Variant Polypeptide
Sequences having Various Glycosylation Profiles
SEQ ID NO: KD (M) Expression system
53   4.5 × 10−10 E. coli
58   1.6 × 10−10 E. coli
60   3.8 × 10−10 E. coli
63   8.9 × 10−11 E. coli
55   6.2 × 10−10 E. coli
62   1.3 × 10−10 E. coli
57   3.6 × 10−10 E. coli
56   2.0 × 10−10 E. coli
61   3.8 × 10−10 E. coli
54  2.7 × 10−9 E. coli
59  1.4 × 10−8 E. coli
2  0.5 × 10−6 E. coli
53   5.2 × 10−10 mammalian cell
77  1.14 × 10−10 mammalian cell
74  2.76 × 10−10 mammalian cell
73  4.48 × 10−10 mammalian cell
72  7.38 × 10−10 mammalian cell
75 1.33 × 10−9 mammalian cell
71 4.94 × 10−9 mammalian cell
76 7.41 × 10−9 mammalian cell
Example 2—Generation of Single Arm and Bispecific SIRP-α Polypeptides
The ability of constructs comprising heterodimers of (i) a SIRP-α-Fc fusion protein and (ii) Fc domain monomer fused to a polypeptide, such as an antigen binding domain, to bind both CD47 and an antigen, e.g., EGFR, was determined by SPR as previously described in this example. The Fc fusion proteins for forming heterodimers are provided in Table 20. Three monofunctional (e.g., binding one target) SIRP-α-Fc fusions were tested. These fusion proteins are depicted as A, B, C in FIG. 6A. A first monofunctional SIRP-α-Fc fusion (“A”) was a homodimer of SEQ ID NO: 136. Second and third monofunctional SIRP-α-Fc fusions were heterodimers of (i) a SIRP-α-Fc fusion and (ii) a Fc domain monomer without an additional polypeptide fused to it. These were generated using the Knob & Hole mutation engineering strategies depicted in FIGS. 4A and 4B. One monofunctional SIRP-α-Fc fusion (“B”) was formed from heterodimerization of SEQ ID NO: 139 (an Fc variant) and SEQ ID NO: 142 (a SIRP-α-Fc fusion). Another monofunctional SIRP-α-Fc fusion (“C”) was formed from heterodimerization of SEQ ID NO: 139 (an Fc variant) and SEQ ID NO: 138 (a SIRP-α Fc fusion). The bifunctional (e.g., binding two targets) SIRP-α-Fc fusion (“D”) was formed from heterodimerization of SEQ ID NO: 127 (a SIRP-α Fc fusion) and SEQ ID NO: 144 (an antigen binding region of Erbitux linked to an Fc variant). SEQ ID NO: 220 represents the light chain of the Erbitux antibody.
TABLE 20
Amino Acid Sequences of Fc Fusion Proteins for
Forming Heterodimers
SEQ
ID
NO: Amino Acid Sequence
138 EEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQWFRGAGPG
RVLIYNQRQGPFPRVTTVSDTTKRNNMDFSIRIGAITPADAGTYY
CIKFRKGSPDDVEFKSGAGTELSVRAKPSDKTHTCPPCPAPEAAG
APSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDG
VEVHNAKTKPREEQYASTYRVVSVLTVLHQDWLNGKEYKCKVSNK
ALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLWCLVKG
FYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
139 DKTHTCPPCPAPEAAGAPSVFLFPPKPKDTLMISRTPEVTCVVVD
VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYASTYRVVSVLTVLH
QDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR
EEMTKNQVSLSCAVKGFYPSDIAVEWESNGQPENNYKTTPPVLDS
DGSFFLVSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSP
GK
142 EEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQWFRGAGPG
RELIYNQREGPFPRVTTVSDTTKRNNMDFSIRIGAITPADAGTYY
CVKFRKGSPDDVEFKSGAGTELSVRAKPSDKTHTCPPCPAPEAAG
APSVFLEPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDG
VEVHNAKTKPREEQYASTYRVVSVLTVLHQDWLNGKEYKCKVSNK
ALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLWCLVKG
FYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
144 QVQLKQSGPGLVQPSQSLSITCTVSGFSLTNYGVHWVRQSPGKGL
EWLGVIWSGGNTDYNTPFTSRLSINKDNSKSQVFFKMNSLQSNDT
AIYYCARALTYYDYEFAYWGQGTLVTVSSASTKGPSVFPLAPSSK
STSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCRKT
HTCPRCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH
EDPEVKFNWYVDGVEVHNAKTKPREEQYASTYRVVSVLTVLHQDW
LNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEM
TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGS
FFLYSRLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
220 DILLTQSPVILSVSPGERVSFSCRASQSIGTNIHWYQQRTNGSPR
LLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIADYYCQQ
NNNWPTTFGAGTKLELKRTVAAPSVFIFPPSDEQLKSGTASVVCL
LNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
217 EEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQWFRGAGPG
RELIYNQREGPFPRVTTVSDTTKRNNMDFSIRIGAITPADAGTYY
CVKFRKGSPDDVEFKSGAGTELSVRAKPSEKTHTCPECPAPEAAG
APSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDG
VEVHNAKTKPREEQYASTYRVVSVLTVLHQDWLNGKEYKCKVSNK
ALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCEVKG
FYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Briefly, CD47 was immobilized on a Proteon GLC chip by amine chemistry as described above. In a first injection, analytes (e.g., A, B, C, D, and Erbitux) were injected at 30 uL/min in PBST for 60 s at 100 nM and binding to the CD47 surface was determined by SPR. In a second, injection 100 nM EGFR-ECD (epidermal growth factor receptor extracellular domain produced in HEK293 cells) was injected and binding of EGFR-ECD to the CD47-bound analytes was measured. Erbitux did not bind CD47 on the chip and therefore it was not able to bind EGFR in the second injection as shown by the curve labeled “Erbitux” in FIG. 6B and illustrated in FIG. 6A. SIRP-α-Fc fusions (e.g., A, B, and C) did bind CD47 but did not bind EGFR in the second injection as shown by the curves labeled “A,” “B,” and “C” shown in FIG. 6B and illustrated in FIG. 6A. The monomeric proteins, or proteins with one SIRP-α D1 domain (e.g., B and C) higher resonance units than the dimeric protein (e.g., A) due to a higher amount of molecules bound to the same CD47 sites available on the chip as shown by the curves labeled “B” and “C”, indicating binding to immobilized CD47 and negligible binding to EGFR-ECD (e.g., monofunctionality). Heterodimeric SIRP-α-Erbitux-Fc bound CD47 on the chip and was also able to bind EGFR-ECD in the second injection as shown by the curve labeled “D” in FIG. 6B, indicating binding to immobilized CD47 and binding of EGFR-ECD (e.g., bi-functionality).
Example 3—Testing Polypeptides with High Binding Affinity to CD47 in Mice
Genetically engineered mouse models of various cancers, e.g., solid tumor and hematological cancer, are used to test the binding of polypeptides of the disclosure to CD47. A polypeptide of the disclosure is injected in a mouse, which is dissected at the later time to detect the presence of the complex of the polypeptide and CD47. Antibodies specific to SIRP-α or CD47 are used in the detection.
Example 4—Testing Polypeptides for Immunogenicity
Polypeptides including a high affinity SIRP-α D1 variant are tested in immunogenicity assays. The polypeptides are tested both in silico and in vitro in T-cell proliferation assays, some of which are commercially available. Polypeptides which provoke a minimal immunogenicity reaction in an in vitro T-cell proliferation assay and display a greater binding affinity to CD47 than does wild-type SIRP-α are selected for further development.
Example 5—Testing Polypeptides for In Vivo Toxicity
Different polypeptides including different high affinity SIRP-α D1 variants which display various degrees of increased binding affinities to CD47 than does wild-type SIRP-α are injected into an animal cancer model (e.g., a mouse cancer model) to assay the effect of different binding affinities on toxicity in the organism. Non-human primate (NHP) can also be used to test high-affinity SIRP-α D1 variants, as the level of cross reactivity for non-human primate (NHP) CD47 and mouse CD47 may be different.
Example 6—Fcγ Receptor Binding of Fc Variants
In addition to their ability to modulate target function, therapeutic monoclonal antibodies and Fc containing fusion proteins are also capable of eliciting two primary immune effector mechanisms: antibody-dependent cell cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC). ADCC is mediated by Fc region binding to activating Fcγ receptors and polypeptide constructs comprising Fc variants described herein were tested for Fcγ receptor binding. As shown in Table 21 below, the polypeptide constructs demonstrated decreased binding to one or more Fcγ receptors as compared to a corresponding wild-type IgG Fc. With regard to IgG1, the mutations L234A, L235A, G237A, and N297A of an IgG1 Fc resulted in a severe loss of binding to Fcγ receptors CD16a, CD32a, CD32b, CD32c, and CD64 as compared to a wild-type IgG1, or a construct lacking one or more of these mutations. Accordingly, the mutations L234A, L235A, G237A (e.g., IgG1 AAA), along with aglycosylation or the deglycosylating mutation N297A results in complete loss of binding to the Fcγ receptors studied. Since Fcγ receptor binding is known to be important to phagocytosis, the mutations L234A, L235A, G237A, and N297A can result in reduction of phagocytosis of the construct comprising the Fc variant.
The following materials and methods were used in this example. Binding of human Fcγ receptors RI (CD64), RIIA (CD32a), RIIB/C (CD32b/c) and RIIIA (CD16a) (R & D Systems, catalog numbers 1257-FC-050, 1330-CD-050, 1875-CD-050 and 4325-FC-050 respectively) to Fc variant constructs was analyzed on a ProteOn XPR36 instrument (Bio-Rad, Hercules, Calif.) using phosphate buffered saline (PBS, pH 7.4) supplemented with 0.01% Tween-20 as running buffer. Approximately 400 Resonance Unit (RU) of minimally biotinylated Fc constructs were immobilized on flow cells of a NLC sensor chip (Bio-rad, Hercules, Calif.) by avidin-neutravidin interaction. Biotinylation was performed according to the manufacturer's instructions using Pierce EZ-Link Sulfo-NHS-LC-LC-Biotin and an equimolar ratio of linker:protein. Analytes (hFcγR) were injected in a “one-shot” kinetic mode at nominal concentrations of 0, 61, 185, 555, 1666, and 5000 nM. Association and dissociation times were monitored for 90s and 600s respectively. After each injection, the surface was regenerated using a 2:1 v/v mixture of Pierce IgG elution buffer (Life Technologies, catalog number 21004) and 4 M NaCl. Complete regeneration of the surface was confirmed by injecting the Fc variants at the beginning and end of the experiment. Biosensor data were double-referenced by subtracting the interspot data (containing no immobilized protein) from the reaction spot data (immobilized protein) and then subtracting the response of a buffer “blank” analyte injection from that of an analyte injection. Double-referenced data were fit to an equilibrium analysis using a simple binding isotherm. KD,app. For Fc molecules with strong binding to hFcγRI, data were also fit globally to a simple Langmuir model and the KD,app value was calculated from the ratio of the apparent kinetic rate constants (KD app=kd,app/ka,app)
As shown in Table 21, the mutations A330S, P331S, and N297A of an IgG2 Fc region resulted in a severe loss of binding to Fcγ receptors CD16a, CD32a, CD32b, CD32c, and CD64 as compared to a wild-type IgG or a construct lacking these mutations. Accordingly, the mutations A330S and P331S along with aglycosylation or the deglycosylating mutation N297A resulted in complete loss of binding to the Fcγ receptors studied. Since Fcγ receptor binding is known to be important to phagocytosis, the mutations A330S, P331 S, and N297A are predicted to result in a reduction in phagocytosis of the Fc variant. Binding data for IgG4 and various mutations are also provided.
TABLE 21
Binding Data (KD) for Fcγ Receptor Binding to Fc Variants.
FC description CD16a CD32a CD32b/c CD64
IgG1  370 nM  400 nM 2000 nM 0.004 nM
IgG1_AAA 2300 nM  8000 nM
IgG1_N297A   150 nM
IgG1_AAA_N297A
IgG2  420 nM   700 nM
IgG2_A330S, P331S  390 nM   900 nM
IgG2_N297A
IgG2_A330S, P331S,
N297A
IgG4 4100 nM  720 nM  710 nM    1 nM
IgG4_S228P
3000 nM  810 nM  850 nM    1 nM
IgG4_S228P, L235E 2400 nM 1200 nM 1100 nM   60 nM
IgG4_S228P, E233P, 1600 nM  2100 nM
F234V, L235A, delG236
An absence of binding is represented by “—”
Example 7—C1q Binding Determination of Fc Variants
Complement-dependent cytotoxicity (CDC) is mediated by complement protein C1q and activation of the complement cascade. Binding of various concentrations of C1q complement to various SIRP-α Fc constructs was determined by enzyme-linked immunosorbent assay (ELISA). SIRP-α Fc fusions were prepared at 5 μg/mL in PBS pH 7.4 and used to coat duplicate wells of Nunc Immulon 4HBX ELISA 96 well plates (using 50 μL/well) overnight at 4° C. The following day, plates were washed five times with wash buffer (PBS and 0.05% Tween-20) and incubated with 200 μL/well of blocking buffer (PBS and 0.5% BSA) for 1 hour at room temperature. Plates were washed five times and incubated for 2 hours at room temperature with 0, 0.13, 0.41, 1.23, 3.7, 11.1, 33.3, 100 μg/mL C1q in assay buffer (PBS, 0.5% BSA, 0.05% Tween-20, 0.25% CHAPS, 5 mM EDTA, and 0.35% NaCl). Plates were washed and incubated for 1 hour with 50 l/well HRP Conjugated sheep-anti-human-C1q at 2.0 μg/mL in assay buffer. Plates were washed five times and incubated for ˜10 minutes with TMB (1-Step Ultra TMB-ELISA, Thermo Sci. Cat. #34028). Finally, 50 μL/well Pierce/Thermo Sci. Stop Solution (0.16M sulfuric acid, cat. # N600) was added and plates were read at 450 nm absorbance with a 570 nm reference. Wells lacking SIRP-α-Fc fusion were run to control for non-specific binding of C1q or the HRP-conjugated detection antibody to the plate. Wells lacking C1q were run to control for non-specific binding of the HRP-conjugated detection antibody to a SIRP-α-Fc fusion or to the plate.
As shown in FIG. 14 , both wildtype IgG1 (SEQ ID NO: 123) and wildtype IgG2 (SEQ ID NO: 126) bound C1q in a dose dependent manner. Conversely, IgG1 variants IgG1_AAA (SEQ ID NO: 124); IgG1_N297A (SEQ ID NO: 125); and IgG1_AAA_N297A (SEQ ID NO: 96) demonstrated significantly reduced and minimally detectable C1q binding activity. Likewise, IgG2 variants IgG2_A330S, P331S (SEQ ID NO: 127); IgG2_N297A (SEQ ID NO: 128); and IgG2_N297A, A330S, P331S (SEQ ID NO: 129) also demonstrated significantly reduced and minimally detectable C1q binding activity. This reduced and minimally detectable C1q binding activity of IgG1 and IgG2 variants were comparable to wildtype IgG4 (SEQ ID NO: 130), which does not to bind C1q.
Example 8—Production of Wild-Type Fc and Fc Variants
Using the methods described herein and in accordance with embodiments of the disclosure, the wild-type Fc polypeptides and Fc variants of Table 7 have been produced.
Example 9—Production of SIRP-α Variant and Fc Variant Polypeptides
Using the methods described herein and in accordance with embodiments of the disclosure, the following SIRP-α D1 variant-Fc variant polypeptides were produced as shown in Table 22 below. Binding to human CD47 was determined by the methodologies as described in Example 1.
TABLE 22
CD47 Binding Affinity of SIRP-α Variant Fc Variant Polypeptides.
SEQ ID NO: KD (M)
96  3.51 × 10−11
97 1.09 × 10−9
98  8.73 × 10−11
99  8.95 × 10−10
100 1.79 × 10−9
101  8.90 × 10−10
102  3.79 × 10−10
103  2.56 × 10−10
104  9.19 × 10−11
105  3.16 × 10−11
106  8.11 × 10−10
107  2.19 × 10−11
108  4.78 × 10−10
109 2.15 × 10−9
110  6.53 × 10−10
111  3.15 × 10−10
112  2.22 × 10−10
113  1.32 × 10−10
114  3.43 × 10−11
115  4.98 × 10−10
135 3.46 × 10−9
136  1.19 × 10−10
Example 10—Phagocytosis of SIRP-α-Fc Variants
To obtain quantitative measurements of phagocytosis, a phagocytosis assay was utilized in which primary human macrophages and GFP+ or CFSE-labeled tumor cells were co-cultured with Fc variant polypeptide constructs described herein. The following materials and methods were employed:
Culture of Tumor Cell Lines
DLD-1-GFP-Luciferase cells, MM1R, and N87 were maintained in growth medium comprising RPMI (Gibco) supplemented with 10% heat-inactivated Fetal Bovine Serum (Gibco), 1% penicillin/streptomycin (Gibco), and 1% Glutamax (Gibco). DLD-1-GFP-Luciferase and N87 cells were grown as adherent monolayers and MM1R cells were grown in suspension.
Derivation and Culture of Human Monocyte-Derived Macrophages
Whole blood buffy coats were diluted 1:2 with Phosphate Buffered Saline (PBS, Gibco). Diluted blood was split into two tubes and underlayed with 20 ml Ficoll-Paque Plus (GE Healthcare). Tubes were centrifuged for 30 minutes at 400×g. Peripheral blood mononuclear cells (PBMCs) were collected from the interface, washed twice by addition of 40 ml PBS, centrifuged for 10 minutes at 100×g, and resuspended in FACS buffer (PBS with 0.5% Bovine Serum Albumin (Gibco)). CD14+ monocytes were purified by negative selection using the Monocyte Isolation Kit II (Miltenyi Biotec) and LS columns (Miltenyi Biotec) according to the manufacturer's protocol. CD14+ monocytes were seeded into 15 cm tissue culture plates (Corning) at 10 million cells per dish in 25 ml differentiation medium comprised of IMDM (Gibco) supplemented with 10% human AB serum (Corning), 1% penicillin/streptomycin, and 1% Glutamax. Cells were cultured for seven to ten days.
In Vitro Phagocytosis Assays
DLD-1-GFP-Luciferase and N87 cells were detached from culture plates by washing twice with 20 ml PBS and incubation in 10 ml TrypLE Select (Gibco) for 10 minutes at 37° C. Cells were removed with a cell scraper (Corning), centrifuged, washed in PBS, and resuspended in IMDM. MM1R and N87 cells were labeled with the Celltrace CFSE Cell Proliferation kit (Thermo Fisher) according to the manufacturer's instructions and resuspended in IMDM. Macrophages were detached from culture plates by washing twice with 20 ml PBS and incubation in 10 ml TrypLE Select for 20 minutes at 37° C. Cells were removed with a cell scraper (Corning), washed in PBS, and resuspended in IMDM.
Phagocytosis assays were assembled in ultra-low attachment U-bottom 96 well plates (Corning) containing 100,000 DLD-1 GFP Luciferase, MM1R, or N87 cells, five-fold serial dilutions of SIRP-α-Fc variants from 1000 nM to 64 pM, and cetuximab (Absolute Antibody), daratumumab, or control antibody of the same isotype (Southern Biotech) at 1 μg/ml. Plates were preincubated 30 minutes at 37° C. in a humidified incubator with 5 percent carbon dioxide, then 50,000 macrophages were added. Plates were incubated two hours at 37° C. in a humidified incubator with 5 percent carbon dioxide. Cells were pelleted by centrifugation for five minutes at 400×g and washed in 250 μl FACS buffer. Macrophages were stained on ice for 15 minutes in 50 μl FACS buffer containing 10 μl human FcR Blocking Reagent (Miltenyi Biotec), 0.5 μl anti-CD33 BV421 (Biolegend), and 0.5 μl anti-CD206 APC-Cy7 (Biolegend). Cells were washed in 200 μl FACS buffer, washed in 250 μl PBS, and stained on ice for 30 minutes in 50 μl Fixable Viability Dye eFluor 506 (ebioscience) diluted 1:1000 in PBS. Cells were washed twice in 250 μl FACS buffer and fixed for 30 minutes on ice in 75 μl Cytofix (BD Biosciences). Cells were washed in 175 μl FACS buffer and resuspended in 75 μl FACS buffer. Cells were analyzed on a FACS Canto II (BD Biosciences), with subsequent data analysis by Flowjo 10.7 (Treestar). Dead cells were excluded by gating on the e506-negative population. Macrophages that had phagocytosed tumor cells were identified as cells positive for CD33, CD206, and GFP or CFSE. Five polypeptide constructs comprising SIRP-α D1 domain variants fused to respective Fc variants were tested for in vitro phagocytosis:
1)
(SEQ ID NO: 105)
EEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQWFRGAGPGRVLIY
NQRQGPFPRVTTVSDTTKRNNMDFSIRIGNITPADAGTYYCIKFRKGSPD
DVEFKSGAGTELSVRAKPSVECPPCPAPPVAGPSVFLFPPKPKDTLMISR
TPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFASTFRVVSV
LTVVHQDWLNGKEYKCKVSNKGLPSSIEKTISKTKGQPREPQVYTLPPSR
EEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFF
LYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
2)
(SEQ ID NO: 127)
EEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQWFRGAGPGRVLIY
NQRQGPFPRVTTVSDTTKRNNMDFSIRIGNITPADAGTYYCIKFRKGSPD
DVEFKSGAGTELSVRAKPSERKCCVECPPCPAPPVAGPSVFLFPPKPKDT
LMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTF
RVVSVLTVVHQDWLNGKEYKCKVSNKGLPSSIEKTISKTKGQPREPQVYT
LPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDS
DGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
3)
(SEQ ID NO: 96)
EEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQWFRGAGPGRVLIY
NQRQGPFPRVTTVSDTTKRNNMDFSIRIGNITPADAGTYYCIKFRKGSPD
DVEFKSGAGTELSVRAKPSDKTHTCPPCPAPEAAGAPSVFLFPPKPKDTL
MISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYASTYR
VVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTL
PPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSD
GSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
4)
(SEQ ID NO: 124)
EEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQWFRGAGPGRVLIY
NQRQGPFPRVTTVSDTTKRNNMDFSIRIGNITPADAGTYYCIKFRKGSPD
DVEFKSGAGTELSVRAKPSDKTHTCPPCPAPEAAGAPSVFLFPPKPKDTL
MISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYR
VVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTL
PPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSD
GSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
5)
(SEQ ID NO: 134)
EEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQWFRGAGPGRVLIY
NQRQGPFPRVTTVSDTTKRNNMDFSIRIGNITPADAGTYYCIKFRKGSPD
DVEFKSGAGTELSVRAKPSAAAPPCPPCPAPEFLGGPSVFLFPPKPKDTL
MISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYR
VVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTL
PPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSD
GSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSPGK

Results
FIG. 7 shows phagocytosis of DLD-1-GFP-Luciferase tumor cells by human monocyte-derived macrophages in the presence of SEQ ID NO: 105 (Fc variant IgG2_A330S, P331S, N297A) and SEQ ID NO: 127 (Fc variant IgG2_A330S, P331S). In particular, FIG. 7 shows that SEQ ID NO: 105 (Fc variant IgG2_A330S, P331S, N297A) (in the presence or absence of a control antibody IgG1,k) has ablated phagocytosis in the phagocytosis assay as a single agent while it is able to increase cetuximab (CTX) phagocytosis (SEQ ID NO: 105+CTX). In contrast, a polypeptide with Fc variant IgG2_A330S, P331S (SEQ ID NO: 127+IgG1,k) has measurable phagocytosis activity as a single agent. The percent of macrophages that phagocytosed tumor cells and are GFP+ is indicated on the y-axis (FIG. 7 ). Concentration of CD47 binding sites from the addition of SEQ ID NO: 105 and SEQ ID NO: 127 is indicated on the x-axis. DLD-1-GFP-Luciferase cells and macrophages were incubated with the indicated concentrations of SEQ ID NO: 105, SEQ ID NO: 107 and CTX (1 ug/mL) and control antibody (IgG1, k). Cells were also incubated with PBS plus cetuximab (line labeled PBS+CTX) or a PBS plus a control antibody of the same isotype (line labeled PBS+IgG1k).
FIG. 8 shows phagocytosis of DLD-1-GFP-Luciferase tumor cells by human monocyte-derived macrophages in the presence of SEQ ID NO: 96 (Fc variant IgG1 L234A, L235A, G237A, N297A and SEQ ID NO: 124 (Fc variant IgG1 L234A, L235A, G237A). In particular, FIG. 8 shows that Fc variant IgG1 L234A, L235A, G237A, N297A (SEQ ID NO: 96) and Fc variant IgG1 L234A, L235A, G237A (SEQ ID NO: 124) have ablated phagocytosis in the phagocytosis assay as single agents. These are represented by lines labelled SEQ ID NO 96+IgG1, k and SEQ ID NO: 124+IgG1,k respectively. Interestingly, both polypeptides SEQ ID NO: 96 and SEQ ID NO: 124 increased the phagocytosis of a tumor specific antibody, CTX. As shown in FIG. 8 , the percent of macrophages that phagocytosed tumor cells and are GFP+ is indicated on the y-axis. Concentration of CD47 binding sites from addition of SEQ ID NO: 96 and SEQ ID NO: 124 is indicated on the x-axis. DLD-1-GFP-Luciferase cells and macrophages were incubated with CTX at 1 μg/mL and the indicated concentrations of SEQ ID NO: 96 (line labeled SEQ ID NO: 96+CTX) or SEQ ID NO: 124 (line labeled SEQ ID NO: 124+CTX). To identify nonspecific effects of cetuximab upon phagocytosis, cells were incubated with a control antibody of the same isotype as cetuximab and the indicated concentrations of SEQ ID NO: 96 (line labeled SEQ ID NO: 96+IgG1,k) or SEQ ID NO: 124 (line labeled SEQ ID NO: 124+IgG1,k). Cells were also incubated with PBS plus cetuximab (line labeled PBS+CTX) or a PBS plus a control antibody of the same isotype (line labeled PBS+IgG1k).
FIG. 9 shows phagocytosis of DLD-1-GFP-Luciferase tumor cells by human monocyte-derived macrophages in the presence of SEQ ID NO: 134 (Fc variant IgG4_S228P). In particular, FIG. 9 shows that the SEQ ID NO: 134 construct has considerable phagocytosis activity as a single agent in in vitro phagocytosis. As shown in FIG. 9 , the percent of macrophages that phagocytosed tumor cells and are GFP+ is indicated on the y-axis. Concentration of CD47 binding sites from addition of SEQ ID NO: 134 is indicated on the x-axis. DLD-1-GFP-Luciferase cells and macrophages were incubated with the indicated concentrations of SEQ ID NO: 134 (line labeled SEQ ID NO: 134+Medium). Cells were also incubated with control antibody (IgG1, k; black square).
Example 11—Production of SIRP-α Variant and HSA Polypeptides
Additionally, using the methods described herein and in accordance with embodiments of the disclosure, SIRP-α D1 variant polypeptide was expressed by fusion to HSA polypeptides, as shown in Table 23 below. Binding to human CD47 was determined by the methodologies as described in Example 1.
TABLE 23
CD47 Binding Affinity of SIRP-α Variants Fused to HSA Polypeptides
SEQ ID NO: KD (M)
150  4.53 × 10−10
151 5.54 × 10−9
152  2.78 × 10−10
153 4.24 × 10−9
154  2.35 × 10−10
155 1.11 × 10−8
157 2.15 × 10−9
158 1.09 × 10−9
159   7.6 × 10−10
Example 12—Extended Half-Life Associated with SIRP-α Variant Polypeptides
As shown in Table 24 and FIG. 10 , SIRP-α D1 variant polypeptides comprising Fc and HSA fusions can have an extended half-life compared to a SIRP-α D1 variant alone. For example, the SIRP-α D1 variant polypeptide fused to Fc as represented by SEQ ID NO: 104 and the SIRP-α D1 variant polypeptide fused to HSA as represented by SEQ ID NO: 159 have increased half-life relative to a SIRP-α D1 variant polypeptide which is not fused to an Fc or HSA as represented by SEQ ID NO: 85. The half-life extension can be attributed to the ability of SIRP-α D1 variant polypeptides which are fused to Fc and HSA to bind to FcRn, which may be associated with prolonged cycling.
TABLE 24
Half-life Measurements for Single Dose
Treatments with SIRP-α Variant Polypeptides
Dosage Half-life
SEQ ID NO: amount (hour)
104 10 mg/kg 41.10
159 10 mg/kg 24.54
85 10 mg/kg 8.20
The methodologies used for this Example are as follows. Briefly, CD-1 male mice weighing approximately 25 grams were obtained from Harlan Labs, and were used for the single dose PK study of the compounds represented by SEQ ID NO: 104, SEQ ID NO: 159, and SEQ ID NO: 85. Each compound was formulated at a working dose of 5 mg/mL. The volume of the dose was adjusted based on the weight of each mouse, ensuring that each mouse was dosed at 1, 3 and 10 mg/kg. The compounds were administered intravenously via the mouse tail vein. Three mice were dosed for each time point at each dose level for each compound. After dosing, mice had blood withdrawn at the following 8 time points: 0.25, 1, 4, 8, 24, 48, 72 and 120 hrs. 500 μL of whole blood was collected into microtainer tubes by orbital bleed. Whole blood samples were rested for 30 minutes to allow serum separation. Samples were then centrifuged for 10 min at 4° C. at a RCF of 1000. Serum was then transferred to 0.5 mL tubes within 40 min of processing and kept frozen until analysis.
The data for SEQ ID NO: 104 was obtained using a human Fc ELISA protocol. Briefly, Immulon 4HBX ELISA 96 well plates were coated (Thermo Scientific cat. #3855) with 2 μg/ml, 100 μl/well of purified CD47 overnight at room temperature in 1× antigen coating buffer (ImmunoChemistry Technologies, cat. #6248). Wells were washed 5 times with 200-300 μL/well 1×TBST (Tris-Buffered Saline+0.05% Tween-20) (Thermo Scientific 20×, cat. #28360). Wells were blocked with 200 μL/well 7.5% BSA in PBS (GIBCO, cat. #15260-037) for 1-2 hours. Wells were washed 5 times with 200-300 μL/well 1×TBST. 50 μL/well standard curve, Quality Controls (QCs) and unknown samples diluted in normal CD1 mouse serum diluted 1:4 in TBS was added. The standard curve, QCs and unknown samples were incubated at room temperature for 1 hour. Concentrations for standard curve were as follows: 0.2500 μg/mL; 0.1250 μg/mL; 0.0625 μg/mL; 0.0313 μg/mL; 0.0156 μg/mL; 0.0078 μg/mL; 0.0039 μg/mL; 0.0020 μg/mL; 0.0010 μg/mL; 0.0005 μg/mL; 0.00025 μg/mL; and 0.00000 μg/mL. Quality Controls (QCs) were frozen and aliquoted, and standard curve protein at a “high,” “mid,” and “low” concentrations on the linear curve of the standard curve which served as controls to ensure that the assay was working well were as follows: QC High=0.125 μg/ml; QC Mid=0.016 μg/ml; and QC Low=0.004 μg/ml.
Then, the wells were washed 5 times with 200-300 μL/well 1×TBST. 50 μL/well of 0.25 ug/mL Abbexa Goat anti-Human IgG Fc polyclonal antibody (11.6 mg/mL stock, Abbexa cat. # abx023511) diluted into 1×TBST+1% BSA was added and incubated for 1 hour at room temperature. Plates were washed5 times with 200-300 μL/well 1×TBST. 50 μL/well of 0.125 μg/mL ZyMax/Invitrogen rabbit anti-goat IgG-HRP conjugated (Thermo Scientific, cat. #81-1620), diluted into TBST+1% BSA was added and incubated for 1 hour at room temperature. Wells were washed 6 times with 200-300 μL/well 1×TBST. The following steps and reagents were carried out at room temperature: 0 μL/well room temperature 1-Step Ultra TMB-ELISA (Thermo Scientific cat. #34028) was added and incubated 2-5 minutes at room temperature until color development was sufficient. 50 μL/well of room temperature Stop Solution (0.16M sulfuric acid, Thermo Scientific cat. # N600) was added immediately and mixed well. Plates were read immediately in a spectrophotometer at O.D. 450 and at O.D. 570. The O.D. 570 reading was a background reading which was subtracted from the O.D. 450 reading. Using a software program like Molecular Devices SoftMax Pro or Graph Pad Prism, the standard curve values were plotted using a 4 parameter fit curve and the concentrations of the unknown samples were interpolated from the standard curve using the software.
The data for SEQ ID NO: 85 was obtained using a His Tag ELISA protocol. Immulon 4HBX ELISA 96 well plates (Thermo Scientific cat. #3855) were coated with 2 μg/mL, 100 μL/well of purified CD47 overnight at room temperature in 1× antigen coating buffer (ImmunoChemistry Technologies, cat. #6248). Wells were washed 5 times with 200-300 μL/well using 1×TBST (Tris-Buffered Saline+0.05% Tween-20) (Thermo Scientific 20×, cat. #28360). Wells were blocked with 200 μL/well 7.5% BSA in PBS (GIBCO, cat. #15260-037) for 1-2 hours. Wells were washed 5 times with 200-300 μL/well 1×TBST. 50 μL/well standard curve, Quality Controls (QCs) and unknown samples diluted in normal CD1 mouse serum diluted 1:4 in TBS were added. The standard curve, QCs and unknown samples were incubated at room temperature for 1 hour. The standard curve concentrations were as follows: 0.12500 μg/mL; 0.06250 μg/mL; 0.03125 μg/mL; 0.01563 μg/mL; 0.00781 μg/mL; 0.00391 μg/mL; 0.00195 μg/mL; 0.00098 μg/mL; and 0.00000 μg/mL. Quality Controls (QCs) were frozen and aliquoted, and standard curve protein at a “high,” “mid,” and “low” concentration on the linear curve of the standard curve which served as controls to ensure that the assay was working well were as follows: QC High=0.02 μg/ml; QC Mid=0.01 g/ml; and QC Low=0.005 μg/ml.
Thereafter, wells were washed 5 times with 200-300 μL/well 1×TBST. 50 μL/well of 0.2 μg/mL Abcam rabbit anti-6×His Tag-HRP conjugated polyclonal antibody (1 mg/mL stock, abcam cat. # ab1187) diluted into TBST+1% BSA was added and incubated for 1 hour at room temperature. Plates were washed 6 times with 200-300 uL/well 1×TBST. Thereafter, the following steps and agents were carried out at room temperature. 50 L/well of room temperature 1-Step Ultra TMB-ELISA (Thermo Scientific cat. #34028) was added and incubated 3-5 minutes at room temperature until color development was sufficient. 50 μL/well of room temperature Stop Solution (0.16M sulfuric acid, Thermo Scientific cat. # N600) was immediately added and mixed well. Plates were read immediately in a spectrophotometer at O.D. 450 and at O.D. 570. The O.D. 570 reading was a background reading which was subtracted from the O.D. 450 reading. Using a software program such as Molecular Devices SoftMax Pro or Graph Pad Prism, the standard curve values were plotted using a 4 parameter fit curve and the concentrations of the unknown samples were interpolated from the standard curve using the software.
The data for SEQ ID NO: 159 was obtained using a HSA ELISA protocol. Immulon 4HBX ELISA 96 well plates (Thermo Scientific cat. #3855) were coated with 2 ug/ml, 100 ul/well of purified CD47 overnight at room temperature in 1× antigen coating buffer (ImmunoChemistry Technologies, cat. #6248). Wells were washed 5 times with 200-300 μL/well using 1×TBST (Tris-Buffered Saline+0.05% Tween-20) (Thermo Scientific 20×, cat. #28360). Wells were blocked with 200 μL/well Li-Cor Odyssey Blocking Buffer (TBS) (Li-Cor, cat. #927-50000) for 2 hours, and blocking buffers containing albumin were not used. Wells were washed 5 times with 200-300 μL/well 1×TBST. 50 uL/well standard curve, Quality Controls (QCs) and unknown samples diluted in normal CD1 mouse serum diluted 1:4 in TBS was added. The standard curve, QCs and unknown samples were incubated at room temperature for 1 hour.
The standard curve concentrations were as follows: 3.20 μg/ml; 1.60 μg/ml; 0.80 μg/ml; 0.40 μg/ml; 0.20 μg/ml; 0.10 μg/ml; 0.05 μg/ml; 0.025 μg/ml; and 0.00 μg/ml. Quality Controls (QCs) are frozen and aliquoted, and standard curve protein at a “high”, “mid”, and “low” concentrations on the linear part of the standard curve which served as controls to ensure that the assay was working well were as follows: QC High=0.6 μg/ml; QC Mid=0.3 μg/ml; QC Low=0.15 μg/ml, and QC Low=0.01 μg/ml.
Thereafter, wells were washed 5 times with 200-300 μL/well 1×TBST. 50 μL/well of 1 g/ml Thermo Scientific/Pierce rabbit anti-HSA-HRP conjugated (Thermo Scientific cat. # PA1-26887) diluted into 1×TBST was added and incubated for 1 hour at room temperature. Plates were washed 6 times with 200-300 L/well 1×TBST. Thereafter, the following steps and reagents were carried out at room temperature. 50 L/well room temperature 1-Step Ultra TMB-ELISA substrate (Thermo Scientific, cat. #34028) was added and incubated 3-5 minutes at room temperature until color development was sufficient. 50 μl/well of room temperature TMB Stop Solution (0.16 M Sulfuric Acid solution, Thermo Scientific cat. # N600) was added and mixed well. Plates were read immediately in a spectrophotometer at O.D. 450 and at O.D. 570. The O.D. 570 reading was a background reading which was subtracted from the O.D. 450 reading. Using a software program such as Molecular Devices SoftMax Pro or Graph Pad Prism, the standard curve values were plotted using a 4 parameter fit curve and the concentrations of the unknown samples were interpolated from the standard curve using the software.
Example 13—Reduced Hemagglutination Demonstrated by SIRP-α Variant Polypeptides
As shown in FIG. 11 , SIRP-α D1 variant polypeptides demonstrated reduced or ablated hemagglutination. Specifically, when hemagglutination occurs, a diffused red coloration is present instead of a red dot, as is shown for the positive control B6H12. For the SIRP-α D1 variant polypeptides tested in FIG. 11 , there was a reduction or ablation of hemagglutination.
The methodologies used for this Example were as follows: human whole blood buffy coats were received from the Stanford University Blood Center and diluted 1:2 with Phosphate Buffered Saline (PBS, Gibco). Diluted blood was split into two tubes and underlayed with 20 ml Ficoll-Paque Plus (GE Healthcare). Tubes were centrifuged for 30 minutes at 400×g. Supernatants were removed and the erythrocyte pellets were washed twice by addition of 30 mL of PBS and centrifugation at 3500 RPM. Thereafter, a hemagglutination assay was carried out as follows: human erythrocytes were diluted in PBS and transferred to 96 well polystyrene plates (Corning) at 4 million cells per well in a volume of 75 μL. Five-fold serial dilutions of the indicated proteins were added to wells in a volume of 75 μL PBS, with final concentration from 1000 nM to 0.488 nM. As a negative control, PBS alone was added to one row of wells. Erythrocytes settled to the well bottom, forming a small and well-defined pellet. As a positive control, cells were treated with the anti-CD47 antibody B6H12 (ebioscience). This antibody caused hemagglutination at concentrations between 8 and 63 nM, indicated by formation of a large and diffuse cell pellet. Among tested constructs, IgG2-based polypeptides (SEQ ID NO: 109 and SEQ ID NO: 113) caused slight hemagglutination at 4 and 8 nM. No hemagglutination was observed for all other polypeptide constructs (IgG1-based and HSA-based).
Example 14—Anti-Tumor Activity of SEQ ID NO: 211 in a Mouse Syngeneic Tumor Model
C57BL/6 mice (7- to 10-week-old female animals) obtained from Charles River Laboratory were used. Mouse colon adenocarcinoma cell line MC38 was recovered from frozen stocks and grown in RPMI 1640 containing 10% fetal bovine serum, penicillin-streptomycin, and L-glutamine. Cells were spun down and resuspended at a concentration of 2E+07 cells/mL in serum-free medium without additives. On Day −7 (i.e., 7 days before the projected staging day), the mice were implanted by subcutaneous injection into the left flank with 100 μL (2.0×106 cells) per mouse of the freshly prepared MC38 in phosphate buffered saline (PBS). When the tumors reached a mean volume of approximately 50 mm3, fifty animals with established tumors and moderate body weights were randomized into 5 treatment groups (Group 1-5, n=10 mice each). Starting on Day 1, mice of Groups 1 to 5 were treated with vehicle (PBS), anti-mPD-L1 (Clone 10F.9G2, 200 μg), SEQ ID NO: 211 (200 μg), anti-mPD-L1 (200 μg)+SEQ ID NO: 211 (100 μg), or anti-mPD-L1 (200 μg)+SEQ ID NO: 211 (200 μg), respectively. Doses were by administered intraperitoneal (IP) injection of 0.05 mL/mouse on days 1, 4 and 7.
SEQ ID NO: 211 was generated by genetically fusing SED ID NO: 206 to a Fc domain monomer. SEQ ID NO: 206 contains mutations shown to improve binding to mouse CD47. The binding data is presented in Table 18.
6)
SEQ ID NO: 211
EEELQIIQPDKSVLVAAGETATLRCTITSLRPVGPIQWFRGAGPGRELIY
NQRDGPFPRVTTVSDTTKRNNMDFSIRIGAITPADAGTYYCVKFRKGIPD
DVEFKSGAGTELSVRAKPSDKTHTCPPCPAPEAAGAPSVFLFPPKPKDTL
MISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYASTYR
VVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTL
PPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSD
GSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Clinical observations and body weights were monitored throughout the study up to Day 42. Tumor sizes were measured two times per week, and at study completion, the perpendicular minor (width, W, and height, H) and major (length, L) dimensions were measured using microcalipers (Mitutoyo, Aurora, Ill.). Tumor volume (mm3) was calculated using the formula for the volume of an ellipsoid sphere (L×W×H/2). Study animals were subjected to humane sacrifice during the study when tumor volumes in individual animals exceeded (or approached) 2,500 mm3. The number of animals remaining in the study up to Day 42 were used for a survival analysis.
Tumors grew to various degrees in all five groups. Among mice dosed with vehicle or SEQ ID NO: 211 (200 μg) ( Groups 1 and 3, respectively), sacrifices began during the 4th week (from Day 25) and all animals in these groups were dead by the end of the 5th week (Day 35). Among mice dosed with anti-mPD-L1 (alone or in combination with SEQ ID NO: 211; Groups 2, 4, and 5), sacrifices began during the 5th week (from Day 29 or 32) but a subset (40-70%) of these animals survived to the scheduled study end (Day 42). FIG. 12 shows survival curves for each treatment group during the study period. Numerically, the anti-mPD-L1 plus 200 μg SEQ ID NO: 211 treatment group had the highest number of surviving animals, following by the anti-mPD-L1 plus 100 μg SEQ ID NO: 211 treatment group and anti-mPD-L1 alone group, with 7 out 10 (70%), 5 out 10 (50%) and 4 out of 10 (40%) mice remaining at Day 42, respectively (Table 25). Median survival was 29 and 30.5 days respectively for vehicle (Group 1) and SEQ ID NO: 211 alone (Group 3) treatments. Median survival increased to 42 days for anti-mPD-L1 alone (Group 2) and anti-PD-L1 plus 100 μg SEQ ID NO: 211 (Group 4) treatment. Median survival for anti-mPD-L1 plus 200 μg SEQ ID NO: 211 treatment (Group 5) was not determined as more than 50% of animals remained at the end of the study (Day 42).
TABLE 25
Animal Survival Data.
Treatment (3
IP doses - on Number of Animals Alive on Indicated Day
Group Days
1, 4 and 7) 1 4 7 11 14 18 22 25 29 32 35 39 42
1 PBS 10 10 10 10 10 10 10 6 1 0 0 0 0
2 anti-mPD-L1 (200 μg) 10 10 10 10 10 10 10 10 9 9 7 5 4
3 SEQ ID NO: 211 (200 μg) 10 10 10 10 10 10 10 9 5 1 0 0 0
4 anti-mPD-L1 (200 μg) + 10 10 10 10 10 10 10 10 10 9 7 6 5
SEQ ID NO: 211 (100 ug)
5 anti-mPD-L1 (200 ug) + 10 10 10 10 10 10 10 10 9 9 8 7 7
SEQ ID NO: 211 (200 μg)
Tumors exhibited rapid growth in the vehicle treated group, indicating ongoing tumor growth in the absence of effective treatment. Dosing with 200 μg SEQ ID NO: 211 (Group 3) yielded significant attenuation of tumor growth only at intermittent time points (Day 7 and 14, for both raw and normalized tumor volume) compared to dosing with vehicle. Dosing with 200 μg anti-mPD-L1, alone or in combination with SEQ ID NO: 211 (Groups 2, 4, and 5), provided significant attenuation of tumor growth from Day 4 or 7 (for raw or normalized tumor volume, respectively) compared to dosing with vehicle (FIG. 13 and Table 26). The addition of SEQ ID NO: 211 to the anti-mPD-L1 regimen (Group 2 vs. 4 or Group 2 vs. 5) produced additional tumor growth inhibition over anti-mPD-L1 treatment alone. Day-22 tumor volumes, including tumor growth inhibition (% TGI), are provided in Table 26. Day 22 is used for the comparison because this day is the last time point at which all animals were still alive. Tumor growth inhibition (% TGI) on Day 22 vs Day 1 were 83%, 81% and 77% for anti-mPD-L1 plus 200 μg SEQ ID NO: 211 group, anti-mPD-L1 plus 100 μg SEQ ID NO: 211 group and anti-mPD-L1 alone group, respectively (Table 26).
TABLE 26
Tumor Volume Analysis
Day-1 Day-22{circumflex over ( )} Mean
Agent Tumor Tumor Day 22* vs. Day 1 Normalized
(Three doses Volume Volume T-B (mm3) % TGI Day-22{circumflex over ( )}
on Day 1, 4 (B, mm3) (T, mm3) Δ tumor % Group Volume
Group and 7, IP) Mean ± SD Mean ± SD volume 1 Δ % Day 1
1 Vehicle 52 ± 13 2126 ± 599  2074.2  0% 4380%
2 anti-mPD-L1 52 ± 12 537 ± 464 484.6 77% 1062%
(200 μg)
3 SEQ ID NO: 51 ± 12 1697 ± 679  1645.4 21% 3384%
211 (200 μg)
4 anti-mPD-L1 52 ± 13 456 ± 368 404.3 81%  959%
(200 μg) +
SEQ ID NO:
211 (100 μg)
5 anti-mPD-Ll 52 ± 11 399 ± 497 347.9 83%  728%
(200 μg) +
SEQ ID NO:
211 (200 μg)0
*Day 22 is the last day on which all animals of all groups remained alive.
Example 15—Optimizing Combination Therapy for Treating Cancer
Polypeptides including a high affinity SIRP-α D1 variant are co-administered with checkpoint inhibitors to treat mouse models of various cancers, e.g., solid tumor and hematological cancer. Cancers may be recognized by the immune system, and under some circumstances, the immune system may be involved in eliminating tumors. Blockade of co-inhibitory molecules, such as CTLA-4, PD-1, and LAG-3, may be involved in amplifying T-cell responses against tumors. Polypeptides described herein are administered in combination with a checkpoint inhibitor, such as an antibody inhibitor of CTLA-4 (e.g., ipilimumab, tremelimumab), PD-1 (nivolumab, pidilizumab, MK3475 also known as pembrolizumab, BMS936559, and MPDL3280A), and LAG-3 (e.g., BMS986016).
Established A20 tumors in BALB/c mice (e.g., lymphoma models) are treated with an antibody inhibitor of CTLA-4 and a high affinity SIRP-α D1 variant fused to an IgG Fc variant provided herein (e.g., a SIRP-α construct). Starting on Day 1, mice are treated with vehicle (PBS), tremelimumab (200 μg)+SIRP-α construct (100 pg), or tremelimumab (200 μg)+SIRP-α construct (200 μg). Doses are administered by intraperitoneal (IP) injection at 0.05 mL/mouse on days 1, 4 and 7. Tumor response to combination therapy is determined daily by measuring tumor volume. If on day 4, tumor volume of mice treated with combination therapy shows no significant improvement, tremelimumab is replaced with ipilimumab. Similarly, if on day 7, tumor volume of mice treated with combination therapy show no significant improvement, tremelimumab is replaced with ipilimumab. It is expected that while tremelimumab and ipilimumab target the same checkpoint protein, they have different therapeutic efficacies and synergistic effects with the SIRP-α construct due to their differing Fc regions. Tremelimumab is an IgG2 antibody that may be more effective at fixing complement while ipilimumab is an IgG1 antibody that may be useful in preventing the elimination of activated T-cells.
Example 16—Method of Treating a Cancer Expressing an Epithelial Marker
SIRP-α polypeptide constructs, such as a high affinity SIRP-α D1 variant (e.g., any variant provided in Tables 2, 5, and 6) fused to an IgG Fc variant, are administered to treat a cancer expressing an epithelial cell marker. Increased phagocytosis resulting from the blockade of CD47 signaling, for example by a SIRP-α D1 construct, may depend on the presence of macrophages. Therefore, administration of a SIRP-α D1 polypeptide construct in combination with an antibody targeting an epithelial marker that is expressed in or on a cancer cell is used to treat the cancer reducing the risk of side effects, e.g., phagocytosis of epithelial cells, due to a low abundance of macrophages at the skin periphery.
Mouse models of a cancer expressing an epithelial marker, for example EGFR or EpCAM, are administered a SIRP-α construct in combination with an antibody that targets the epithelial marker, e.g., an anti-EGFR antibody or an anti-EpCAM antibody. Antibodies targeting epithelial markers can recognize both cancerous cells and non-cancerous cells, for example non-cancerous cells at the skin periphery. However, it is expected that non-cancerous cells at the skin periphery will not be susceptible to phagocytosis due to a low abundance of macrophages near the skin.
Example 17—Phagocytosis by Single Arm SIRP-α-Fc Fusions
To obtain quantitative measurements of phagocytosis induced by SIRP-α-Fc fusions having a single SIRP-α molecule (e.g., a single arm molecule) (depicted in FIGS. 1, 4A, and 4B), a phagocytosis assay with different cell types MM1R and N87 cells was performed using methods as described in Example 8.
Six single arm constructs were tested for in vitro phagocytosis. These single-arm constructs are generated using knob & hole strategies. Homodimer SIRP-α Fc fusion of SEQ ID NO: 136 was used as a double arm comparison (control). A first single-arm SIRP-α Fc fusion (e.g., A) was formed from a heterodimer of SEQ ID NO: 139 (an Fc variant) and SEQ ID NO: 138 (a SIRP-α Fc fusion). A second single-arm SIRP-α Fc fusion (e.g., B) was formed from a heterodimer of SEQ ID NO: 141 (an Fc variant) and SEQ ID NO: 140 (a SIRP-α Fc fusion). A third single-arm SIRP-α Fc fusion (e.g., C) was formed from a heterodimer of SEQ ID NO: 139 (an Fc variant) and SEQ ID NO: 142 (a SIRP-α Fc fusion). A fourth single-arm SIRP-α Fc fusion (e.g., D) was formed from a heterodimer of SEQ ID NO: 141 (an Fc variant) and SEQ ID NO: 143 (a SIRP-α Fc fusion). A fifth single-arm SIRP-α Fc fusion (e.g., E) was formed from a heterodimer of SEQ ID NO: 147 (an Fc variant) and SEQ ID NO: 146 (a SIRP-α Fc fusion). A sixth single-arm SIRP-α Fc fusion (e.g., F) was formed from a heterodimer of SEQ ID NO: 149 (an Fc variant) and SEQ ID NO: 148 (a SIRP-α Fc fusion). The CD47 binding affinities (KD) of the SIRP-α single-arm when tested as a monomer are as follows: ˜10 pM (A,B), ˜100 pM (C, D) and ˜5 nM (E, F). The sequences are provided in Table 27 below.
TABLE 27
Amino Acid Sequences of SIRPα - Fc Fusions
for the Construction of Heterodimers
SEQ
ID
NO: Amino Acid Sequence
138 EEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQWFRGAGPG
RVLIYNQRQGPFPRVTTVSDTTKRNNMDFSIRIGAITPADAGTYY
CIKFRKGSPDDVEFKSGAGTELSVRAKPSDKTHTCPPCPAPEAAG
APSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDG
VEVHNAKTKPREEQYASTYRVVSVLTVLHQDWLNGKEYKCKVSNK
ALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLWCLVKG
FYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
139 DKTHTCPPCPAPEAAGAPSVFLFPPKPKDTLMISRTPEVTCVVVD
VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYASTYRVVSVLTVLH
QDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR
EEMTKNQVSLSCAVKGFYPSDIAVEWESNGQPENNYKTTPPVLDS
DGSFFLVSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSP
GK
140 EEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQWFRGAGPG
RVLIYNQRQGPFPRVTTVSDTTKRNNMDFSIRIGAITPADAGTYY
CIKFRKGSPDDVEFKSGAGTELSVRAKPSDKTHTCPPCPAPEAAG
APSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDG
VEVHNAKTKPREEQYASTYRVVSVLTVLHQDWLNGKEYKCKVSNK
ALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLSCAVKG
FYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLVSKLTVDKSR
WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
141 DKTHTCPPCPAPEAAGAPSVFLFPPKPKDTLMISRTPEVTCVVVD
VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYASTYRVVSVLTVLH
QDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR
EEMTKNQVSLWCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDS
DGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSP
GK
142 EEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQWFRGAGPG
RELIYNQREGPFPRVTTVSDTTKRNNMDFSIRIGAITPADAGTYY
CVKFRKGSPDDVEFKSGAGTELSVRAKPSDKTHTCPPCPAPEAAG
APSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDG
VEVHNAKTKPREEQYASTYRVVSVLTVLHQDWLNGKEYKCKVSNK
ALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLWCLVKG
FYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
143 EEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQWFRGAGPG
RELIYNQREGPFPRVTTVSDTTKRNNMDFSIRIGAITPADAGTYY
CVKFRKGSPDDVEFKSGAGTELSVRAKPSDKTHTCPPCPAPEAAG
APSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDG
VEVHNAKTKPREEQYASTYRVVSVLTVLHQDWLNGKEYKCKVSNK
ALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLSCAVKG
FYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLVSKLTVDKSR
WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
146 EEELQVIQPDKSVLVAAGETATLRCTATSLFPVGPIQWFRGAGPG
RELIYNQRQGPFPRVTTVSDLTKRNNMDFSIRIGNITPADAGTYY
CVKFRKGSPDDVEFKSGAGTELSVRAKPSDKTHTCPPCPAPEAAG
APSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDG
VEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNK
ALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLWCLVKG
FYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
147 DKTHTCPPCPAPEAAGAPSVFLFPPKPKDTLMISRTPEVTCVVVD
VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLH
QDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR
EEMTKNQVSLSCAVKGFYPSDIAVEWESNGQPENNYKTTPPVLDS
DGSFFLVSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSP
GK
148 EEELQVIQPDKSVLVAAGETATLRCTATSLFPVGPIQWFRGAGPG
RELIYNQRQGPFPRVTTVSDLTKRNNMDFSIRIGNITPADAGTYY
CVKFRKGSPDDVEFKSGAGTELSVRAKPSDKTHTCPPCPAPEAAG
APSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDG
VEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNK
ALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLSCAVKG
FYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLVSKLTVDKSR
WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
149 DKTHTCPPCPAPEAAGAPSVFLFPPKPKDTLMISRTPEVTCVVVD
VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLH
QDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR
EEMTKNQVSLWCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDS
DGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSP
GK
FIGS. 15-17 shows phagocytosis of multiple myeloma line 1R (MM1R) and gastric carcinoma line N87 by non-polarized, human monocyte-derived macrophages. “+” and “−” denotes the addition or absence of Daratumumab (Dara) respectively in FIGS. 15-16 . In FIG. 17 , “+” and “−” denotes addition and absence of Herceptin/trastuzumab (Her) respectively.
FIG. 15 shows construct A in the presence of a control antibody (IgG1,k), e.g., “A−” has ablated phagocytosis as a single agent while it is able to increase Daratumumab (Dara) phagocytosis, e.g., “A+”. Similarly, construct B in the presence of a control antibody (IgG1,k), e.g., “B−” has ablated phagocytosis as a single agent while it is able to increase Daratumumab (Dara) phagocytosis, e.g., “B+”. The percent of macrophages that phagocytosed MM1R and are CFSE+ is indicated on the y-axis. Concentration of CD47 binding sites from addition of construct A, B, or control construct is indicated on the x-axis. The levels of phagocytosis are comparable to the control construct (which is a double-arm SIRP-α). The level of phagocytosis resulting from incubation with an anti-CD47 antibody, e.g. B6H12 (100 nM), is comparable to incubation with Dara, e.g. PBS+. As shown, single arm SIRP-α-Fc fusions can increase Dara phagocytosis comparable to a double arm SIRP-α-Fc fusions.
FIG. 16 shows construct C in the presence of a control antibody (IgG1,k), e.g., “C−” has ablated phagocytosis in the phagocytosis assay as a single agent while it is able to increase Daratumumab (Dara) phagocytosis, e.g., “C+”. Similarly, construct D in the presence of a control antibody (IgG1,k), e.g., “D−” has ablated phagocytosis in the phagocytosis assay as a single agent while it is able to increase Daratumumab (Dara) phagocytosis, e.g., “D+”. The percent of macrophages that phagocytosed MM1R and are CFSE+ is indicated on the y-axis. Concentration of CD47 binding sites from addition of construct C, D, or control construct is indicated on the x-axis. The levels of phagocytosis are comparable to the control construct (which is a double-arm SIRP-α). The level of phagocytosis resulting from incubation with an anti-CD47 antibody, e.g. B6H12 (100 nM), is comparable to incubation with Dara, e.g. PBS+. As shown, single arm SIRP-α-Fc fusions can increase Dara phagocytosis comparable to a double arm SIRP-α-Fc fusions. As shown, single arm SIRP-α-Fc fusions can increase Dara phagocytosis comparable to a double arm SIRP-α-Fc fusions.
FIG. 17 shows phagocytosis in the presence of low affinity single-arm SIRP-α constructs (E, F) performed similarly as above examples. As shown, these low affinity single-arm SIRP-α constructs (E, F) in combination with Herceptin showed comparable phagocytosis of N87 cells to Herceptin alone (PBS+). Therefore, 5 nM affinity for CD47 is not sufficient for single-arm SIRP-α-Fc fusion to enhance further in vitro phagocytosis in combination with Herceptin.
Example 17—Cross Reactivity of High Affinity SIRP-α D1 Variants
Polypeptides of high affinity SIRP-α D1 variants were generated as previously described. Binding to human, mouse, and rat CD47 was determined using SPR as measured by a Biacore T100 instrument (GE Healthcare) and Proteon XPR36 (Bio-rad, Hercules, Calif.) as described in Example 1. SEQ ID NO: 215 is an engineered SIRP-α D1 variant that does not bind to human, mouse, or rat CD47 and was utilized as a negative control.
TABLE 28
Representative Cross-Species CD47 Binding Affinity for
High Affinity SIRP-α Variants
KD (M)
SEQ ID NO: Human Mouse Rat
85  2.03 × 10−10 2.16 × 10−9 1.96 × 10−8
198  1.55 × 10−10 1.41 × 10−9 9.88 × 10−9
199 1.26 × 10−9 1.25 × 10−9 1.07 × 10−8
200  3.04 × 10−10 1.17 × 10−9 1.42 × 10−8
204  6.53 × 10−10  4.48 × 10−10 3.42 × 10−9
205  2.48 × 10−10  5.69 × 10−10 4.28 × 10−9
206  9.67 × 10−10  2.88 × 10−10 1.49 × 10−9
207 1.04 × 10−9  8.80 × 10−10 5.90 × 10−9
208  2.19 × 10−10  8.32 × 10−10 5.17 × 10−9
209 1.01 × 10−9  3.71 × 10−10 2.26 × 10−9
210 1.65 × 10−9  6.12 × 10−10 4.59 × 10−9
136 1.3904 × 10−10   1.1407 × 10−8   6.43 × 10−9
214 2.00 × 10−9 6.30 × 10−8 8.00 × 10−8
215 Non-Binding Non-Binding Non-Binding
SEQ ID NO: 215:
EEELQVIQPDKSVLVAAGETATLRCTATSLIPRGPIQWFRGAGPGRELIY
NRKEGHFPRVTTVSDLTKRNNMDFSIRIGNITPADAGTYYCVKFRKGSPD
DVEFKSGAGTELSVRAKPSDKTHTCPPCPAPEAAGAPSVFLFPPKPKDTL
MISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYASTYR
VVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTL
PPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSD
GSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Example 18—Anti-Tumor Activity of High Affinity SIRP-α Constructs in a Mouse Xenograft Tumor Model
Immunodeficient NOD scid gamma (NSG) mice (NOD.Cg-PrkdcscidIl2rgtm1Wjl/SzJ; 50 females, plus spares) were purchased as 6- to 10-week-old animals. Human lymphoma cell line GFP-Luc-Raji cells were grown in RPMI 1640 containing 10% fetal bovine serum, penicillin, streptomycin, and L-glutamine. Cells then were spun down and re-suspended at a concentration of 1.0×107 cells/mL in serum-free medium without additives and combined 1:1 with Matrigel™ (Trevigen, Gaithersburg, Md.). On Day −11 (i.e., 11 days before the projected staging day), the mice were implanted by subcutaneous injection into the left flank with 200 μL (1.0×106 cells) per mouse of the freshly prepared GFP-Luc-Raji:Matrigel mixture. When the tumors reached a mean volume of approximately 55 mm3, fifty animals with established tumors and moderate body weights were randomized into 5 treatment groups (Group 1-5, n=10 mice each). Starting on Day 1, Groups 1 to 5 were treated with (1) SEQ ID NO: 215 [10 mg/kg (mpk), 3×/week]; (2) SEQ ID NO: 104 (10 mpk, 3×/week); (3) rituximab (5 mpk, 2×/week)+SEQ ID NO: 100 (10 mpk, 3×/week); (4) rituximab (5 mpk, 2×/week)+SEQ ID NO: 104 (10 mpk, 3×/week); or (5) rituximab (5 mpk, 2×/week)+SEQ ID NO: 215 (10 mpk, 3×/week), respectively. Doses were administered by intraperitoneal (IP) injection at 0.05 mL/mouse. For all animals, doses were administered starting on the staging day and continuing for a total of 31 days (Days 1-31).
Clinical observations were recorded twice per day (morning and evening). Additional findings were recorded as observed. Body weights were measured three times per week using an electronic balance (Ohaus SCOUT® PRO). Tumor sizes were measured three times per week, and at study completion, using microcalipers (Mitutoyo, Aurora, Ill.) to measure the perpendicular minor (width, W, and height, H) and major (length, L) dimensions. Tumor volume (mm3) was calculated using the formula for the volume of an ellipsoid sphere (L×W×H/2). Blood samples were drawn from 20 animals on Day 1 (baseline; prior to group assignment) and from all animals on Day 8 (Week 1) and Day 31 (at termination). Blood specimens were submitted for complete blood counts (CBCs) on the respective day of draw.
The SIRP-α construct of SEQ ID NO: 215 does not exhibit measurable binding to CD47 (see Table 28). Tumors in the SEQ ID NO: 215-dosed group (Group 1) grew linearly through Day 31 (FIG. 19A), similar to tumors observed in the PBS vehicle group of the same model (data not shown). This observation demonstrates ongoing tumor growth in the absence of effective treatment.
Comparisons between Groups 1 and 5 (SEQ ID NO: 215 with or without rituximab) and between Groups 2 and 4 (SEQ ID NO: 104 with or without rituximab) reveal that the combination treatments yielded significant attenuation of tumor volume, both as raw values (from Day 9) and normalized values (from Day 7). By Day 16, the majority of mice in Group 3 (SEQ ID NO: 100+rituximab) and Group 4 (SEQ ID NO: 104+rituximab) no longer harbored detectable tumors; these two combination treatments showed similar efficacy. In contrast, tumor growth appeared to recover in animals of Group 5 (SEQ ID NO: 215+rituximab) from Day 18 on. Tumor volumes of all five groups over the study period (mean+/−SEM and individual scatter plots) are presented in FIG. 19A and FIG. 19B respectively.
Complete blood count (CBC) values (red blood cells, hemoglobin, hematocrit, platelets, etc.) measured pre-dose (Day 1), 1 week after dosing (Day 9), and 4 weeks after dosing (Day 31). Parameters did not differ significantly at Week 1 or Week 4 among the five groups. Hemoglobin (HGB) values are shown in FIG. 19C. These results demonstrate that high affinity SIRP-α constructs can effectively attenuate tumor growth and synergize with rituximab in an in vivo mouse model of cancer. Furthermore, in contrast to anti-CD47 based antibody treatments, no acute episodes of anemia were observed in any of the test groups treated with the high affinity SIRP-α constructs.
Example 19: SIRP-α Fc Variant Constructs Exhibit Decreased Red Blood Cell Toxicity
Red blood cell loss is a concern when targeting CD47. To examine the effects of a SIRP-α Fc variant construct on red blood cell toxicity, mice were treated with a high affinity SIRP-α variant construct containing either a wildtype IgG1 Fc construct (SEQ ID NO: 216) or a IgG1 Fc variant construct (SEQ ID NO:96) with IgG1 mutations L234A, L235A, G237A, and N297A (IgG1_AAA_N297A). Mice were assigned to five groups of six and were treated on day 1 and 7 (see solid arrows in FIG. 20 ) with either: (1) PBS; (2) 10 mg/kg SEQ ID NO: 216 (wildtype IgG1 Fc); (3) 30 mg/kg SEQ ID NO: 216; (4) 10 mg/kg SEQ ID NO: 96 (IgG1_AAA_N297A); or (5) 30 mg/kg SEQ ID NO: 96. Baseline complete blood count (CBC) measurements were taken from all animals on day −7 and for three of six animals on day 1. The blood draws (see FIG. 20 ) rotated between three mice from each group to not exceed the amount of blood withdrawal allowed per week. As demonstrated in FIG. 20 , treatment with a wildtype IgG1 containing SIRP-α D1 variant construct resulted in a dose-dependent decrease in red blood cell counts. Conversely, treatment with an IgG1_AAA_N297A containing SIRP-α D1 variant construct resulted in red blood cell counts similar to the PBS treated control group.
While preferred embodiments of the present invention have been shown and described herein, it will be obvious to those skilled in the art that such embodiments are provided by way of example only. Numerous variations, changes, and substitutions will now occur to those skilled in the art without departing from the invention. It should be understood that various alternatives to the embodiments of the invention described herein can be employed in practicing the invention. It is intended that the following claims define the scope of the invention and that methods and structures within the scope of these claims and their equivalents be covered thereby.

Claims (28)

What is claimed is:
1. A polypeptide, comprising:
(a) a signal-regulatory protein α (SIRP-α) polypeptide or a fragment thereof that is capable of binding CD47; and
(b) an Fc variant, wherein the Fc variant is a human IgG1 Fc region comprising mutations L234A, L235A, G237A, and N297A, wherein numbering is according to the EU index,
wherein the polypeptide does not cause acute anemia in rodents, non-human primates, or humans after administration.
2. The polypeptide of claim 1, wherein the Fc variant binds to an Fcγ receptor with a KD greater than about 5×10−6 M.
3. The polypeptide of claim 1, wherein the SIRP-α polypeptide or fragment thereof that is capable of binding CD47 comprises a SIRP-α D1 variant comprising the amino acid sequence, EEELQX1IQPDKSVLVAAGETATLRCTX2TSLX3PVGPIQWFRGAGPGRX4LIYNQX5EGX6FPR VTTVSDX7TKRNNMDFSIRIGX8ITPADAGTYYCX9KFRKGSPDDVEFKSGAGTELSVRAKPS (SEQ ID NO: 51), wherein X1 is V or I; X2 is A or I; X3 is I or F; X4 is E or V; X5 is K or R; X6 is H or P; X7 is L or T; X8 is any amino acid other than N; and X9 is V or I.
4. The polypeptide of claim 3, wherein the SIRP-α polypeptide or fragment thereof that is capable of binding CD47 comprises a SIRP-α D1 variant wherein X1 is V or I; X2 is A or I; X3 is I or F; X4 is E; X5 is K or R; X6 is H or P; X7 is L or T; X8 is not N; and X9 is V.
5. A method of treating an individual having a disease or disorder, the method comprising administering to the individual a polypeptide comprising:
(a) a signal-regulatory protein α (SIRP-α) polypeptide or a fragment thereof that is capable of binding CD47; and
(b) an Fc variant, wherein the Fc variant a human IgG1 Fc region comprising mutations L234A, L235A, G237A, and N297A,
wherein numbering is according to the EU index;
wherein the polypeptide does not cause acute anemia in the individual after administration.
6. The method of claim 5, wherein the disease or disorder is a cancer, an autoimmune disease, or an inflammatory disease.
7. The method of claim 5, wherein the disease or disorder is a cancer, and the cancer is selected from solid tumor cancer, hematological cancer, acute myeloid leukemia, chronic lymphocytic leukemia, chronic myeloid leukemia, acute lymphoblastic leukemia, non-Hodgkin lymphoma, Hodgkin lymphoma, multiple myeloma, bladder cancer, pancreatic cancer, cervical cancer, endometrial cancer, lung cancer, bronchus cancer, liver cancer, ovarian cancer, colon and rectal cancer, stomach cancer, gastric cancer, gallbladder cancer, gastrointestinal stromal tumor cancer, thyroid cancer, head and neck cancer, oropharyngeal cancer, esophageal cancer, melanoma, non-melanoma skin cancer, Merkel cell carcinoma, virally induced cancer, neuroblastoma, breast cancer, prostate cancer, renal cancer, renal cell cancer, renal pelvis cancer, leukemia, lymphoma, sarcoma, glioma, brain tumor, and carcinoma.
8. The method of claim 5, wherein the disease or disorder is an autoimmune disease or an inflammatory disease, and the autoimmune disease or the inflammatory disease is selected from multiple sclerosis, rheumatoid arthritis, a spondyloarthropathy, systemic lupus erythematosus, an antibody-mediated inflammatory or autoimmune disease, graft versus host disease, sepsis, diabetes, psoriasis, atherosclerosis, Sjogren's syndrome, progressive systemic sclerosis, scleroderma, acute coronary syndrome, ischemic reperfusion, Crohn's Disease, endometriosis, glomerulonephritis, myasthenia gravis, idiopathic pulmonary fibrosis, asthma, acute respiratory distress syndrome (ARDS), vasculitis, and inflammatory autoimmune myositis.
9. The method of claim 5, wherein the signal-regulatory protein α (SIRP-α) polypeptide or fragment thereof that is capable of binding CD47 comprises a sequence set forth in any one of SEQ ID NOs: 78-85.
10. The method of claim 9, further comprising administration of at least one additional agent.
11. The method of claim 10, wherein the at least one additional agent is an antibody, tumor associated antigen, or a non-antibody therapeutic.
12. The method of claim 11, wherein at least two additional agents are administered.
13. The method of claim 12, wherein the at least two additional agents comprise two antibodies.
14. The method of claim 12, wherein the at least two additional agents comprise an antibody and a tumor associated antigen.
15. The method of claim 11, wherein the antibody is a human IgG1 isotype antibody, a human IgG2 isotype antibody, or a human IgG4 isotype antibody.
16. The method of claim 11, wherein the antibody is selected from an anti-HER2 antibody, anti-CD20 antibody, anti-CD19 antibody, anti-CS1 antibody, anti-CD38 antibody, anti-EGFR antibody, anti-OX40 antibody, anti-PD-1 antibody, anti-PD-L1 antibody, anti-RANKL antibody, anti-CD274 antibody, anti-CTLA-4 antibody, anti-CD137 antibody, anti-4-1BB antibody, anti-B7-H3 antibody, anti-FZD7 antibody, anti-CD27 antibody, anti-CCR4 antibody, anti-CSF1R antibody, anti-CSF antibody, anti-CD30 antibody, anti-BAFF antibody, anti-VEGF antibody, or anti-VEGFR2 antibody.
17. The method of claim 10, wherein the at least one additional agent is a tumor associated antigen and the tumor associated antigen elicits an immune response.
18. The method of claim 10, wherein the at least one additional agent is an antibody and the antibody targets a HLA/peptide or MHC/peptide complex.
19. The method of claim 18, wherein the antibody targets a HLA/peptide or MHC/peptide complex comprising NY-ESO-1/LAGE1, SSX-2, MAGE family (MAGE-A3), gp100/pmel17, Melan-A/MART-1, gp75/TRP1, tyrosinase, TRP2, CEA, PSA, TAG-72, Immature laminin receptor, MOK/RAGE-1, WT-1, Her2/neu, EphA3, SAP-1, BING-4, Ep-CAM, MUC1, PRAME, survivin, Mesothelin, BRCA1/2, CDK4, CML66, MART-2, p53, Ras, β-catenin, HPV E6, or HPV E7.
20. A nucleic acid encoding a polypeptide comprising
(a) a signal-regulatory protein α (SIRP-α) polypeptide or a fragment thereof that is capable of binding CD47; and
(b) an Fc variant wherein the Fc variant is a human IgG1 Fc region comprising mutations L234A, L235A, G237A, and N297A,
wherein numbering is according to the EU index.
21. A vector comprising the nucleic acid of claim 20.
22. A host cell comprising the nucleic acid of claim 20.
23. A method of producing a polypeptide comprising culturing the host cell of claim 22 under appropriate conditions to cause expression of the polypeptide and recovering the polypeptide.
24. A pharmaceutical composition comprising:
(I) a polypeptide that comprises
(a) a signal-regulatory protein α (SIRP-α) polypeptide or a fragment thereof that is capable of binding CD47; and
(b) an Fc variant, wherein the Fc variant is a human IgG1 Fc region comprising mutations L234A, L235A, G237A, and N297A,
wherein numbering is according to the EU index; and
(II) a pharmaceutically acceptable carrier.
25. A dimer comprising a polypeptide that comprises:
(a) a signal-regulatory protein α (SIRP-α) polypeptide or a fragment thereof that is capable of binding CD47; and
(b) an Fc variant, wherein the Fc variant is a human IgG1 Fc region comprising mutations L234A, L235A, G237A, and N297A,
wherein numbering is according to the EU index.
26. The dimer of claim 25, wherein the dimer is a heterodimer.
27. The dimer of claim 25, wherein the dimer is a homodimer.
28. The polypeptide of claim 1, wherein the SIRP-α polypeptide or a fragment thereof binds to CD47 with a KD of about 10 nM or less.
US16/736,651 2015-08-07 2020-01-07 Constructs having a SIRP-α domain or variant thereof Active US11639376B2 (en)

Priority Applications (2)

Application Number Priority Date Filing Date Title
US16/736,651 US11639376B2 (en) 2015-08-07 2020-01-07 Constructs having a SIRP-α domain or variant thereof
US18/540,092 US20240343778A1 (en) 2015-08-07 2023-12-14 Constructs having a sirp-alpha domain or variant thereof

Applications Claiming Priority (10)

Application Number Priority Date Filing Date Title
US201562202775P 2015-08-07 2015-08-07
US201562202772P 2015-08-07 2015-08-07
US201562202779P 2015-08-07 2015-08-07
US201562265887P 2015-12-10 2015-12-10
US201662276796P 2016-01-08 2016-01-08
US201662276801P 2016-01-08 2016-01-08
US201662346414P 2016-06-06 2016-06-06
US15/230,186 US10259859B2 (en) 2015-08-07 2016-08-05 Constructs having a SIRP-α domain or variant thereof
US16/153,404 US10696730B2 (en) 2015-08-07 2018-10-05 Constructs having a SIRP-alpha domain or variant thereof
US16/736,651 US11639376B2 (en) 2015-08-07 2020-01-07 Constructs having a SIRP-α domain or variant thereof

Related Parent Applications (1)

Application Number Title Priority Date Filing Date
US16/153,404 Continuation US10696730B2 (en) 2015-08-07 2018-10-05 Constructs having a SIRP-alpha domain or variant thereof

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US202318185255A Continuation 2015-08-07 2023-03-16

Publications (2)

Publication Number Publication Date
US20200239543A1 US20200239543A1 (en) 2020-07-30
US11639376B2 true US11639376B2 (en) 2023-05-02

Family

ID=57983500

Family Applications (5)

Application Number Title Priority Date Filing Date
US15/230,186 Active US10259859B2 (en) 2015-08-07 2016-08-05 Constructs having a SIRP-α domain or variant thereof
US16/153,404 Active US10696730B2 (en) 2015-08-07 2018-10-05 Constructs having a SIRP-alpha domain or variant thereof
US16/736,651 Active US11639376B2 (en) 2015-08-07 2020-01-07 Constructs having a SIRP-α domain or variant thereof
US16/825,850 Active US11208459B2 (en) 2015-08-07 2020-03-20 Constructs having a SIRP-alpha domain or variant thereof
US18/540,092 Pending US20240343778A1 (en) 2015-08-07 2023-12-14 Constructs having a sirp-alpha domain or variant thereof

Family Applications Before (2)

Application Number Title Priority Date Filing Date
US15/230,186 Active US10259859B2 (en) 2015-08-07 2016-08-05 Constructs having a SIRP-α domain or variant thereof
US16/153,404 Active US10696730B2 (en) 2015-08-07 2018-10-05 Constructs having a SIRP-alpha domain or variant thereof

Family Applications After (2)

Application Number Title Priority Date Filing Date
US16/825,850 Active US11208459B2 (en) 2015-08-07 2020-03-20 Constructs having a SIRP-alpha domain or variant thereof
US18/540,092 Pending US20240343778A1 (en) 2015-08-07 2023-12-14 Constructs having a sirp-alpha domain or variant thereof

Country Status (33)

Country Link
US (5) US10259859B2 (en)
EP (2) EP3913051A1 (en)
JP (4) JP6898303B2 (en)
KR (2) KR20250133806A (en)
CN (3) CN108350048B (en)
AU (2) AU2016304794B2 (en)
CA (1) CA2993835A1 (en)
CL (3) CL2018000340A1 (en)
CO (1) CO2018002471A2 (en)
CY (1) CY1124372T1 (en)
DK (1) DK3331902T3 (en)
ES (1) ES2881771T3 (en)
GE (4) GEAP202215294A (en)
HR (1) HRP20211167T1 (en)
HU (1) HUE055139T2 (en)
IL (3) IL294679B2 (en)
LT (1) LT3331902T (en)
MX (2) MX395275B (en)
MY (1) MY185014A (en)
NZ (1) NZ738950A (en)
PE (1) PE20180778A1 (en)
PH (1) PH12018500269B1 (en)
PL (1) PL3331902T3 (en)
PT (1) PT3331902T (en)
RS (1) RS62151B1 (en)
RU (2) RU2740672C2 (en)
SA (1) SA518390881B1 (en)
SG (2) SG10202101909RA (en)
SI (1) SI3331902T1 (en)
SM (1) SMT202100424T1 (en)
UA (2) UA125638C2 (en)
WO (1) WO2017027422A1 (en)
ZA (3) ZA201800857B (en)

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12098214B2 (en) 2021-05-13 2024-09-24 ALX Oncology Inc. Combination therapies for treating cancer
US12343377B2 (en) 2020-06-01 2025-07-01 ALX Oncology Inc. Combination therapies comprising a hypomethylation agent for treating cancer
US12527838B2 (en) 2019-11-27 2026-01-20 ALX Oncology Inc. Combination therapies comprising an agent that blocks the interaction between CD47 and SIRPα for treating gastric or gastroesphageal junction cancel

Families Citing this family (132)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10053513B2 (en) * 2009-11-30 2018-08-21 Janssen Biotech, Inc. Antibody Fc mutants with ablated effector functions
US12466897B2 (en) 2011-10-10 2025-11-11 Xencor, Inc. Heterodimeric human IgG1 polypeptides with isoelectric point modifications
US10858417B2 (en) 2013-03-15 2020-12-08 Xencor, Inc. Heterodimeric proteins
SG11201704283PA (en) 2014-11-26 2017-06-29 Xencor Inc Heterodimeric antibodies that bind cd3 and tumor antigens
US20170151281A1 (en) 2015-02-19 2017-06-01 Batu Biologics, Inc. Chimeric antigen receptor dendritic cell (car-dc) for treatment of cancer
WO2017027422A1 (en) 2015-08-07 2017-02-16 Alexo Therapeutics Inc. Constructs having a sirp-alpha domain or variant thereof
ES2894335T5 (en) 2015-08-26 2024-06-27 Univ Leland Stanford Junior Enhanced Target Cell Depletion with CD47 Blockade and an Immune Costimulatory Agonist
BR112018006578A2 (en) 2015-10-01 2018-12-26 Heat Biologics, Inc. compositions and methods for joining type i and type ii extracellular domains as heterologous chimeric proteins
ES2796378T3 (en) 2016-01-11 2020-11-26 Forty Seven Inc Humanized, mouse, or chemical anti-cd47 monoclonal antibodies
US11560433B2 (en) 2016-05-27 2023-01-24 Albert Einstein College Of Medicine Methods of treatment by targeting VCAM1 and MAEA
KR102050463B1 (en) 2016-08-10 2019-11-29 아주대학교산학협력단 Heterodimeric Fc-fused cytokine and pharmaceutical composition comprising the same
PL3565828T3 (en) 2017-01-05 2022-04-04 Kahr Medical Ltd. SIRP1 ALFA-41BBL fusion protein and methods of its use
RU2769513C2 (en) 2017-01-05 2022-04-01 Кахр Медикал Лтд. Pd1-4-1bbl fusion protein and methods of its use
WO2018127918A1 (en) 2017-01-05 2018-07-12 Kahr Medical Ltd. A sirp alpha-cd70 fusion protein and methods of use thereof
US11566060B2 (en) 2017-01-05 2023-01-31 Kahr Medical Ltd. PD1-CD70 fusion protein and methods of use thereof
MX2019009255A (en) 2017-02-06 2019-11-05 Orionis Biosciences Nv Targeted chimeric proteins and uses thereof.
CN118994414A (en) 2017-02-27 2024-11-22 沙塔克实验室有限公司 Chimeric proteins based on TIGIT and LIGHT
BR112019017713A2 (en) 2017-02-27 2020-04-07 Shattuck Labs Inc chimeric csf1r-based proteins
US20200157179A1 (en) * 2017-03-28 2020-05-21 Trillium Therapeutics Inc. Cd47 blockade therapy
US11518810B2 (en) 2017-05-08 2022-12-06 Shanghai Jmt-Bio Technology Co., Ltd. Bispecific recombinant protein and use thereof
EP3634466A4 (en) * 2017-06-06 2021-03-24 Relinia, Inc. SINGLE CHAIN TNF RECEPTOR 2-AGONIST FUSION PROTEINS
US11529425B2 (en) 2017-09-07 2022-12-20 Dingfu Biotarget Co., Ltd. Immunoconjugates comprising signal regulatory protein alpha
AU2017439776B2 (en) * 2017-11-20 2025-03-27 Taizhou Mabtech Pharmaceutical Co., Ltd Bifunctional fusion protein targeting CD47 and PD-l1
EA202091364A1 (en) 2017-12-04 2020-10-13 Бейджин Ханми Фармасьютикал Ко., Лтд. ANTI-PD-L1 / ANTI-CD47 BISPECIFIC ANTIBODY WITH A NATURAL ANTIBODY-LIKE STRUCTURE AND IN THE FORM OF A HETERODIMER AND A METHOD FOR ITS PRODUCTION
CN109971716B (en) * 2017-12-28 2023-08-01 上海细胞治疗研究院 EGFR-specific CAR-T cells with autocrine CD47 antibody and uses thereof
ES2927305T3 (en) 2018-02-12 2022-11-04 Forty Seven Inc Cancer regimen using anti-CD47 and anti-CD20 antibodies
AU2019235627B2 (en) * 2018-03-13 2026-01-15 Pfizer Inc. Improvements in CD47 blockade therapy by EGFR antibody
CA3093603A1 (en) * 2018-03-13 2019-09-19 Trillium Therapeutics Inc. Cd47 blockade therapy and cd38 antibody
CN110386984B (en) * 2018-04-17 2022-04-22 杭州尚健生物技术有限公司 Fusion protein combined with CD47 protein and application thereof
MX2020012227A (en) * 2018-05-17 2021-04-13 Immunome Inc CH3 DOMAIN MARKER EPITOPES.
EP3802599B1 (en) * 2018-06-03 2023-12-20 LamKap Bio beta AG Bispecific antibodies against ceacam5 and cd47
KR102945860B1 (en) * 2018-07-11 2026-03-31 카 메디컬 리미티드 SIRPalpha-4-1BBL variant fusion protein and method of using the same
CA3104778A1 (en) 2018-07-11 2020-01-16 Kahr Medical Ltd. Pd1-4-1bbl variant fusion protein and methods of use thereof
US12084497B2 (en) 2018-08-08 2024-09-10 Orionis Biosciences, Inc. SIRP1α targeted chimeric proteins and uses thereof
US10780121B2 (en) 2018-08-29 2020-09-22 Shattuck Labs, Inc. FLT3L-based chimeric proteins
WO2020047326A2 (en) 2018-08-31 2020-03-05 ALX Oncology Inc. Decoy polypeptides
TW202028237A (en) 2018-09-27 2020-08-01 美商西建公司 Sirpα binding proteins and methods of use thereof
US11591390B2 (en) 2018-09-27 2023-02-28 Celgene Corporation SIRP-α binding proteins and methods of use thereof
US12331320B2 (en) 2018-10-10 2025-06-17 The Research Foundation For The State University Of New York Genome edited cancer cell vaccines
CN109306017B (en) * 2018-10-12 2021-02-09 倍而达药业(苏州)有限公司 Recombinant protein prepared based on SIRP-alpha D1 mutant and application thereof
CA3117212A1 (en) * 2018-10-23 2020-04-30 Dragonfly Therapeutics, Inc. Heterodimeric fc-fused proteins
EP3876977A1 (en) 2018-11-06 2021-09-15 The Regents Of The University Of California Chimeric antigen receptors for phagocytosis
CN111303293B (en) * 2018-11-14 2022-08-30 杭州尚健生物技术有限公司 Fusion protein and application thereof
CN109517054B (en) * 2018-12-04 2022-04-08 江苏东抗生物医药科技有限公司 SIRP alpha variant or fusion protein thereof and application thereof
JP2022523543A (en) 2019-03-06 2022-04-25 ジエンス ヘンルイ メデイシンカンパニー リミテッド Bifunctional fusion protein and its pharmaceutical use
WO2020200941A1 (en) 2019-03-29 2020-10-08 F. Hoffmann-La Roche Ag Spr-based binding assay for the functional analysis of multivalent molecules
CN111763261B (en) * 2019-04-02 2022-08-09 杭州尚健生物技术有限公司 Fusion protein and application thereof
US11013764B2 (en) 2019-04-30 2021-05-25 Myeloid Therapeutics, Inc. Engineered phagocytic receptor compositions and methods of use thereof
KR20220044904A (en) * 2019-05-31 2022-04-12 알렉소 온콜로지 인크. How to treat cancer with SIRP alpha FC fusion in combination with immune checkpoint inhibitors
CA3142738A1 (en) * 2019-06-05 2020-12-10 Asher Biotherapeutics, Inc. Fusions of mutant interleukin-2 polypeptides with antigen binding molecules for modulating immune cell function
US20200400662A1 (en) 2019-06-07 2020-12-24 ALX Oncology Inc. Methods and reagents for reducing the interference of drugs that bind cd47 in serological assays
CN112125975B (en) * 2019-06-25 2024-03-01 上海翰森生物医药科技有限公司 PD-L1 and CD47 bispecific fusion protein and medical application thereof
KR102228271B1 (en) * 2019-07-16 2021-03-17 한국과학기술연구원 immune regulatory protein-siRNA complex for anticancer activity
AU2020315598B2 (en) 2019-07-16 2024-12-12 Gilead Sciences, Inc. HIV vaccines and methods of making and using
KR20220097875A (en) 2019-09-03 2022-07-08 마이얼로이드 테라퓨틱스, 인크. Methods and compositions for genomic integration
KR102902719B1 (en) 2019-10-18 2025-12-24 포티 세븐, 엘엘씨 Combination therapy for treating myelodysplastic syndromes and acute myeloid leukemia
CA3153636A1 (en) 2019-10-31 2021-05-06 Forty Seven, Inc. Anti-cd47 and anti-cd20 based treatment of blood cancer
US10980836B1 (en) 2019-12-11 2021-04-20 Myeloid Therapeutics, Inc. Therapeutic cell compositions and methods of manufacturing and use thereof
EP4445902A3 (en) 2019-12-24 2024-12-18 Carna Biosciences, Inc. Diacylglycerol kinase modulating compounds
EP4090674A4 (en) 2020-01-14 2024-01-24 Synthekine, Inc. METHODS AND COMPOSITIONS OF BIASED IL2 MUTEINS
JP2023511274A (en) 2020-01-14 2023-03-17 シンセカイン インコーポレイテッド IL2 orthologs and usage
CN117964757A (en) 2020-02-14 2024-05-03 吉利德科学公司 Antibodies and fusion proteins binding to CCR8 and uses thereof
CN111253482B (en) * 2020-02-18 2021-11-30 中国人民解放军军事科学院军事医学研究院 SIRPa variants, fusion proteins, and uses thereof
WO2021191870A1 (en) 2020-03-27 2021-09-30 Dcprime B.V. Ex vivo use of modified cells of leukemic origin for enhancing the efficacy of adoptive cell therapy
WO2021231976A1 (en) 2020-05-14 2021-11-18 Xencor, Inc. Heterodimeric antibodies that bind prostate specific membrane antigen (psma) and cd3
KR20230033647A (en) 2020-06-30 2023-03-08 멘두스 비.브이. Use of leukemia-derived cells in ovarian cancer vaccines
TWI815136B (en) * 2020-06-30 2023-09-11 大陸商和鉑醫藥(上海)有限責任公司 A bispecific antibody and its use
WO2022010806A1 (en) 2020-07-06 2022-01-13 ALX Oncology Inc. Methods for reducing the interference of drugs that bind therapeutic targets expressed on blood cells in serological assays
CN113912736A (en) * 2020-07-09 2022-01-11 上海交通大学 Targeting CD47 and PD-L1 double-effect fusion protein and application thereof
CN111808183B (en) * 2020-07-25 2022-07-08 北京吉尔麦迪生物医药科技有限公司 High-affinity SIRP alpha mutant targeting CD47 and fusion protein thereof
CN114057888A (en) * 2020-07-30 2022-02-18 三生国健药业(上海)股份有限公司 SIRP alpha-Fc fusion protein
WO2022034946A1 (en) * 2020-08-14 2022-02-17 한국과학기술연구원 Immunomodulatory protein-sirna complex having anticancer activity
KR102579284B1 (en) * 2020-09-22 2023-09-18 비피진 주식회사 Liposome complex for treatment cancer comprising new CD47 binder and polynucleotide
KR102557016B1 (en) * 2020-09-22 2023-07-20 비피진 주식회사 CD47 binder and liposome complex for treatment cancer
US12024559B2 (en) 2020-10-23 2024-07-02 Asher Biotherapeutics, Inc. Fusions with CD8 antigen binding molecules for modulating immune cell function
JP2023549140A (en) 2020-11-04 2023-11-22 マイエロイド・セラピューティクス,インコーポレーテッド Engineered chimeric fusion protein compositions and methods of use thereof
US20220196651A1 (en) 2020-12-06 2022-06-23 ALX Oncology Inc. Multimers for reducing the interference of drugs that bind cd47 in serological assays
CN112979782B (en) * 2021-03-08 2023-07-18 深圳市乐土生物医药有限公司 Polypeptide and application thereof
KR20230156079A (en) * 2021-03-09 2023-11-13 젠코어 인코포레이티드 Heterodimeric antibody binding to CD3 and CLDN6
WO2022190058A1 (en) 2021-03-12 2022-09-15 Dcprime B.V. Methods of vaccination and use of cd47 blockade
TW202302145A (en) 2021-04-14 2023-01-16 美商基利科學股份有限公司 Co-inhibition of cd47/sirpα binding and nedd8-activating enzyme e1 regulatory subunit for the treatment of cancer
BR112023023642A2 (en) 2021-05-11 2024-01-30 Myeloid Therapeutics Inc METHODS AND COMPOSITIONS FOR GENOMIC INTEGRATION
GB2638094B (en) 2021-05-19 2026-03-04 Asher Biotherapeutics Inc IL-21 Polypeptides And Targeted Constructs
WO2022271650A1 (en) 2021-06-23 2022-12-29 Gilead Sciences, Inc. Diacylglyercol kinase modulating compounds
EP4359415A1 (en) 2021-06-23 2024-05-01 Gilead Sciences, Inc. Diacylglyercol kinase modulating compounds
WO2022271659A1 (en) 2021-06-23 2022-12-29 Gilead Sciences, Inc. Diacylglyercol kinase modulating compounds
US11932634B2 (en) 2021-06-23 2024-03-19 Gilead Sciences, Inc. Diacylglycerol kinase modulating compounds
WO2023003331A1 (en) * 2021-07-19 2023-01-26 Yuhan Corporation Sirp-alpha variants and use thereof
CN113896802A (en) * 2021-10-09 2022-01-07 宜明昂科生物医药技术(上海)有限公司 Recombinant fusion protein targeting CD47 and CD38, and preparation and application thereof
AU2022375782B2 (en) 2021-10-28 2026-02-26 Gilead Sciences, Inc. Pyridizin-3(2h)-one derivatives
AU2022376954B2 (en) 2021-10-29 2026-04-23 Gilead Sciences, Inc. Cd73 compounds
TWI859619B (en) * 2021-11-01 2024-10-21 大陸商山東先聲生物製藥有限公司 SIRPa MUTANT AND APPLICATION THEREOF
WO2023088429A1 (en) * 2021-11-19 2023-05-25 杭州尚健生物技术有限公司 SIRPα VARIANT AND USE THEREOF
CN116178561B (en) * 2021-11-26 2025-07-18 杭州尚健生物技术有限公司 Fusion proteins comprising SIRPalpha mutants
EP4340893A1 (en) 2021-11-19 2024-03-27 KIST (Korea Institute of Science and Technology) Therapeutic compounds for red blood cell-mediated delivery of an active pharmaceutical ingredient to a target cell
CA3236718A1 (en) * 2021-12-21 2023-06-29 Fbd Biologics Limited Engineered sirp.alpha. variants and methods of use thereof
AU2022419982B2 (en) 2021-12-22 2026-04-16 Gilead Sciences, Inc. Ikaros zinc finger family degraders and uses thereof
CA3237577A1 (en) 2021-12-22 2023-06-29 Gilead Sciences, Inc. Ikaros zinc finger family degraders and uses thereof
KR102710779B1 (en) * 2022-01-04 2024-09-26 주식회사 보령바이오파마 Polynucleotide for treatment cancer encoding 5'-nucleotidase modified protein
TW202340168A (en) 2022-01-28 2023-10-16 美商基利科學股份有限公司 Parp7 inhibitors
US20250302953A1 (en) 2022-02-14 2025-10-02 Sana Biotechnology, Inc. Methods of treating patients exhibiting a prior failed therapy with hypoimmunogenic cells
EP4493554A1 (en) 2022-03-17 2025-01-22 Gilead Sciences, Inc. Ikaros zinc finger family degraders and uses thereof
WO2023183313A1 (en) 2022-03-22 2023-09-28 Sana Biotechnology, Inc. Engineering cells with a transgene in b2m or ciita locus and associated compositions and methods
US20250257113A1 (en) 2022-03-24 2025-08-14 The Board Of Trustees Of The Leland Stanford Junior University Multivalent sirp-alpha fusion polypeptides
WO2023183817A1 (en) 2022-03-24 2023-09-28 Gilead Sciences, Inc. Combination therapy for treating trop-2 expressing cancers
EP4499837A1 (en) 2022-03-24 2025-02-05 Bitterroot Bio, Inc. Sirp-alpha fusion polypeptides with modified fc domains
TWI876305B (en) 2022-04-05 2025-03-11 美商基利科學股份有限公司 Combination therapy for treating colorectal cancer
CR20240451A (en) 2022-04-21 2024-12-04 Gilead Sciences Inc Kras g12d modulating compounds
TW202400650A (en) 2022-05-11 2024-01-01 日商第一三共股份有限公司 Combination of an antibody and cd47 inhibitor
US20240010701A1 (en) 2022-06-01 2024-01-11 ALX Oncology Inc. Combination therapies for treating urothelial carcinoma
PE20250758A1 (en) 2022-07-01 2025-03-13 Gilead Sciences Inc CD73 COMPOUNDS
KR20250036855A (en) 2022-07-12 2025-03-14 길리애드 사이언시즈, 인코포레이티드 HIV immunogenic polypeptides and vaccines, and uses thereof
CN116041470B (en) * 2022-08-04 2024-10-22 四川大学华西医院 Cell membrane material with high affinity binding to tumor cell CD47 and preparation method and application thereof
KR102896511B1 (en) * 2022-09-07 2025-12-08 주식회사 시프트바이오 Antibody specifically binding to SIRPα variant
WO2024064668A1 (en) 2022-09-21 2024-03-28 Gilead Sciences, Inc. FOCAL IONIZING RADIATION AND CD47/SIRPα DISRUPTION ANTICANCER COMBINATION THERAPY
CN117886927A (en) * 2022-10-14 2024-04-16 华南理工大学 An immunoglobulin Fc variant with improved blood half-life and its application
CN120225509A (en) 2022-12-22 2025-06-27 吉利德科学公司 PRMT5 inhibitors and uses thereof
AU2024252725A1 (en) 2023-04-11 2025-11-06 Gilead Sciences, Inc. Kras modulating compounds
PE20260121A1 (en) 2023-04-21 2026-01-16 Gilead Sciences Inc PRMT5 INHIBITORS AND THEIR USES
CN119451994A (en) 2023-05-31 2025-02-14 Fbd生物制品有限公司 Protein complexes targeting CD47/PD-L1 and methods of use thereof
AU2024306338A1 (en) 2023-06-30 2026-01-08 Gilead Sciences, Inc. Kras modulating compounds
WO2025024811A1 (en) 2023-07-26 2025-01-30 Gilead Sciences, Inc. Parp7 inhibitors
KR20260046403A (en) 2023-07-26 2026-04-07 길리애드 사이언시즈, 인코포레이티드 PARP7 inhibitor
US20250101042A1 (en) 2023-09-08 2025-03-27 Gilead Sciences, Inc. Kras g12d modulating compounds
AU2024337913A1 (en) 2023-09-08 2026-03-26 Gilead Sciences, Inc. Pyrimidine-containing polycyclic derivatives as kras g12d modulating compounds
WO2025072726A1 (en) 2023-09-29 2025-04-03 Trex Bio, Inc. Tnf-alpha variant fusion molecules
US20250154172A1 (en) 2023-11-03 2025-05-15 Gilead Sciences, Inc. Prmt5 inhibitors and uses thereof
WO2025137640A1 (en) 2023-12-22 2025-06-26 Gilead Sciences, Inc. Azaspiro wrn inhibitors
US20250332216A1 (en) * 2024-04-26 2025-10-30 Immuneonco Biopharmaceuticals (Shanghai) Inc. Combination therapy for classic hodkin's lymphoma
WO2025245003A1 (en) 2024-05-21 2025-11-27 Gilead Sciences, Inc. Prmt5 inhibitors and uses thereof
WO2026039365A1 (en) 2024-08-12 2026-02-19 Gilead Sciences, Inc. Kras modulating compounds
WO2026089992A1 (en) 2024-10-21 2026-04-30 Gilead Sciences, Inc. Prmt5 inhibitors and uses thereof

Citations (104)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3773919A (en) 1969-10-23 1973-11-20 Du Pont Polylactide-drug mixtures
US5116964A (en) 1989-02-23 1992-05-26 Genentech, Inc. Hybrid immunoglobulins
WO1993000077A1 (en) 1991-06-21 1993-01-07 University Of Cincinnati Orally administrable therapeutic proteins and method of making
US5306809A (en) 1990-12-31 1994-04-26 Akzo N.V. Acid-labile linker molecules
US5478925A (en) 1991-08-07 1995-12-26 Yeda Research And Development Co. Ltd. Multimers of the soluble forms of TNF receptors, their preparation and pharmaceutical compositions containing them
US5505931A (en) 1993-03-04 1996-04-09 The Dow Chemical Company Acid cleavable compounds, their preparation and use as bifunctional acid-labile crosslinking agents
US5648237A (en) 1991-09-19 1997-07-15 Genentech, Inc. Expression of functional antibody fragments
US5697901A (en) 1989-12-14 1997-12-16 Elof Eriksson Gene delivery by microneedle injection
WO1999040940A1 (en) 1998-02-16 1999-08-19 Marie Sarfati Ligands of the cd47 antigen, agents binding the ligands of the cd47 antigen and uses thereof
US5972707A (en) 1994-06-27 1999-10-26 The Johns Hopkins University Gene delivery system
WO2000077026A1 (en) 1999-06-11 2000-12-21 Human Genome Sciences, Inc. 49 human secreted proteins
WO2001048020A1 (en) 1999-12-24 2001-07-05 Medical Research Council Composition for inhibiting macrophage activity
US6261554B1 (en) 1995-07-25 2001-07-17 Introgene B.V. Compositions for targeted gene delivery
US6541615B1 (en) 1996-11-15 2003-04-01 Max-Planck-Gellschaft Zur Foderung Der Wissenschaften E.V. SIRP proteins and uses thereof
WO2003031650A2 (en) 2001-10-08 2003-04-17 Bayer Healthcare Ag Genes and proteins for prevention, prediction, prognosis and therapy of cardiovascular disease
US6591129B1 (en) 1996-02-15 2003-07-08 Biosense, Inc. Method for treating tissue through injection of a therapeutic agent
US6613332B1 (en) 1991-06-21 2003-09-02 The University Of Cincinnati Oral administration of therapeutic proteins
WO2003095618A2 (en) 2002-05-09 2003-11-20 Brigham And Women's Hospital, Inc. Identification of dysregulated genes in patients with multiple sclerosis
WO2004011618A2 (en) 2002-07-29 2004-02-05 Hmgene, Inc. Methods of identifying adipocyte specific genes, the genes identified, and their uses
US20040213792A1 (en) 2003-04-24 2004-10-28 Clemmons David R. Method for inhibiting cellular activation by insulin-like growth factor-1
WO2005108415A2 (en) 2004-04-30 2005-11-17 Biogen Idec Ma Inc. Membrane associated molecules
US20070148201A1 (en) 2003-08-25 2007-06-28 Pieris Proteolab Ag Muteins of a bilin-binding protein with affinity for a given target
WO2007084344A2 (en) 2006-01-13 2007-07-26 Novartis Ag Compositions and methods of use for antibodies of dickkopf-1 and/or -4
US7402155B2 (en) 1999-12-08 2008-07-22 Boston Scientific Scimed, Inc. Injection apparatus for delivering therapeutic
US20090068195A1 (en) 2007-04-23 2009-03-12 Wyeth Methods and compositions for treating and monitoring treatment of il-13-associated disorders
US7514229B2 (en) 2005-09-29 2009-04-07 The Board Of Trustees Of The Leland Stanford Junior University Methods for diagnosing and evaluating treatment of blood disorders
WO2009046541A1 (en) 2007-10-11 2009-04-16 University Health Network MODULATION OF SIRPα - CD47 INTERACTION FOR INCREASING HUMAN HEMATOPOIETIC STEM CELL ENGRAFTMENT AND COMPOUNDS THEREFOR
WO2009091601A1 (en) 2008-01-15 2009-07-23 The Board Of Trustees Of The Leland Stanford Junior University Methods for manipulating phagocytosis mediated by cd47
WO2009131453A1 (en) 2008-04-23 2009-10-29 Stichting Sanquin Bloedvoorziening Compositions and methods to enhance the immune system.
US7662367B2 (en) 2000-03-02 2010-02-16 Xencor, Inc. Pharmaceutical compositions for the treatment of TNF-α related disorders
WO2010070047A1 (en) 2008-12-19 2010-06-24 Novartis Ag Soluble polypeptides for use in treating autoimmune and inflammatory disorders
US20100189651A1 (en) 2009-01-12 2010-07-29 Cytomx Therapeutics, Llc Modified antibody compositions, methods of making and using thereof
WO2010096838A2 (en) 2009-02-23 2010-08-26 Cytomx Therapeutics, Llc Proproteins and methods of use thereof
US20100215640A1 (en) 2003-04-24 2010-08-26 The University Of North Carolina At Chapel Hill Method for inhibiting cellular activation by insulin-like growth factor-1
US20100239579A1 (en) 2006-05-15 2010-09-23 Viral Logic Systems Technology Corp. CD47 Related Compositions and Methods for Treating Immunological Diseases and Disorders
WO2010130053A1 (en) 2009-05-15 2010-11-18 University Health Network COMPOSITIONS AND METHODS FOR TREATING HEMATOLOGIC CANCERS TARGETING THE SIRPα - CD47 INTERACTION
WO2011011315A1 (en) 2009-07-20 2011-01-27 National Cheng Kung University POLYPEPTIDES SELECTIVE FOR AV β3 INTEGRIN CONJUGATED WITH A VARIANT OF HUMAN SERUM ALBUMIN (HSA) AND PHARMACEUTICAL USES THEREOF
US7892558B2 (en) 2004-02-27 2011-02-22 Vaxconsulting Isolated TNF-alpha peptide and pharmaceutical composition thereof
US20110081345A1 (en) 2007-04-18 2011-04-07 Moore Margaret D Single chain fc, methods of making and methods of treatment
US20110110938A1 (en) 2002-09-16 2011-05-12 Henry Chiu Compositions and methods for the treatment of immune related diseases
WO2011066501A1 (en) 2009-11-30 2011-06-03 Centocor Ortho Biotech Inc. Antibody fc mutants with ablated effector functions
WO2011076781A1 (en) 2009-12-22 2011-06-30 Novartis Ag Tetravalent cd47-antibody constant region fusion protein for use in therapy
US20110184145A1 (en) 2002-11-08 2011-07-28 Ablynx N.V. Method of administering therapeutic polypeptides, and polypeptides therefor
WO2011143624A2 (en) 2010-05-14 2011-11-17 The Board Of Trustees Of The Leland Stanford Junior University Humanized and chimeric monoclonal antibodies to cd47
WO2012048332A2 (en) 2010-10-08 2012-04-12 John Williams A monoclonal antibody framework binding interface for meditopes, meditope delivery systems and methods for their use
US8216805B2 (en) 1995-03-01 2012-07-10 Genentech, Inc. Knobs and holes heteromeric polypeptides
WO2012130831A1 (en) 2011-03-29 2012-10-04 Roche Glycart Ag Antibody fc variants
WO2012142515A2 (en) 2011-04-13 2012-10-18 Bristol-Myers Squibb Company Fc fusion proteins comprising novel linkers or arrangements
US20120283408A1 (en) 2009-11-03 2012-11-08 Samsung Electronic Co., Ltd. Fusion protein binding specifically to constant region of antibody, method of preparing the fusion protein, and method of isolating antibody using the fusion protein
WO2012172521A1 (en) 2011-06-16 2012-12-20 Novartis Ag Soluble proteins for use as therapeutics
WO2013032948A1 (en) 2011-08-26 2013-03-07 The University Of North Carolina At Chapel Hill Method for inhibiting cellular activation by insulin-like growth factor-1
WO2013063076A1 (en) 2011-10-25 2013-05-02 Indiana University Research & Technology Corporation Compositions for and methods of modulating complications, risks and issues with xenotransplantation
WO2013109752A1 (en) 2012-01-17 2013-07-25 The Board Of Trustees Of The Leland Stanford Junior University High affinity sirp-alpha reagents
US8518404B2 (en) 2007-08-22 2013-08-27 The Regents Of The University Of California Activatable binding polypeptides and methods of identification and use thereof
US8518869B2 (en) 2004-03-29 2013-08-27 Austria Wirtschaftsservice Gesellschaft M.B.H. Pharmaceutical combined preparation containing a therapeutic protein
US8603778B2 (en) 2000-08-07 2013-12-10 Janssen Biotech, Inc. Anti-TNF antibodies, compositions, methods and uses
US20140010810A1 (en) 2012-06-22 2014-01-09 Cytomx Therapeutics, Inc. Anti-Jagged 1/Jagged 2 Cross-Reactive Antibodies, Activatable Anti-Jagged Antibodies And Methods Of Use Thereof
US20140023664A1 (en) 2012-06-22 2014-01-23 Cytomx Therapeutics, Inc. Activatable Antibodies Having Non-Binding Steric Moieties and Methods of Using the Same
US20140024111A1 (en) 2008-01-07 2014-01-23 Amgen Inc. Host cell for making antibody fc-heterodimeric molecules using electrostatic steering effects
WO2014045022A2 (en) 2012-09-18 2014-03-27 The University Of Birmingham Agents and methods
US20140113348A1 (en) 2012-02-10 2014-04-24 City Of Hope Meditopes and meditope-binding antibodies and uses thereof
US20140140926A1 (en) 2011-02-07 2014-05-22 The Trustees Of The University Of Pennsylvania Novel Peptides and Methods Using Same
US8748399B2 (en) 2010-11-15 2014-06-10 E I Du Pont De Nemours And Company Acid-cleavable linkers exhibiting altered rates of acid hydrolysis
US20140161800A1 (en) 2011-04-22 2014-06-12 John W. Blankenship Prostate-Specific Membrane Antigen Binding Proteins and Related Compositions and Methods
WO2014094122A1 (en) 2012-12-17 2014-06-26 Trillium Therapeutics Inc. Treatment of cd47+ disease cells with sirp alpha-fc fusions
WO2014121093A1 (en) 2013-01-31 2014-08-07 Thomas Jefferson University Fusion proteins that facilitate cancer cell destruction
WO2014124028A1 (en) 2013-02-05 2014-08-14 Weiskopf Kipp Cd47 targeted therapies for the treatment of infectious disease
US20140242095A1 (en) 2011-10-19 2014-08-28 University Health Network Antibodies and antibody fragments targeting sirp-alpha and their use in treating hematologic cancers
WO2014149477A1 (en) 2013-03-15 2014-09-25 The Board Of Trustees Of The Leland Stanford Junior University Methods for achieving therapeutically effective doses of anti-cd47 agents
WO2014160183A1 (en) 2013-03-13 2014-10-02 The United States Of America,As Represented By The Secretary,Department Of Health And Human Services Methods for modulating chemotherapeutic cytotoxicity
WO2014179132A1 (en) 2013-04-29 2014-11-06 The Board Of Trustees Of The Leland Stanford Junior University Use of anti-cd47 agents to enhance immunization
WO2014186761A2 (en) 2013-05-17 2014-11-20 The Board Of Trustes Of The Leland Stanford Junior University Methods for determining responsiveness to an anti-cd47 agent
WO2015042557A1 (en) 2013-09-23 2015-03-26 Regeneron Pharmaceuticals, Inc. Non-human animals having a humanized signal-regulatory protein gene
WO2015041987A1 (en) 2013-09-18 2015-03-26 The Board Of Trustees Of The Leland Stanford Junior University Modulation of efferocytosis pathways for treatment of atherosclerotic disease
WO2015048329A2 (en) 2013-09-25 2015-04-02 Cytomx Therapeutics, Inc. Matrix metalloproteinase substrates and other cleavable moieties and methods of use thereof
WO2015057834A1 (en) 2013-10-15 2015-04-23 The California Institute For Biomedical Research Peptidic chimeric antigen receptor t cell switches and uses thereof
WO2015116933A2 (en) 2014-01-31 2015-08-06 Cytomx Therapeutics, Inc. Matriptase and u-plasminogen activator substrates and other cleavable moieties and methods of use thereof
WO2015136541A2 (en) 2014-03-12 2015-09-17 Yeda Research And Development Co. Ltd Reducing systemic regulatory t cell levels or activity for treatment of disease and injury of the cns
WO2016023040A1 (en) 2014-08-08 2016-02-11 Alexo Therapeutics International Sirp-alpha variant constructs and uses thereof
WO2016022971A1 (en) 2014-08-08 2016-02-11 The Board Of Trustees Of The Leland Stanford Junior University Sirp alpha-antibody fusion proteins
WO2016023001A1 (en) 2014-08-08 2016-02-11 The Board Of Trustees Of The Leland Stanford Junior University Multispecific high affinity pd-1 agents and methods of use
WO2016022994A2 (en) 2014-08-08 2016-02-11 The Board Of Trustees Of The Leland Stanford Junior University High affinity pd-1 agents and methods of use
WO2016024021A1 (en) 2014-08-15 2016-02-18 Merck Patent Gmbh Sirp-alpha immunoglobulin fusion proteins
WO2016033201A1 (en) 2014-08-26 2016-03-03 The Board Of Trustees Of The Leland Stanford Junior University Engraftment of stem cells with a combination of an agent that targets stem cells and modulation of immunoregulatory signaling
WO2016044021A1 (en) 2014-09-15 2016-03-24 The Board Of Trustees Of The Leland Stanford Junior University Targeting aneurysm disease by modulating phagocytosis pathways
WO2016057980A1 (en) 2014-10-10 2016-04-14 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Methods to eliminate cancer stem cells by targeting cd47
WO2016063233A1 (en) 2014-10-24 2016-04-28 Effimune Method and compositions for inducing differentiation of myeloid derived suppressor cell to treat cancer and infectious diseases
WO2016065329A1 (en) 2014-10-24 2016-04-28 The Board Of Trustees Of The Leland Stanford Junior University Compositions and methods for inducing phagocytosis of mhc class i positive cells and countering anti-cd47/sirpa resistance
WO2016081423A1 (en) 2014-11-18 2016-05-26 Janssen Pharmaceutica Nv Cd47 antibodies, methods, and uses
US20160193295A1 (en) 2013-07-31 2016-07-07 Amgen Inc. Stabilization of fc-containing polypeptides
US9394365B1 (en) 2014-03-12 2016-07-19 Yeda Research And Development Co., Ltd Reducing systemic regulatory T cell levels or activity for treatment of alzheimer's disease
WO2016138306A1 (en) 2015-02-27 2016-09-01 The Board Of Trustees Of The Leland Stanford Junior University Combination therapy for treatment of coronary artery disease
WO2016169261A1 (en) 2015-04-24 2016-10-27 宜明昂科生物医药技术(上海)有限公司 Novel recombinant bi-functional fusion protein and preparation and application therefor
US20170029508A1 (en) 2014-03-12 2017-02-02 Yeda Research And Development Co. Ltd Reducing Systemic Regulatory T Cell Levels or Activity for Treatment of Disease and Injury of the CNS
WO2017027422A1 (en) 2015-08-07 2017-02-16 Alexo Therapeutics Inc. Constructs having a sirp-alpha domain or variant thereof
WO2017178653A2 (en) 2016-04-14 2017-10-19 Ose Immunotherapeutics NEW ANTI-SIRPa ANTIBODIES AND THEIR THERAPEUTIC APPLICATIONS
WO2018057669A1 (en) 2016-09-21 2018-03-29 Alexo Therapeutics Inc. Antibodies against signal-regulatory protein alpha and methods of use
WO2020243338A1 (en) 2019-05-31 2020-12-03 ALX Oncology Inc. Methods of treating cancer with sirp alpha fc fusion in combination with an immune checkpoint inhibitor
WO2020247820A1 (en) 2019-06-07 2020-12-10 ALX Oncology Inc. Methods and reagents for reducing the interference of drugs that bind cd47 in serological assays
US20210154269A1 (en) 2019-11-27 2021-05-27 ALX Oncology Inc. Combination therapies for treating cancer
WO2021247430A1 (en) 2020-06-01 2021-12-09 ALX Oncology Inc. Combination therapies comprising a hypomethylation agent for treating cancer
WO2022010806A1 (en) 2020-07-06 2022-01-13 ALX Oncology Inc. Methods for reducing the interference of drugs that bind therapeutic targets expressed on blood cells in serological assays
WO2022120286A1 (en) 2020-12-06 2022-06-09 ALX Oncology Inc. Multimers for reducing the interference of drugs that bind cd47 in serological assays
WO2022241157A1 (en) 2021-05-13 2022-11-17 ALX Oncology Inc. Combination therapies for treating cancer

Family Cites Families (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JO3076B1 (en) 2007-10-17 2017-03-15 Janssen Alzheimer Immunotherap Immunotherapy regimes dependent on apoe status
WO2012145746A1 (en) 2011-04-21 2012-10-26 The Regents Of The University Of Colorado, A Body Corporate Compositions and methods for the treatment of neuromyelitis optica
JP2016507555A (en) 2013-02-06 2016-03-10 インヒブルクス エルピー Non-platelet and non-erythrocyte-reducing CD47 antibodies and methods of use thereof

Patent Citations (187)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3773919A (en) 1969-10-23 1973-11-20 Du Pont Polylactide-drug mixtures
US5116964A (en) 1989-02-23 1992-05-26 Genentech, Inc. Hybrid immunoglobulins
US5697901A (en) 1989-12-14 1997-12-16 Elof Eriksson Gene delivery by microneedle injection
US5306809A (en) 1990-12-31 1994-04-26 Akzo N.V. Acid-labile linker molecules
WO1993000077A1 (en) 1991-06-21 1993-01-07 University Of Cincinnati Orally administrable therapeutic proteins and method of making
US6613332B1 (en) 1991-06-21 2003-09-02 The University Of Cincinnati Oral administration of therapeutic proteins
US6174529B1 (en) 1991-06-21 2001-01-16 University Of Cincinnati Oral therapy for the treatment of allergies and method of manufacture
US5478925A (en) 1991-08-07 1995-12-26 Yeda Research And Development Co. Ltd. Multimers of the soluble forms of TNF receptors, their preparation and pharmaceutical compositions containing them
US5648237A (en) 1991-09-19 1997-07-15 Genentech, Inc. Expression of functional antibody fragments
US5505931A (en) 1993-03-04 1996-04-09 The Dow Chemical Company Acid cleavable compounds, their preparation and use as bifunctional acid-labile crosslinking agents
US5972707A (en) 1994-06-27 1999-10-26 The Johns Hopkins University Gene delivery system
US8216805B2 (en) 1995-03-01 2012-07-10 Genentech, Inc. Knobs and holes heteromeric polypeptides
US6261554B1 (en) 1995-07-25 2001-07-17 Introgene B.V. Compositions for targeted gene delivery
US6591129B1 (en) 1996-02-15 2003-07-08 Biosense, Inc. Method for treating tissue through injection of a therapeutic agent
US6541615B1 (en) 1996-11-15 2003-04-01 Max-Planck-Gellschaft Zur Foderung Der Wissenschaften E.V. SIRP proteins and uses thereof
WO1999040940A1 (en) 1998-02-16 1999-08-19 Marie Sarfati Ligands of the cd47 antigen, agents binding the ligands of the cd47 antigen and uses thereof
WO2000077026A1 (en) 1999-06-11 2000-12-21 Human Genome Sciences, Inc. 49 human secreted proteins
US7402155B2 (en) 1999-12-08 2008-07-22 Boston Scientific Scimed, Inc. Injection apparatus for delivering therapeutic
WO2001048020A1 (en) 1999-12-24 2001-07-05 Medical Research Council Composition for inhibiting macrophage activity
US7662367B2 (en) 2000-03-02 2010-02-16 Xencor, Inc. Pharmaceutical compositions for the treatment of TNF-α related disorders
US8603778B2 (en) 2000-08-07 2013-12-10 Janssen Biotech, Inc. Anti-TNF antibodies, compositions, methods and uses
WO2003031650A2 (en) 2001-10-08 2003-04-17 Bayer Healthcare Ag Genes and proteins for prevention, prediction, prognosis and therapy of cardiovascular disease
WO2003095618A2 (en) 2002-05-09 2003-11-20 Brigham And Women's Hospital, Inc. Identification of dysregulated genes in patients with multiple sclerosis
WO2004011618A2 (en) 2002-07-29 2004-02-05 Hmgene, Inc. Methods of identifying adipocyte specific genes, the genes identified, and their uses
US20110110938A1 (en) 2002-09-16 2011-05-12 Henry Chiu Compositions and methods for the treatment of immune related diseases
US20110184145A1 (en) 2002-11-08 2011-07-28 Ablynx N.V. Method of administering therapeutic polypeptides, and polypeptides therefor
US8613922B2 (en) 2003-04-24 2013-12-24 The University Of North Carolina At Chapel Hill Methods for inhibiting diabetic retinopathy with an antibody against integrin associated protein (IAP)
US20080160013A1 (en) 2003-04-24 2008-07-03 The University Of North Carolina Method for inhibiting cellular activation by insulin-like growth factor-1
US20160297866A1 (en) 2003-04-24 2016-10-13 The University Of North Carolina At Chapel Hill Method for inhibiting cellular activation by insulin-like growth factor-1
US9475882B2 (en) 2003-04-24 2016-10-25 The University Of North Carolina At Chapel Hill Antagonists of IAP-SHPS1 interaction
WO2004096133A2 (en) 2003-04-24 2004-11-11 University Of North Carolina At Chaper Hill Method for inhibiting cellular activation by insulin-like growth factor-1
US20040213792A1 (en) 2003-04-24 2004-10-28 Clemmons David R. Method for inhibiting cellular activation by insulin-like growth factor-1
US20100215640A1 (en) 2003-04-24 2010-08-26 The University Of North Carolina At Chapel Hill Method for inhibiting cellular activation by insulin-like growth factor-1
US20070148201A1 (en) 2003-08-25 2007-06-28 Pieris Proteolab Ag Muteins of a bilin-binding protein with affinity for a given target
US7691970B2 (en) 2003-08-25 2010-04-06 Pieris Ag Muteins of a bilin-binding protein with affinity for a given target
US7892558B2 (en) 2004-02-27 2011-02-22 Vaxconsulting Isolated TNF-alpha peptide and pharmaceutical composition thereof
US8518869B2 (en) 2004-03-29 2013-08-27 Austria Wirtschaftsservice Gesellschaft M.B.H. Pharmaceutical combined preparation containing a therapeutic protein
US20140051634A1 (en) 2004-03-29 2014-02-20 Austria Wirtschaftsservice Gesellschaft M.B.H. Pharmaceutical combined preparation containing a therapeutic protein
WO2005108415A2 (en) 2004-04-30 2005-11-17 Biogen Idec Ma Inc. Membrane associated molecules
US7514229B2 (en) 2005-09-29 2009-04-07 The Board Of Trustees Of The Leland Stanford Junior University Methods for diagnosing and evaluating treatment of blood disorders
EA015538B1 (en) 2006-01-13 2011-08-30 Новартис Аг Compositions and methods of use for antibodies of dickkopf-1 and/or -4
WO2007084344A2 (en) 2006-01-13 2007-07-26 Novartis Ag Compositions and methods of use for antibodies of dickkopf-1 and/or -4
US20100239579A1 (en) 2006-05-15 2010-09-23 Viral Logic Systems Technology Corp. CD47 Related Compositions and Methods for Treating Immunological Diseases and Disorders
US8377448B2 (en) 2006-05-15 2013-02-19 The Board Of Trustees Of The Leland Standford Junior University CD47 related compositions and methods for treating immunological diseases and disorders
US20110081345A1 (en) 2007-04-18 2011-04-07 Moore Margaret D Single chain fc, methods of making and methods of treatment
US20090068195A1 (en) 2007-04-23 2009-03-12 Wyeth Methods and compositions for treating and monitoring treatment of il-13-associated disorders
US8541203B2 (en) 2007-08-22 2013-09-24 The Regents Of The University Of California Activatable binding polypeptides and methods of identification and use thereof
US8529898B2 (en) 2007-08-22 2013-09-10 The Regents Of The University Of California Activatable binding polypeptides and methods of identification and use thereof
US8518404B2 (en) 2007-08-22 2013-08-27 The Regents Of The University Of California Activatable binding polypeptides and methods of identification and use thereof
US9169321B2 (en) 2007-08-22 2015-10-27 The Regents Of The University Of California Activatable binding polypeptides and methods of identification and use thereof
WO2009046541A1 (en) 2007-10-11 2009-04-16 University Health Network MODULATION OF SIRPα - CD47 INTERACTION FOR INCREASING HUMAN HEMATOPOIETIC STEM CELL ENGRAFTMENT AND COMPOUNDS THEREFOR
JP2011500005A (en) 2007-10-11 2011-01-06 ユニバーシティー ヘルス ネットワーク Modulation of SIRPα-CD47 interaction to increase human hematopoietic stem cell engraftment and compounds therefor
US20100239578A1 (en) 2007-10-11 2010-09-23 University Health Network Modulation of sirp-alpha - cd47 interaction for increasing human hematopoietic stem cell engraftment and compounds therefor
US20140024111A1 (en) 2008-01-07 2014-01-23 Amgen Inc. Host cell for making antibody fc-heterodimeric molecules using electrostatic steering effects
WO2009091601A1 (en) 2008-01-15 2009-07-23 The Board Of Trustees Of The Leland Stanford Junior University Methods for manipulating phagocytosis mediated by cd47
US8562997B2 (en) 2008-01-15 2013-10-22 The Board Of Trustees Of The Leland Stanford Junior University Methods of treating acute myeloid leukemia by blocking CD47
US8728476B2 (en) 2008-04-23 2014-05-20 Stichting Sanquin Bloedvoorziening Compositions and methods to enhance the immune system
US9352037B2 (en) 2008-04-23 2016-05-31 Stichting Sanquin Bloedvoorziening Compositions and methods to enhance the immune system
US20170044258A1 (en) 2008-04-23 2017-02-16 Stichting Sanquin Bloedvoorziening Compositions and methods to enhance the immune system
WO2009131453A1 (en) 2008-04-23 2009-10-29 Stichting Sanquin Bloedvoorziening Compositions and methods to enhance the immune system.
US20160244522A1 (en) 2008-04-23 2016-08-25 Stichting Sanquin Bloedvoorziening Compositions and methods to enhance the immune system
WO2010070047A1 (en) 2008-12-19 2010-06-24 Novartis Ag Soluble polypeptides for use in treating autoimmune and inflammatory disorders
US20110237498A1 (en) 2008-12-19 2011-09-29 Novartis Ag Soluble polypeptides for use in treating autoimmune and inflammatory disorders
CN102257001A (en) 2008-12-19 2011-11-23 诺瓦提斯公司 soluble polypeptides for use in treating autoimmune and inflammatory disorders
US20100189651A1 (en) 2009-01-12 2010-07-29 Cytomx Therapeutics, Llc Modified antibody compositions, methods of making and using thereof
US8993266B2 (en) 2009-02-23 2015-03-31 Cytomx Therapeutics, Inc. Proproteins activatable interferon alpha
WO2010096838A2 (en) 2009-02-23 2010-08-26 Cytomx Therapeutics, Llc Proproteins and methods of use thereof
US8399219B2 (en) 2009-02-23 2013-03-19 Cytomx Therapeutics, Inc. Protease activatable interferon alpha proprotein
US20150203559A1 (en) 2009-02-23 2015-07-23 Cytomx Therapeutics, Inc. Proproteins and methods of use thereof
CN107252476A (en) 2009-05-15 2017-10-17 大学健康网络 Compound is used to treat the CD47+ cancer cells in patient's body or the purposes of tumour
CN102596233A (en) 2009-05-15 2012-07-18 大学健康网络 Compositions and methods for targeting the SIRPα-CD47 interaction to treat hematological cancers
US20190093174A1 (en) 2009-05-15 2019-03-28 The Hospital For Sick Children Compositions and methods for treating hematological cancers targeting the sirpalpha cd47 interaction
EP2429574B1 (en) 2009-05-15 2015-05-06 University Health Network Compositions and methods for treating hematologic cancers targeting the sirp - cd47 interaction
US10907209B2 (en) 2009-05-15 2021-02-02 University Health Network Compositions and methods for treating hematological cancers targeting the SIRPα CD47 interaction
US20120189625A1 (en) 2009-05-15 2012-07-26 University Health Network Compositions and Methods for Treating Hematological Cancers Targeting the SIRPA CD47 Interaction
WO2010130053A1 (en) 2009-05-15 2010-11-18 University Health Network COMPOSITIONS AND METHODS FOR TREATING HEMATOLOGIC CANCERS TARGETING THE SIRPα - CD47 INTERACTION
JP2012533631A (en) 2009-07-20 2012-12-27 國立成功大學 Polypeptides selective for αvβ3 integrin conjugated to a variant of human serum albumin (HSA) and pharmaceutical use thereof
WO2011011315A1 (en) 2009-07-20 2011-01-27 National Cheng Kung University POLYPEPTIDES SELECTIVE FOR AV β3 INTEGRIN CONJUGATED WITH A VARIANT OF HUMAN SERUM ALBUMIN (HSA) AND PHARMACEUTICAL USES THEREOF
US20120283408A1 (en) 2009-11-03 2012-11-08 Samsung Electronic Co., Ltd. Fusion protein binding specifically to constant region of antibody, method of preparing the fusion protein, and method of isolating antibody using the fusion protein
WO2011066501A1 (en) 2009-11-30 2011-06-03 Centocor Ortho Biotech Inc. Antibody fc mutants with ablated effector functions
CN102939303A (en) 2009-12-22 2013-02-20 诺瓦提斯公司 Tetravalent cd47-antibody constant region fusion protein for use in therapy
WO2011076781A1 (en) 2009-12-22 2011-06-30 Novartis Ag Tetravalent cd47-antibody constant region fusion protein for use in therapy
US20130011401A1 (en) 2009-12-22 2013-01-10 Novartis Ag Soluble proteins for use as therapeutics
US9017675B2 (en) 2010-05-14 2015-04-28 The Board Of Trustees Of The Leland Sanford Junior University Humanized and chimeric monoclonal antibodies to CD47
US20160304609A1 (en) 2010-05-14 2016-10-20 The Board Of Trustees Of The Leland Stanford Junior University Humanized and chimeric monoclonal antibodies to cd47
WO2011143624A2 (en) 2010-05-14 2011-11-17 The Board Of Trustees Of The Leland Stanford Junior University Humanized and chimeric monoclonal antibodies to cd47
US9382320B2 (en) 2010-05-14 2016-07-05 The Board Of Trustees Of The Leland Stanford Junior University Humanized and chimeric monoclonal antibodies to CD47
JP2013541542A (en) 2010-10-08 2013-11-14 シー. ウィリアムズ,ジョン Monoclonal antibody framework binding interface for meditope, meditope delivery system, and uses thereof
WO2012048332A2 (en) 2010-10-08 2012-04-12 John Williams A monoclonal antibody framework binding interface for meditopes, meditope delivery systems and methods for their use
US8748399B2 (en) 2010-11-15 2014-06-10 E I Du Pont De Nemours And Company Acid-cleavable linkers exhibiting altered rates of acid hydrolysis
US20140140926A1 (en) 2011-02-07 2014-05-22 The Trustees Of The University Of Pennsylvania Novel Peptides and Methods Using Same
WO2012130831A1 (en) 2011-03-29 2012-10-04 Roche Glycart Ag Antibody fc variants
WO2012142515A2 (en) 2011-04-13 2012-10-18 Bristol-Myers Squibb Company Fc fusion proteins comprising novel linkers or arrangements
US20140161800A1 (en) 2011-04-22 2014-06-12 John W. Blankenship Prostate-Specific Membrane Antigen Binding Proteins and Related Compositions and Methods
WO2012172521A1 (en) 2011-06-16 2012-12-20 Novartis Ag Soluble proteins for use as therapeutics
US20140193408A1 (en) 2011-06-16 2014-07-10 Novartis Ag Soluble proteins for use as therapeutics
CN103635490A (en) 2011-06-16 2014-03-12 诺瓦提斯公司 Soluble proteins for use as therapeutics
WO2013032948A1 (en) 2011-08-26 2013-03-07 The University Of North Carolina At Chapel Hill Method for inhibiting cellular activation by insulin-like growth factor-1
US20140242095A1 (en) 2011-10-19 2014-08-28 University Health Network Antibodies and antibody fragments targeting sirp-alpha and their use in treating hematologic cancers
WO2013063076A1 (en) 2011-10-25 2013-05-02 Indiana University Research & Technology Corporation Compositions for and methods of modulating complications, risks and issues with xenotransplantation
US20150071905A1 (en) 2012-01-17 2015-03-12 The Board Of Trustees Of The Leland Stanford Junior University High Affinity Sirp-Alpha Reagents
JP2015504899A (en) 2012-01-17 2015-02-16 ザ ボード オブ トラスティーズ オブ ザ レランド スタンフォード ジュニア ユニバーシティー High affinity SIRP-alpha reagent
US9944911B2 (en) 2012-01-17 2018-04-17 The Board Of Trustees Of The Leland Stanford Junior University High affinity Sirp-alpha reagents and methods of using
US20220064293A1 (en) 2012-01-17 2022-03-03 The Board Of Trustees Of The Leland Stanford Junior University High affinity sirp-alpha reagents and methods of using
US20180195054A1 (en) 2012-01-17 2018-07-12 The Board Of Trustees Of The Leland Stanford Junior University High affinity sirp-alpha reagents and methods of using
US11208481B2 (en) 2012-01-17 2021-12-28 The Board Of Trustees Of The Leland Stanford Junior University High affinity SIRP-alpha reagents and methods of using
WO2013109752A1 (en) 2012-01-17 2013-07-25 The Board Of Trustees Of The Leland Stanford Junior University High affinity sirp-alpha reagents
US20140113348A1 (en) 2012-02-10 2014-04-24 City Of Hope Meditopes and meditope-binding antibodies and uses thereof
US20140023664A1 (en) 2012-06-22 2014-01-23 Cytomx Therapeutics, Inc. Activatable Antibodies Having Non-Binding Steric Moieties and Methods of Using the Same
US20140010810A1 (en) 2012-06-22 2014-01-09 Cytomx Therapeutics, Inc. Anti-Jagged 1/Jagged 2 Cross-Reactive Antibodies, Activatable Anti-Jagged Antibodies And Methods Of Use Thereof
WO2014045022A2 (en) 2012-09-18 2014-03-27 The University Of Birmingham Agents and methods
CN104812413A (en) 2012-09-18 2015-07-29 伯明翰大学 Agents and methods
US20150329616A1 (en) 2012-12-17 2015-11-19 Trillium Therapeutics Inc. Treatment of CD47+ Disease Cells with SIRP Alpha-FC Fusions
WO2014094122A1 (en) 2012-12-17 2014-06-26 Trillium Therapeutics Inc. Treatment of cd47+ disease cells with sirp alpha-fc fusions
US20150353642A1 (en) 2013-01-31 2015-12-10 Thomas Jefferson University Fusion proteins that facilitate cancer cell destruction
WO2014121093A1 (en) 2013-01-31 2014-08-07 Thomas Jefferson University Fusion proteins that facilitate cancer cell destruction
WO2014124028A1 (en) 2013-02-05 2014-08-14 Weiskopf Kipp Cd47 targeted therapies for the treatment of infectious disease
US20150376288A1 (en) 2013-02-05 2015-12-31 The Board Of Trustees Of The Leland Stanford Junior University CD47 Targeted Therapies for the Treatment of Infectious Disease
WO2014160183A1 (en) 2013-03-13 2014-10-02 The United States Of America,As Represented By The Secretary,Department Of Health And Human Services Methods for modulating chemotherapeutic cytotoxicity
US20160045532A1 (en) 2013-03-13 2016-02-18 The United States Of America, As Represented By The Secretary, Department Of Health And Human Serv Methods for modulating chemotherapeutic cytotoxicity
WO2014149477A1 (en) 2013-03-15 2014-09-25 The Board Of Trustees Of The Leland Stanford Junior University Methods for achieving therapeutically effective doses of anti-cd47 agents
US20160008429A1 (en) 2013-03-15 2016-01-14 The Board Of Trustees Of The Leland Stanford Junior University Methods for Achieving Therapeutically Effective Doses of anti-CD47 Agents
US20160144009A1 (en) 2013-04-29 2016-05-26 The Board Of Trustees Of The Leland Stanford Junior University Use of Anti-CD47 Agents to Enhance Immunization
WO2014179132A1 (en) 2013-04-29 2014-11-06 The Board Of Trustees Of The Leland Stanford Junior University Use of anti-cd47 agents to enhance immunization
WO2014186761A2 (en) 2013-05-17 2014-11-20 The Board Of Trustes Of The Leland Stanford Junior University Methods for determining responsiveness to an anti-cd47 agent
US20160069898A1 (en) 2013-05-17 2016-03-10 The Board Of Trustees Of The Leland Stanford Junior University Methods for Determining Responsiveness to an Anti-CD47 Agent
US20160193295A1 (en) 2013-07-31 2016-07-07 Amgen Inc. Stabilization of fc-containing polypeptides
WO2015041987A1 (en) 2013-09-18 2015-03-26 The Board Of Trustees Of The Leland Stanford Junior University Modulation of efferocytosis pathways for treatment of atherosclerotic disease
US20160194406A1 (en) 2013-09-18 2016-07-07 The Board Of Trustees Of The Leland Stanford Junior University Modulation of efferocytosis pathways for treatment of atherosclerotic disease
WO2015042557A1 (en) 2013-09-23 2015-03-26 Regeneron Pharmaceuticals, Inc. Non-human animals having a humanized signal-regulatory protein gene
WO2015048329A2 (en) 2013-09-25 2015-04-02 Cytomx Therapeutics, Inc. Matrix metalloproteinase substrates and other cleavable moieties and methods of use thereof
WO2015057834A1 (en) 2013-10-15 2015-04-23 The California Institute For Biomedical Research Peptidic chimeric antigen receptor t cell switches and uses thereof
WO2015116933A2 (en) 2014-01-31 2015-08-06 Cytomx Therapeutics, Inc. Matriptase and u-plasminogen activator substrates and other cleavable moieties and methods of use thereof
WO2017009829A1 (en) 2014-03-12 2017-01-19 Yeda Research And Development Co. Ltd At The Weizmann Institute Of Science Reducing systemic regulatory t cell levels or activity for treatment of disease and injury of the cns
US20160008463A1 (en) 2014-03-12 2016-01-14 Yeda Research And Development Co. Ltd Reducing systemic regulatory t cell levels or activity for treatment of disease and injury of the cns
US9512225B2 (en) 2014-03-12 2016-12-06 Yeda Research And Development Co. Ltd Reducing systemic regulatory T cell levels or activity for treatment of Alzheimer's disease
US9534052B2 (en) 2014-03-12 2017-01-03 Yeda Research And Development Co. Ltd Reducing systemic regulatory T cell levels or activity for treatment of Alzheimer's disease
US9394365B1 (en) 2014-03-12 2016-07-19 Yeda Research And Development Co., Ltd Reducing systemic regulatory T cell levels or activity for treatment of alzheimer's disease
US20160000909A1 (en) 2014-03-12 2016-01-07 Yeda Research And Development Co. Ltd Reducing systemic regulatory t cell levels or activity for treatment of disease and injury of the cns
US9512227B2 (en) 2014-03-12 2016-12-06 Yeda Research And Development Co. Ltd Reducing systemic regulatory T cell levels or activity for treatment of Alzheimer's disease
US20170029508A1 (en) 2014-03-12 2017-02-02 Yeda Research And Development Co. Ltd Reducing Systemic Regulatory T Cell Levels or Activity for Treatment of Disease and Injury of the CNS
WO2015136541A2 (en) 2014-03-12 2015-09-17 Yeda Research And Development Co. Ltd Reducing systemic regulatory t cell levels or activity for treatment of disease and injury of the cns
US9562087B2 (en) 2014-08-08 2017-02-07 The Board Of Trustees Of The Leland Stanford Junior University High affinity PD-1 agents and methods of use
US20200263154A1 (en) 2014-08-08 2020-08-20 ALX Oncology Inc. Sirp-alpha variant constructs and uses thereof
WO2016022971A1 (en) 2014-08-08 2016-02-11 The Board Of Trustees Of The Leland Stanford Junior University Sirp alpha-antibody fusion proteins
US20160186150A1 (en) 2014-08-08 2016-06-30 Alexo Therapeutics International Sirp-alpha variant constructs and uses thereof
US20180371435A1 (en) 2014-08-08 2018-12-27 ALX Oncology Inc. Sirp-alpha variant constructs and uses thereof
US9546206B2 (en) 2014-08-08 2017-01-17 The Board Of Trustees Of The Leland Stanford Junior University High affinity PD-1 agents and methods of use
WO2016023001A1 (en) 2014-08-08 2016-02-11 The Board Of Trustees Of The Leland Stanford Junior University Multispecific high affinity pd-1 agents and methods of use
US20210388329A1 (en) 2014-08-08 2021-12-16 ALX Oncology Inc. Sirp-alpha variant constructs and uses thereof
WO2016023040A1 (en) 2014-08-08 2016-02-11 Alexo Therapeutics International Sirp-alpha variant constructs and uses thereof
WO2016022994A2 (en) 2014-08-08 2016-02-11 The Board Of Trustees Of The Leland Stanford Junior University High affinity pd-1 agents and methods of use
WO2016024021A1 (en) 2014-08-15 2016-02-18 Merck Patent Gmbh Sirp-alpha immunoglobulin fusion proteins
US20160177276A1 (en) 2014-08-15 2016-06-23 Merck Patent Gmbh Sirp-alpha immunoglobulin fusion proteins
WO2016033201A1 (en) 2014-08-26 2016-03-03 The Board Of Trustees Of The Leland Stanford Junior University Engraftment of stem cells with a combination of an agent that targets stem cells and modulation of immunoregulatory signaling
WO2016044021A1 (en) 2014-09-15 2016-03-24 The Board Of Trustees Of The Leland Stanford Junior University Targeting aneurysm disease by modulating phagocytosis pathways
WO2016057980A1 (en) 2014-10-10 2016-04-14 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Methods to eliminate cancer stem cells by targeting cd47
WO2016063233A1 (en) 2014-10-24 2016-04-28 Effimune Method and compositions for inducing differentiation of myeloid derived suppressor cell to treat cancer and infectious diseases
WO2016065329A1 (en) 2014-10-24 2016-04-28 The Board Of Trustees Of The Leland Stanford Junior University Compositions and methods for inducing phagocytosis of mhc class i positive cells and countering anti-cd47/sirpa resistance
WO2016081423A1 (en) 2014-11-18 2016-05-26 Janssen Pharmaceutica Nv Cd47 antibodies, methods, and uses
WO2016138306A1 (en) 2015-02-27 2016-09-01 The Board Of Trustees Of The Leland Stanford Junior University Combination therapy for treatment of coronary artery disease
US20180141986A1 (en) 2015-04-24 2018-05-24 Immuneonco Biopharmaceuticals (Shanghai) Co.,Ltd Novel recombinant bi-functional fusion protein and preparation and application therefor
WO2016169261A1 (en) 2015-04-24 2016-10-27 宜明昂科生物医药技术(上海)有限公司 Novel recombinant bi-functional fusion protein and preparation and application therefor
WO2017027422A1 (en) 2015-08-07 2017-02-16 Alexo Therapeutics Inc. Constructs having a sirp-alpha domain or variant thereof
CO2018002471A2 (en) 2015-08-07 2018-05-31 Alexo Therapeutics Inc Constructs of antibodies with a sirp-alpha domain and its variants
US10696730B2 (en) 2015-08-07 2020-06-30 ALX Oncology Inc. Constructs having a SIRP-alpha domain or variant thereof
US10259859B2 (en) 2015-08-07 2019-04-16 ALX Oncology Inc. Constructs having a SIRP-α domain or variant thereof
US11208459B2 (en) 2015-08-07 2021-12-28 ALX Oncology Inc. Constructs having a SIRP-alpha domain or variant thereof
US20170107270A1 (en) 2015-08-07 2017-04-20 Alexo Therapeutics Inc. Constructs having a sirp-alpha domain or variant thereof
US20190169266A1 (en) 2015-08-07 2019-06-06 ALX Oncology Inc. Constructs having a sirp-alpha domain or variant thereof
US20210070838A1 (en) 2015-08-07 2021-03-11 ALX Oncology Inc. Constructs having a sirp-alpha domain or variant thereof
WO2017178653A2 (en) 2016-04-14 2017-10-19 Ose Immunotherapeutics NEW ANTI-SIRPa ANTIBODIES AND THEIR THERAPEUTIC APPLICATIONS
WO2018057669A1 (en) 2016-09-21 2018-03-29 Alexo Therapeutics Inc. Antibodies against signal-regulatory protein alpha and methods of use
US20220242928A1 (en) 2019-05-31 2022-08-04 ALX Oncology Inc. Methods of treating cancer
US20220213166A1 (en) 2019-05-31 2022-07-07 ALX Oncology Inc. Methods of treating cancer
US20200392199A1 (en) 2019-05-31 2020-12-17 ALX Oncology Inc. Methods of treating cancer
WO2020243338A1 (en) 2019-05-31 2020-12-03 ALX Oncology Inc. Methods of treating cancer with sirp alpha fc fusion in combination with an immune checkpoint inhibitor
US20200400662A1 (en) 2019-06-07 2020-12-24 ALX Oncology Inc. Methods and reagents for reducing the interference of drugs that bind cd47 in serological assays
WO2020247820A1 (en) 2019-06-07 2020-12-10 ALX Oncology Inc. Methods and reagents for reducing the interference of drugs that bind cd47 in serological assays
WO2021108693A1 (en) 2019-11-27 2021-06-03 ALX Oncology Inc. Combination therapies for treating cancer
US20210154269A1 (en) 2019-11-27 2021-05-27 ALX Oncology Inc. Combination therapies for treating cancer
WO2021247430A1 (en) 2020-06-01 2021-12-09 ALX Oncology Inc. Combination therapies comprising a hypomethylation agent for treating cancer
WO2022010806A1 (en) 2020-07-06 2022-01-13 ALX Oncology Inc. Methods for reducing the interference of drugs that bind therapeutic targets expressed on blood cells in serological assays
WO2022120286A1 (en) 2020-12-06 2022-06-09 ALX Oncology Inc. Multimers for reducing the interference of drugs that bind cd47 in serological assays
US20220196651A1 (en) 2020-12-06 2022-06-23 ALX Oncology Inc. Multimers for reducing the interference of drugs that bind cd47 in serological assays
WO2022241157A1 (en) 2021-05-13 2022-11-17 ALX Oncology Inc. Combination therapies for treating cancer
US20220363779A1 (en) 2021-05-13 2022-11-17 ALX Oncology Inc. Combination therapies for treating cancer

Non-Patent Citations (90)

* Cited by examiner, † Cited by third party
Title
Atwell, S. et al. (Jul. 4, 1997). "Stable heterodimers from remodeling the domain interface of a homodimer using a phage display library," J Mol. Biol. 270(1):26-35.
Barclay, A.N. et al. (Jun. 2006). "The SIRP family of receptors and immune Yegulation," Nat. Rev. Immunol. 6(6):457-464.
Borrok, M.J. et al. (epub Jul. 10, 2012). "Revisiting the role of glycosylation in the structure of human IgG Fc." ACS Chemical Biology 7(9):1596-1602.
Castañeda, L. et al. (Sep. 25, 2013). "Acid-cleavable thiomaleamic acid linker for homogeneous antibody-drug conjugation," Chem Commun (Camb). 49(74):8187-8189.
Constantinou, A. et al. (epub Feb. 29, 2008). "Modulation of antibody pharmacokinetics by chemical polysialylation," Bioconjug Chem. 19(3):643-650.
Deluca, P.P. et al. (1982). "Parenteral drug-delivery systems," Chapter 8 in Pharmaceutics and Pharmacy Practice, Banker, G.S. and Chalmers, R.K. ed., J. B. Lippincott & Co.: Philadelphia, PA, pp. 238-250.
Dennis, M.S. et al. (epub Jul. 15, 2002). "Albumin binding as a general strategy for improving the pharmacokinetics of proteins," J. Biol. Chem. 277(38):35035-35043.
Donaldson, J.M. et al. (epub Oct. 7, 2013). "Identification and grafting of a unique peptide-binding site in the Fab framework of monoclonal antibodies," Proc Natl Acad Sci USA. 110(43):17456-17461.
Duan, J.X. et al. (epub Feb. 8, 2008). "Potent and highly selective hypoxia-activated achiral phosphoramidate mustards as anticancer drugs," J. Med. Chem. 51(8):2412-2420.
Ducry, L. et al. (Jan. 2010). "Antibody-drug conjugates: linking cytotoxic payloads to monoclonal antibodies," Bioconjug Chem. 21(1):5-13.
European Search Report dated Nov. 7, 2016 for European Application No. 16183261.3, filed on Aug. 8, 2016, 14 pages.
European Search Report dated Oct. 23, 2015 for European Application No. 13738232.1, filed on Jan. 17, 2013, seven pages.
GenBank Accession No. NP_037148.2, (ROD Sep. 1, 2016, last updated Apr. 16, 2017), "tyrosine-protein phosphatase non-receptor type substrate 1 precursor [Rattus norvegicus]," located at <http://www.ncbi.nlm.nih.gov/protein/NP_037148.2>, last visited on Jun. 9, 2017, four pages.
Gentz, R. et al. (Feb. 1989). "Bioassay for trans-activation using purified human immunodeficiency virus tat-encoded protein: trans-activation requires mRNA synthesis." Proc. Natl. Acad. Sci. USA. 86(3):821-824.
Gregoriadis, G. et al. (Dec. 2000). "Polysialic acids: potential in improving the stability and pharmacokinetics of proteins and other therapeutics," Cell. Mol. Life Sci. 57(13-14):1964-1969.
Gunasekaran, K. et al. (epub Apr. 16, 2010). "Enhancing antibody Fc heterodimer formation through electrostatic steering effects: applications to bispecific molecules and monovalent IgG," J Biol Chem. 285(25):19637-19646.
Hanes, J. et al. (Oct. 1997). "New advances in microsphere-based single-dose vaccines," Advanced Drug Delivery Reviews 28(1):97-119.
Hatherley, D. et al. (epub Jul. 23, 2009). "Structure of signal-regulatory protein alpha: a link to antigen receptor evolution," J Biol Chem. 284(39):26613-26619.
Hatherley, D. et al. (epub Mar. 16, 2007). "The structure of the macrophage signal regulatory protein alpha (SIRPalpha) inhibitory receptor reveals a binding face reminiscent of that used by T cell receptors." J Biol Chem. 282(19):14567-14575.
Hatherley, D. et al. (Jul. 25, 2008). "Paired receptor specificity explained by structures of signal regulatory proteins alone and complexed with CD47," Mol. Cell. 31(2):266-277.
Hezareh et al. (2001) "Effector function activities of a panel of mutants of a broadly neutralizing antibody against human immunodeficiency virus type 1," J Virol., 75(24):12161-8.
Ho et al. (2015). "‘Velcro’ Engineering of High Affinity CD47 Ectodomain as Signal Regulatory Protein α (SIRPα) Antagonists That Enhance Antibody-Dependent Cellular Phagocytosis," J Biol Chem, 290(20):12650-63.
Icard, P. et al. (epub Jul. 25, 2012). "A global view of the biochemical pathways involved in the regulation of the metabolism of cancer cells," Biochim Biophys Acta. 1826(2):423-433.
International Preliminary Report on Patentability dated Feb. 23, 2017 for PCT Application No. PCT/US2015/044528, filed on Aug. 10, 2015, 11 pages.
International Preliminary Report on Patentability dated Jan. 24, 2017, for PCT Application No. PCT/US2016/045914, filed on Aug. 5, 2016, 20 pages.
International Preliminary Report on Patentability dated Jul. 31, 2014 for PCT Application No. PCT/US2013/021937, filed on Jan. 17, 2013, 7 pages.
International Search Report dated Dec. 22, 2015 for PCT Application No. PCT/US2015/044528, filed on Aug. 10, 2015, four pages.
International Search Report dated Jan. 24, 2017, for PCT Application No. PCT/US2016/045914, filed on Aug. 5, 2016, six pages.
International Search Report dated May 21, 2013, for PCT Application No. PCT/US2013/021937, filed on Jan. 17, 2013, five pages.
Jawa, V. et al. (epub Sep. 25, 2013). "T-cell dependent immunogenicity of protein therapeutics: Preclinical assessment and mitigation," Clin Immunol. 149(3):534-555.
Judd, R.C. (Aug. 1982). "Surface peptide mapping of protein I and protein III of four strains of Neisseria gonorrhoeae," Infect Immun. 37(2):632-641.
Kabat, E.A. et al. (1991). Sequences of proteins of immunological interest, 5th ed. U.S. Dept. of Health and Human Services, Public Health Service, National Institutes of Health: Bethesda, MD.
Kharitonenkov, A. et al., "A family of proteins that inhibit signalling through tyrosine kinase receptors," Nature (Mar. 13, 1997), 386(6621):181-186.
Kim et al. (2019). "A Phase 1 Study of ALX148, a CD47 Blocker, in Combination with Rituximab in Patients with Non-Hodgkin Lymphoma," Blood, 134, Supplement_1, Abstract #1953.
Kling, J. (May 7, 2012). "Hypoxia-activated prodrugs forge ahead in cancer," Nature Biotechnology 30(5):381.
Koblinski, J.E. et al. (Feb. 2000). "Unraveling the role of proteases in cancer," Clin Chim Acta. 291(2):113-135.
Kwon, E.D. et al. (Dec. 21, 1999). "Elimination of residual metastatic prostate cancer after surgery and adjunctive cytotoxic T lymphocyte-associated antigen 4 (CTLA-4) blockade immunotherapy," Proc. Natl. Acad. Sci. USA. 96(26):15074-15079.
La Rocca, G. et al. (Apr. 5, 2004). "Zymographic detection and clinical correlations of MMP-2 and MMP-9 in breast cancer sera," Br J Cancer. 90(7):1414-1421.
Langer, R. (Sep. 28, 1990). "New methods of drug delivery," Science 249(4976):1527-1533.
LeBeau, A.M. et al. (2013, epub Dec. 17, 2012). "Imaging a functional tumorigenic biomarker in the transformed epithelium," Proc. Natl. Acad. Sci. USA 110(1):93-98.
Lee, W.Y. et al. (Dec. 1, 2007). "Novel structural determinants on SIRP alpha that mediate binding to CD47," The Journal of Immunology 179(11):7741-7750.
Lee, W.Y. et al. (epub Sep. 7, 2010). "The role of cis dimerization of signal regulatory protein alpha (SIRPalpha) in binding to CD47," J Biol Chem. 285(49):37953-37963.
Lin, Y. et al. (epub Jul. 17, 2012). "Soluble extracellular domains of human SIRPα and CD47 expressed in Escherichia coli enhances the phagocytosis of leukemia cells by macrophages in vitro," Protein Expr Purif. 85(1):109-116.
Liu, C. et al. (Jun. 1, 2003). "Overexpression of legumain in tumors is significant for invasion/metastasis and a candidate enzymatic target for prodrug therapy," Cancer Res. 63(11):2957-2964.
Liu, Y. et al. (2007, epub Oct. 3, 2006). "Functional elements on SIRPalpha IgV domain mediate cell surface binding to CD47," Journal of Molecular Biology 365(3):680-693.
Liu, Y. et al. (Feb. 15, 2004). "Peptide-mediated inhibition of neutrophil transmigration by blocking CD47 interactions with signal regulatory protein alpha," J Immunol. 172 (4) 2578-2585.
Martens, T. et al. (Oct. 15, 2006). "A novel one-armed anti-c-Met antibody inhibits glioblastoma growth in vivo," Clin Cancer Res. 12(20 Pt 1):6144-6152.
Merchant, A.M. et al. (Jul. 1998). "An efficient route to human bispecific IgG," Nat Biotechnol. 16(7):677-681.
Merchant, M. et al. (epub Jul. 23, 2013). "Monovalent antibody design and mechanism of action of onartuzumab, a MET antagonist with anti-tumor activity as a therapeutic agent," Proc. Natl. Acad. Sci. USA. 110(32):E2987-E2996.
Milla, P. et al. (Jan. 2012). "PEGylation of proteins and liposomes: a powerful and flexible strategy to improve the drug delivery," Curr Drug Metab. 13(1):105-119.
Miyakawa, N. et al. (epub Mar. 5, 2013). "Gene delivery of albumin binding peptide-interferon-gamma fusion protein with improved pharmacokinetic properties and sustained biological activity," J. Pharm. Sci. 102(9):3110-3118.
Nakaishi, A. et al. (2008, epub Nov. 7, 2007). "Structural insight into the specific interaction between murine SHPS-1/SIRP alpha and its ligand CD47," J Mol Biol. 375(3):650-660.
Oldenborg, P.A. et al. (Jun. 16, 2000). "Role of CD47 as a marker of self on red blood cells," Science 288(5473):2051-2054.
Ridgway, J.B. et al. (Jul. 1996). "‘Knobs-into-holes’ engineering of antibody CH3 domains for heavy chain heterodimerization," Protein Eng. 9(7):617-621.
Rudikoff et al. (1982). "Single amino acid substitution altering antigen-binding specificity," Immunology, vol. 79, pp. 1979-1983.
Sazinsky et al. (2008). "Aglycosylated immunoglobulin G1 variants productively engage activating Fc receptors," Proc Natl Acad Sci U S A, 105(51): 20167-20172.
Schellenberger, V. et al. (Dec. 2009). "A recombinant polypeptide extends the in vivo half-life of peptides and proteins in a tunable manner," Nat. Biotechnol. 27(12):1186-1190.
Schlapschy, M. et al. (epub Jun. 10, 2013). "PASylation: a biological alternative to PEGylation for extending the plasma half-life of pharmaceutically active proteins," Protein Eng Des Sel. 26(8):489-501.
Shigenaga, A. et al. (epub Apr. 13, 2012). "Development of a reduction-responsive amino acid that induces peptide bond cleavage in hypoxic cells," Chembiochem. 13(7):968-971.
Sim et al., (2019). "Discovery of high affinity, pan-allelic, and pan-mammalian reactive antibodies against the myeloid checkpoint receptor SIRPα," mAbs, 11(6): 1-17.
Strauch, E.M. et al. (2014, epub Dec. 31, 2013). "Computational design of a pH-sensitive IgG binding protein," Proc Natl Acad Sci USA. 111(2):675-680.
Subramanian, S. et al. (2007, epub Nov. 10, 2006). "Phylogenetic divergence of CD47 interactions with human signal regulatory protein alpha reveals locus of species specificity. Implications for the binding site," J Biol Chem. 282(3):1805-1818.
Takenaka, K. et al. (epub Nov. 4, 2007). "Polymorphism in SIRPα modulates engraftment of human hematopoietic stem cells," Nat Immunol. 8(12):1313-1323.
Trissel, L.A. (1986). Handbook on Injectable Drugs, 4th ed., ASHP: Bethesda, MD, pp. 622-630.
Trüssel, S. et al. (Dec. 2009). "New strategy for the extension of the serum half-life of antibody fragments," Bioconjug Chem. 20(12):2286-2292.
Tsai, R.K. et al. (epub Mar. 17, 2010). "Self inhibition of phagocytosis: the affinity of ‘marker of self’ CD47 for SIRPalpha dictates potency of inhibition but only at low expression levels," Blood Cells Mol Dis. 45(1):67-74.
U.S. Appl. No. 15/955,640, filed Apr. 17, 2018, for Deming et al. (Copy not submitted herewith pursuant to the waiver of 37 C.F.R. § 1.98(a)(2)(iii) issued by the Office Sep. 21, 2004).
U.S. Appl. No. 16/153,404, filed on Oct. 5, 2018, for Pons et al. (Copy not submitted herewith pursuant to the waiver of 37 C.F.R. § 1.98(a)(2)(iii) issued by the Office Sep. 21, 2004).
U.S. Appl. No. 16/659,376, filed Mar. 20, 2020 for Pons et al. (Copy not submitted herewith pursuant to the waiver of 37 C.F.R. § 1.98(a)(2)(iii) issued by the Office Sep. 21, 2004).
U.S. Appl. No. 16/659,376, filed Oct. 21, 2019, for Deming et al. (Copy not submitted herewith pursuant to the waiver of 37 C.F.R. § 1.98(a)(2)(iii) issued by the Office Sep. 21, 2004).
U.S. Appl. No. 16/825,850, filed Mar. 20, 2020 for Pons et al. (Copy not submitted herewith pursuant to the waiver of 37 C.F.R. § 1.98(a)(2)(iii) issued by the Office Sep. 21, 2004).
U.S. Appl. No. 16/825,850, filed Oct. 21, 2019, for Deming et al. (Copy not submitted herewith pursuant to the waiver of 37 C.F.R. § 1.98(a)(2)(iii) issued by the Office Sep. 21, 2004).
U.S. Appl. No. 16/886,559, filed May 28, 2020 for Pons et al. (Copy not submitted herewith pursuant to the waiver of 37 C.F.R. § 1.98(a)(2)(iii) issued by the Office Sep. 21, 2004).
U.S. Appl. No. 16/894,468, filed Jun. 5, 2020 for Wan et al. (Copy not submitted herewith pursuant to the waiver of 37 C.F.R. § 1.98(a)(2)(iii) issued by the Office Sep. 21, 2004).
U.S. Appl. No. 17/105,353, filed Nov. 25, 2020 for Wan et al. (Copy not submitted herewith pursuant to the waiver of 37 C.F.R. § 1.98(a)(2)(iii) issued by the Office Sep. 21, 2004).
U.S. Appl. No. 17/164,716, filed Feb. 1, 2021 for Deming et al. (Copy not submitted herewith pursuant to the waiver of 37 C.F.R. § 1.98(a)(2)(iii) issued by the Office Sep. 21, 2004).
U.S. Appl. No. 17/334,151, filed May 28, 2021 for Pons et al., titled "Combination Therapies Comprising a Hypomethylation Agent for Treating Cancer," (Copy not submitted herewith pursuant to the waiver of 37 C.F.R. § 1.98(a)(2)(iii) issued by the Office Sep. 21, 2004).
U.S. Appl. No. 17/743,350, filed May 12, 2022 for Wan et al., titled "Combination Therapies for Treating Cancer," (Copy not submitted herewith pursuant to the waiver of 37 C.F.R. § 1.98(a)(2)(iii) issued by the Office Sep. 21, 2004).
U.S. Appl. No. 17/932,180, filed Sep. 14, 2022 for Deming et al., titled "SIRP-Alpha Variant Constructs and Uses Thereof," (Copy not submitted herewith pursuant to the waiver of 37 C.F.R. § 1.98(a)(2)(iii) issued by the Office Sep. 21, 2004).
U.S. Appl. No. 18/154,380, filed Jan. 13, 2023, for Wan et al. (Copy not submitted herewith pursuant to the waiver of 37 C.F.R. § 1.98(a)(2)(iii) issued by the Office Sep. 21, 2004).
Uhland, K. (Dec. 2006). "Matriptase and its putative role in cancer," Cell Mol Life Sci. 63(24):2968-2978.
Ulisse, S. et al. (Feb. 2009). "The urokinase plasminogen activator system: a target for anti-cancer therapy," Curr Cancer Drug Targets. 9(1):32-71.
Wan et al. (2019). "Pharmacodynamic Biomarker Characterization of ALX148, a CD47 Blocker, in Combination with Established Anticancer Antibodies in Patients with Advanced Malignancy," Society for Immunotherapy of Cancer (SITC), Abstract #P449.
Weiskopf, K. et al. (epub May 30, 2013). "Engineered SIRPα variants as immunotherapeutic adjuvants to anticancer antibodies," Science 341(6141):88-91.
Wilson, I. et al. (Jul. 1984). "The structure of an antigenic determinant in a protein," Cell 37(3):767-778.
Written Opinion dated Dec. 22, 2015 for PCT Application No. PCT/US2015/044528, filed on Aug. 10, 2015, nine pages.
Written Opinion dated Jan. 24, 2017 for PCT Application No. PCT/US2016/045914, filed on Aug. 5, 2016, 19 pages.
Written Opinion of the International Searching Authority dated May 21, 2013 for PCT Application No. PCT/US2013/021937, filed on Jan. 17, 2013, five pages.
Yamao, T. et al. (Feb. 3, 1997). "Mouse and human SHPS-1: molecular cloning of cDNAs and chromosomal localization of genes," Biochem Biophys Res Commun. 231(1):61-67.
Zhao, X.W. et al. (epub Oct. 31, 2011). "CD47-signal regulatory protein-α (SIRPα) interactions form a barrier for antibody-mediated tumor cell destruction," Proc Natl Acad Sci USA. 108(45):18342-18347.

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12527838B2 (en) 2019-11-27 2026-01-20 ALX Oncology Inc. Combination therapies comprising an agent that blocks the interaction between CD47 and SIRPα for treating gastric or gastroesphageal junction cancel
US12343377B2 (en) 2020-06-01 2025-07-01 ALX Oncology Inc. Combination therapies comprising a hypomethylation agent for treating cancer
US12098214B2 (en) 2021-05-13 2024-09-24 ALX Oncology Inc. Combination therapies for treating cancer

Also Published As

Publication number Publication date
MX2022010803A (en) 2022-09-27
HUE055139T2 (en) 2021-11-29
US11208459B2 (en) 2021-12-28
PT3331902T (en) 2021-07-26
RU2018108103A (en) 2019-09-09
US20170107270A1 (en) 2017-04-20
US20210070838A1 (en) 2021-03-11
US20240343778A1 (en) 2024-10-17
RU2018108103A3 (en) 2019-12-20
SA518390881B1 (en) 2021-11-14
ZA202000743B (en) 2022-07-27
GEAP202114720A (en) 2021-06-10
NZ778013A (en) 2025-02-28
PH12018500269B1 (en) 2023-10-20
SG10202101909RA (en) 2021-04-29
MX2018001428A (en) 2018-09-05
GEP20217326B (en) 2021-11-25
HK1257372A1 (en) 2019-10-18
IL256989A (en) 2018-03-29
CL2020000531A1 (en) 2020-07-10
EP3331902B1 (en) 2021-04-28
GEAP202215294A (en) 2022-07-11
HRP20211167T1 (en) 2021-10-15
RU2020143675A3 (en) 2021-10-29
MY185014A (en) 2021-04-30
EP3913051A1 (en) 2021-11-24
US10259859B2 (en) 2019-04-16
AU2016304794A1 (en) 2018-02-01
SG10201912905VA (en) 2020-02-27
ES2881771T3 (en) 2021-11-30
EP3331902A4 (en) 2019-04-03
JP2025069164A (en) 2025-04-30
AU2016304794B2 (en) 2021-07-15
CN117777267A (en) 2024-03-29
SMT202100424T1 (en) 2021-09-14
CN117964732A (en) 2024-05-03
CL2018000340A1 (en) 2018-05-11
ZA201800857B (en) 2020-10-28
NZ738950A (en) 2023-03-31
CO2018002471A2 (en) 2018-05-31
JP2021063082A (en) 2021-04-22
KR102855748B1 (en) 2025-09-09
ZA202001863B (en) 2023-12-20
EP3331902A1 (en) 2018-06-13
RU2740672C2 (en) 2021-01-19
IL302491A (en) 2023-06-01
IL256989B (en) 2022-08-01
AU2021218004B2 (en) 2023-06-15
RU2020143675A (en) 2021-05-26
JP6898303B2 (en) 2021-07-07
GEP20227447B (en) 2022-12-12
RS62151B1 (en) 2021-08-31
KR20250133806A (en) 2025-09-08
PE20180778A1 (en) 2018-05-07
WO2017027422A1 (en) 2017-02-16
JP2023061969A (en) 2023-05-02
CL2020000530A1 (en) 2020-07-10
US10696730B2 (en) 2020-06-30
LT3331902T (en) 2021-08-10
SI3331902T1 (en) 2021-09-30
CN108350048A (en) 2018-07-31
UA130083C2 (en) 2025-11-05
CY1124372T1 (en) 2022-07-22
JP7843876B2 (en) 2026-04-10
CA2993835A1 (en) 2017-02-16
US20200239543A1 (en) 2020-07-30
BR112018001353A2 (en) 2018-09-11
CN108350048B (en) 2024-02-09
US20190169266A1 (en) 2019-06-06
UA125638C2 (en) 2022-05-11
JP7591917B2 (en) 2024-11-29
IL294679A (en) 2022-09-01
AU2021218004A1 (en) 2021-09-09
IL294679B2 (en) 2023-10-01
KR20180028548A (en) 2018-03-16
PL3331902T3 (en) 2021-11-22
DK3331902T3 (en) 2021-07-26
IL294679B1 (en) 2023-06-01
PH12018500269A1 (en) 2018-08-29
JP2018525382A (en) 2018-09-06
MX395275B (en) 2025-03-25

Similar Documents

Publication Publication Date Title
US20240343778A1 (en) Constructs having a sirp-alpha domain or variant thereof
AU2015303135B2 (en) SIRP-alpha immunoglobulin fusion proteins
IL318888A (en) D-domain containing polypeptides and uses thereof
TW202128758A (en) Multispecific fusion protein and use thereof
HK40064097A (en) Constructs having a sirp-alpha domain or variant thereof
HK40108172A (en) Constructs having a sirp-alpha domain or variant thereof
BR112018001353B1 (en) A polypeptide comprising a D1 variant of signaling regulatory protein A (SIRP-A) and an FC variant, its production method and uses, host cell, and pharmaceutical composition.
HK1257372B (en) Constructs having a sirp-alpha domain or variant thereof

Legal Events

Date Code Title Description
FEPP Fee payment procedure

Free format text: ENTITY STATUS SET TO UNDISCOUNTED (ORIGINAL EVENT CODE: BIG.); ENTITY STATUS OF PATENT OWNER: LARGE ENTITY

AS Assignment

Owner name: ALEXO THERAPEUTICS INC., CALIFORNIA

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:PONS, JAUME;DEMING, LAURA;GOODMAN, COREY;AND OTHERS;SIGNING DATES FROM 20160809 TO 20160823;REEL/FRAME:051625/0318

AS Assignment

Owner name: ALX ONCOLOGY INC., CALIFORNIA

Free format text: CHANGE OF NAME;ASSIGNOR:ALEXO THERAPEUTICS INC.;REEL/FRAME:052119/0743

Effective date: 20180619

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION MAILED

STPP Information on status: patent application and granting procedure in general

Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER

STPP Information on status: patent application and granting procedure in general

Free format text: FINAL REJECTION MAILED

STCV Information on status: appeal procedure

Free format text: NOTICE OF APPEAL FILED

STPP Information on status: patent application and granting procedure in general

Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION MAILED

STCF Information on status: patent grant

Free format text: PATENTED CASE

CC Certificate of correction