RU2812859C1 - Method of differentiating arriah-g333 genome of genetically modified strain from pb-97 vaccine strain of rabies virus using real-time polymerase chain reaction with high-resolution peak analysis - Google Patents
Method of differentiating arriah-g333 genome of genetically modified strain from pb-97 vaccine strain of rabies virus using real-time polymerase chain reaction with high-resolution peak analysis Download PDFInfo
- Publication number
- RU2812859C1 RU2812859C1 RU2023121314A RU2023121314A RU2812859C1 RU 2812859 C1 RU2812859 C1 RU 2812859C1 RU 2023121314 A RU2023121314 A RU 2023121314A RU 2023121314 A RU2023121314 A RU 2023121314A RU 2812859 C1 RU2812859 C1 RU 2812859C1
- Authority
- RU
- Russia
- Prior art keywords
- arriah
- strain
- analysis
- rabies virus
- genome
- Prior art date
Links
- 241000711798 Rabies lyssavirus Species 0.000 title claims abstract description 78
- 238000004458 analytical method Methods 0.000 title claims abstract description 73
- 238000000034 method Methods 0.000 title claims abstract description 70
- 229960005486 vaccine Drugs 0.000 title claims abstract description 54
- 238000003753 real-time PCR Methods 0.000 title claims abstract description 25
- 238000003752 polymerase chain reaction Methods 0.000 claims abstract description 18
- 239000003155 DNA primer Substances 0.000 claims abstract description 11
- 238000004519 manufacturing process Methods 0.000 claims abstract description 9
- 238000002844 melting Methods 0.000 claims description 47
- 230000008018 melting Effects 0.000 claims description 47
- 108091093088 Amplicon Proteins 0.000 claims description 12
- 239000012634 fragment Substances 0.000 claims description 12
- 239000002299 complementary DNA Substances 0.000 claims description 10
- 230000004069 differentiation Effects 0.000 claims description 10
- 230000003321 amplification Effects 0.000 claims description 9
- 238000003199 nucleic acid amplification method Methods 0.000 claims description 9
- 230000035945 sensitivity Effects 0.000 claims description 9
- 238000006243 chemical reaction Methods 0.000 claims description 8
- 238000012360 testing method Methods 0.000 claims description 8
- 101150082239 G gene Proteins 0.000 claims description 7
- 239000000203 mixture Substances 0.000 claims description 6
- 238000011160 research Methods 0.000 claims description 6
- 238000009830 intercalation Methods 0.000 claims description 4
- 239000013641 positive control Substances 0.000 claims description 4
- 239000013642 negative control Substances 0.000 claims description 3
- 238000000605 extraction Methods 0.000 claims 1
- 230000000869 mutational effect Effects 0.000 claims 1
- 238000011161 development Methods 0.000 abstract description 6
- 239000000126 substance Substances 0.000 abstract 1
- 108020004414 DNA Proteins 0.000 description 22
- 239000013615 primer Substances 0.000 description 22
- 108090000623 proteins and genes Proteins 0.000 description 18
- 239000002773 nucleotide Substances 0.000 description 17
- 125000003729 nucleotide group Chemical group 0.000 description 17
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 12
- 230000035772 mutation Effects 0.000 description 11
- 108091006027 G proteins Proteins 0.000 description 10
- 102000030782 GTP binding Human genes 0.000 description 10
- 108091000058 GTP-Binding Proteins 0.000 description 10
- 108090000288 Glycoproteins Proteins 0.000 description 10
- 102000003886 Glycoproteins Human genes 0.000 description 10
- 102000004169 proteins and genes Human genes 0.000 description 10
- 210000002845 virion Anatomy 0.000 description 10
- 102000004389 Ribonucleoproteins Human genes 0.000 description 8
- 108010081734 Ribonucleoproteins Proteins 0.000 description 8
- 241000700605 Viruses Species 0.000 description 8
- 238000001514 detection method Methods 0.000 description 8
- 241001465754 Metazoa Species 0.000 description 7
- 239000000975 dye Substances 0.000 description 7
- 150000007523 nucleic acids Chemical class 0.000 description 7
- 102000053602 DNA Human genes 0.000 description 6
- 101710141454 Nucleoprotein Proteins 0.000 description 6
- 108091034117 Oligonucleotide Proteins 0.000 description 6
- 230000002068 genetic effect Effects 0.000 description 6
- 108020004707 nucleic acids Proteins 0.000 description 6
- 102000039446 nucleic acids Human genes 0.000 description 6
- 239000000725 suspension Substances 0.000 description 6
- 101710085938 Matrix protein Proteins 0.000 description 5
- 101710127721 Membrane protein Proteins 0.000 description 5
- 108091028043 Nucleic acid sequence Proteins 0.000 description 5
- 102000011931 Nucleoproteins Human genes 0.000 description 5
- 108010061100 Nucleoproteins Proteins 0.000 description 5
- 206010037742 Rabies Diseases 0.000 description 5
- 210000004027 cell Anatomy 0.000 description 5
- 230000018109 developmental process Effects 0.000 description 5
- 229960003127 rabies vaccine Drugs 0.000 description 5
- 239000002994 raw material Substances 0.000 description 5
- 238000003757 reverse transcription PCR Methods 0.000 description 5
- 238000013518 transcription Methods 0.000 description 5
- 230000035897 transcription Effects 0.000 description 5
- 101001065501 Escherichia phage MS2 Lysis protein Proteins 0.000 description 4
- 241000711828 Lyssavirus Species 0.000 description 4
- 102100034574 P protein Human genes 0.000 description 4
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 4
- 230000000890 antigenic effect Effects 0.000 description 4
- 238000003556 assay Methods 0.000 description 4
- 230000015572 biosynthetic process Effects 0.000 description 4
- 210000000170 cell membrane Anatomy 0.000 description 4
- 238000003205 genotyping method Methods 0.000 description 4
- 238000002360 preparation method Methods 0.000 description 4
- 238000006467 substitution reaction Methods 0.000 description 4
- 108060003393 Granulin Proteins 0.000 description 3
- 102000007982 Phosphoproteins Human genes 0.000 description 3
- 108010089430 Phosphoproteins Proteins 0.000 description 3
- 150000001413 amino acids Chemical group 0.000 description 3
- 238000000137 annealing Methods 0.000 description 3
- 230000027455 binding Effects 0.000 description 3
- 238000010835 comparative analysis Methods 0.000 description 3
- 238000007405 data analysis Methods 0.000 description 3
- 239000008367 deionised water Substances 0.000 description 3
- 229910021641 deionized water Inorganic materials 0.000 description 3
- 238000004925 denaturation Methods 0.000 description 3
- 230000036425 denaturation Effects 0.000 description 3
- 238000012544 monitoring process Methods 0.000 description 3
- 230000010076 replication Effects 0.000 description 3
- 238000002255 vaccination Methods 0.000 description 3
- 230000001018 virulence Effects 0.000 description 3
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Chemical compound O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 3
- 239000004475 Arginine Substances 0.000 description 2
- 108091026890 Coding region Proteins 0.000 description 2
- 241000710198 Foot-and-mouth disease virus Species 0.000 description 2
- 239000000232 Lipid Bilayer Substances 0.000 description 2
- TWRXJAOTZQYOKJ-UHFFFAOYSA-L Magnesium chloride Chemical compound [Mg+2].[Cl-].[Cl-] TWRXJAOTZQYOKJ-UHFFFAOYSA-L 0.000 description 2
- 108060004795 Methyltransferase Proteins 0.000 description 2
- 101710181008 P protein Proteins 0.000 description 2
- 101710177166 Phosphoprotein Proteins 0.000 description 2
- 108010015724 Prephenate Dehydratase Proteins 0.000 description 2
- 108010067390 Viral Proteins Proteins 0.000 description 2
- 108020000999 Viral RNA Proteins 0.000 description 2
- 229940024606 amino acid Drugs 0.000 description 2
- 238000013459 approach Methods 0.000 description 2
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 2
- 230000008901 benefit Effects 0.000 description 2
- 239000012620 biological material Substances 0.000 description 2
- 238000012217 deletion Methods 0.000 description 2
- 230000037430 deletion Effects 0.000 description 2
- 238000002405 diagnostic procedure Methods 0.000 description 2
- 201000010099 disease Diseases 0.000 description 2
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 239000000284 extract Substances 0.000 description 2
- 230000007614 genetic variation Effects 0.000 description 2
- 239000000463 material Substances 0.000 description 2
- 239000012528 membrane Substances 0.000 description 2
- 244000005700 microbiome Species 0.000 description 2
- 210000002569 neuron Anatomy 0.000 description 2
- 230000006911 nucleation Effects 0.000 description 2
- 238000010899 nucleation Methods 0.000 description 2
- 102000054765 polymorphisms of proteins Human genes 0.000 description 2
- 230000003449 preventive effect Effects 0.000 description 2
- 238000003908 quality control method Methods 0.000 description 2
- 239000011541 reaction mixture Substances 0.000 description 2
- 238000010839 reverse transcription Methods 0.000 description 2
- 238000007480 sanger sequencing Methods 0.000 description 2
- 238000010532 solid phase synthesis reaction Methods 0.000 description 2
- 239000000243 solution Substances 0.000 description 2
- 102000040650 (ribonucleotides)n+m Human genes 0.000 description 1
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 241001466804 Carnivora Species 0.000 description 1
- 208000035473 Communicable disease Diseases 0.000 description 1
- 230000004568 DNA-binding Effects 0.000 description 1
- 108090000626 DNA-directed RNA polymerases Proteins 0.000 description 1
- 102000004163 DNA-directed RNA polymerases Human genes 0.000 description 1
- 102000014150 Interferons Human genes 0.000 description 1
- 108010050904 Interferons Proteins 0.000 description 1
- 108091029795 Intergenic region Proteins 0.000 description 1
- 101150062031 L gene Proteins 0.000 description 1
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 1
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 1
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- 241000711513 Mononegavirales Species 0.000 description 1
- 241000204025 Mycoplasma capricolum Species 0.000 description 1
- 238000010222 PCR analysis Methods 0.000 description 1
- 102000001708 Protein Isoforms Human genes 0.000 description 1
- 108010029485 Protein Isoforms Proteins 0.000 description 1
- 108010076504 Protein Sorting Signals Proteins 0.000 description 1
- 101900083372 Rabies virus Glycoprotein Proteins 0.000 description 1
- 241000282849 Ruminantia Species 0.000 description 1
- 241001428894 Small ruminant morbillivirus Species 0.000 description 1
- 238000003723 Smelting Methods 0.000 description 1
- 108010006785 Taq Polymerase Proteins 0.000 description 1
- 102000015098 Tumor Suppressor Protein p53 Human genes 0.000 description 1
- 108010078814 Tumor Suppressor Protein p53 Proteins 0.000 description 1
- DRTQHJPVMGBUCF-XVFCMESISA-N Uridine Chemical group O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C=C1 DRTQHJPVMGBUCF-XVFCMESISA-N 0.000 description 1
- 238000010521 absorption reaction Methods 0.000 description 1
- 238000009825 accumulation Methods 0.000 description 1
- 230000019552 anatomical structure morphogenesis Effects 0.000 description 1
- 230000002238 attenuated effect Effects 0.000 description 1
- 238000002869 basic local alignment search tool Methods 0.000 description 1
- 238000004364 calculation method Methods 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 238000010367 cloning Methods 0.000 description 1
- 230000000295 complement effect Effects 0.000 description 1
- 108091036078 conserved sequence Proteins 0.000 description 1
- 238000013211 curve analysis Methods 0.000 description 1
- 210000000805 cytoplasm Anatomy 0.000 description 1
- 230000001086 cytosolic effect Effects 0.000 description 1
- 231100000433 cytotoxic Toxicity 0.000 description 1
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 description 1
- 230000001472 cytotoxic effect Effects 0.000 description 1
- 230000007423 decrease Effects 0.000 description 1
- 239000005549 deoxyribonucleoside Substances 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 238000003745 diagnosis Methods 0.000 description 1
- 239000012895 dilution Substances 0.000 description 1
- 238000010790 dilution Methods 0.000 description 1
- 239000000539 dimer Substances 0.000 description 1
- 238000006471 dimerization reaction Methods 0.000 description 1
- 239000003814 drug Substances 0.000 description 1
- 238000001962 electrophoresis Methods 0.000 description 1
- 230000008030 elimination Effects 0.000 description 1
- 238000003379 elimination reaction Methods 0.000 description 1
- 238000010828 elution Methods 0.000 description 1
- 238000011156 evaluation Methods 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 239000007850 fluorescent dye Substances 0.000 description 1
- 230000004927 fusion Effects 0.000 description 1
- 102000054767 gene variant Human genes 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 210000002443 helper t lymphocyte Anatomy 0.000 description 1
- 230000000215 hyperchromic effect Effects 0.000 description 1
- 230000036039 immunity Effects 0.000 description 1
- 230000003053 immunization Effects 0.000 description 1
- 238000002649 immunization Methods 0.000 description 1
- 230000002163 immunogen Effects 0.000 description 1
- 230000001976 improved effect Effects 0.000 description 1
- 238000000126 in silico method Methods 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 239000012678 infectious agent Substances 0.000 description 1
- 208000015181 infectious disease Diseases 0.000 description 1
- 230000002458 infectious effect Effects 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 229940079322 interferon Drugs 0.000 description 1
- 229960000310 isoleucine Drugs 0.000 description 1
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 1
- 229940124590 live attenuated vaccine Drugs 0.000 description 1
- 229940023012 live-attenuated vaccine Drugs 0.000 description 1
- 238000004020 luminiscence type Methods 0.000 description 1
- 229910001629 magnesium chloride Inorganic materials 0.000 description 1
- 239000011159 matrix material Substances 0.000 description 1
- 230000035800 maturation Effects 0.000 description 1
- 238000011880 melting curve analysis Methods 0.000 description 1
- 238000010309 melting process Methods 0.000 description 1
- 108020004999 messenger RNA Proteins 0.000 description 1
- 230000001537 neural effect Effects 0.000 description 1
- 150000002482 oligosaccharides Polymers 0.000 description 1
- 230000003287 optical effect Effects 0.000 description 1
- 230000008506 pathogenesis Effects 0.000 description 1
- 230000001717 pathogenic effect Effects 0.000 description 1
- 230000007170 pathology Effects 0.000 description 1
- 230000035515 penetration Effects 0.000 description 1
- 230000026731 phosphorylation Effects 0.000 description 1
- 238000006366 phosphorylation reaction Methods 0.000 description 1
- 239000013612 plasmid Substances 0.000 description 1
- 230000008488 polyadenylation Effects 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 230000001737 promoting effect Effects 0.000 description 1
- 230000000069 prophylactic effect Effects 0.000 description 1
- 230000001681 protective effect Effects 0.000 description 1
- 238000004445 quantitative analysis Methods 0.000 description 1
- 230000005855 radiation Effects 0.000 description 1
- 102200055464 rs113488022 Human genes 0.000 description 1
- 102220197820 rs121913227 Human genes 0.000 description 1
- 238000001304 sample melting Methods 0.000 description 1
- 238000009738 saturating Methods 0.000 description 1
- 238000012216 screening Methods 0.000 description 1
- 238000002864 sequence alignment Methods 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 241000894007 species Species 0.000 description 1
- 238000007619 statistical method Methods 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 230000001225 therapeutic effect Effects 0.000 description 1
- 230000005026 transcription initiation Effects 0.000 description 1
- 230000005030 transcription termination Effects 0.000 description 1
- 108091005703 transmembrane proteins Proteins 0.000 description 1
- 102000035160 transmembrane proteins Human genes 0.000 description 1
- 230000001927 transneuronal effect Effects 0.000 description 1
- 238000002054 transplantation Methods 0.000 description 1
- 239000001226 triphosphate Substances 0.000 description 1
- 235000011178 triphosphate Nutrition 0.000 description 1
- 125000002264 triphosphate group Chemical class [H]OP(=O)(O[H])OP(=O)(O[H])OP(=O)(O[H])O* 0.000 description 1
- 241001529453 unidentified herpesvirus Species 0.000 description 1
- 230000021887 virion transport Effects 0.000 description 1
- 230000003612 virological effect Effects 0.000 description 1
Abstract
Description
Изобретение относится к ветеринарной вирусологии, к средствам молекулярной диагностики, а именно к дифференциации генома генетически модифицированного штамма «ВНИИЗЖ-G333» от вакцинного штамма «РВ-97» вируса бешенства методом полимеразной цепной реакции в режиме реального времени с анализом пиков высокого разрешения.The invention relates to veterinary virology, to molecular diagnostic tools, namely to the differentiation of the genome of the genetically modified strain "ARRIAH-G333" from the vaccine strain "RV-97" of the rabies virus using the polymerase chain reaction method in real time with high-resolution peak analysis.
Классификация и понимание генетических вариаций между различными изолятами и штаммами микроорганизмов является важной задачей в области геномики. Быстро растет интерес к поддающимся количественной оценке методам скрининга мутаций в исследованиях в области естественных наук. Такие методы используются для обнаружения генов, ответственных за различные признаки [1, 2].Classifying and understanding genetic variations between different isolates and strains of microorganisms is an important task in the field of genomics. Interest in quantifiable mutation screening methods in life sciences research is growing rapidly. Such methods are used to detect genes responsible for various traits [1, 2].
Особый интерес для генетических исследований вызывает вирус бешенства, геном которого представлен несегментированной одноцепочечной негативной молекулой РНК длиной около 12000 н.о. Нуклеиновая кислота кодирует 5 основных белков, расположенных в консервативном линейном порядке: нуклеопротеин (N-белок), фосфопротеин (Р-белок), матриксный белок (М-белок), гликопротеин (G-белок), РНК-зависимую РНК-полимеразу (L-белок) [1]. N-, М- и L-белки схожи по структуре и длине среди всех видов и штаммов лиссавирусов, в то время как длины Р- и G-белков являются переменными [3, 4].Of particular interest for genetic research is the rabies virus, the genome of which is represented by a non-segmented single-stranded negative RNA molecule about 12,000 nt long. Nucleic acid encodes 5 major proteins arranged in a conservative linear order: nucleoprotein (N protein), phosphoprotein (P protein), matrix protein (M protein), glycoprotein (G protein), RNA-dependent RNA polymerase (L -protein) [1]. N-, M- and L-proteins are similar in structure and length among all lyssavirus species and strains, while the lengths of P- and G-proteins are variable [3, 4].
Каждый ген состоит из внутренней кодирующей области, окруженной не кодирующими областями (NCRs), которые граничат с сигналами инициации транскрипции (TISs) и сигналами полиаденилирования завершения транскрипции (ТТР). Данные сигналы состоят примерно из 10 нуклеотидов. Последовательность участка TIS (3'-U-U-G-U-R-R-п-GA-5') строго сохраняется во всех геномах лиссавирусов. Последовательность участков ТТР (3'-A/U-C-U-U-U-U-U-U-U-U-G-5') содержит последовательность из семи остатков уридина, которые повторно копируются с помощью РНК-полимеразы для получения полиаденилированного хвоста каждой мРНК перед повторной инициацией при следующем стартовом сигнале. Гены обычно разделяются сохраненными не транскрибируемыми межгенными областями (IGRs), которые имеют длину 2-6 нуклеотидов [4]. Таким образом, единицы транскрипции разделены короткими не транслируемыми межгенными областями. Исключение составляет межгенная область G-L, которая состоит из 400-700 нуклеотидов и может представлять собой остаток гена, который потерял свою функциональность во время эволюции лиссавирусов [3].Each gene consists of an internal coding region flanked by non-coding regions (NCRs) that are flanked by transcription initiation signals (TISs) and transcription termination polyadenylation signals (TTPs). These signals consist of approximately 10 nucleotides. The sequence of the TIS region (3'-U-U-G-U-R-R-n-GA-5') is strictly conserved in all lyssavirus genomes. The TTP region sequence (3'-A/U-C-U-U-U-U-U-U-U-U-G-5') contains a sequence of seven uridine residues that are repeatedly copied by RNA polymerase to produce the polyadenylated tail of each mRNA before reinitiation at the next start signal. Genes are typically separated by conserved untranscribed intergenic regions (IGRs), which are 2–6 nucleotides in length [4]. Thus, transcription units are separated by short untranslated intergenic regions. The exception is the G-L intergenic region, which consists of 400-700 nucleotides and may represent a remnant of a gene that has lost its functionality during the evolution of lyssaviruses [3].
Пять генов в РНК вируса бешенства окружены двумя короткими участками NCRs на 3'- и 5'-концах: лидерная область 3'- (leader) и трейлерная область 5' (trailer). Эти последовательности, соответственно, инициируют и завершают транскрипцию и репликацию генома, соответственно. Leader и trailer очень богаты UTP и АТР. Лидирующая область представлена 58 нуклеотидными остатками, первые девять из которых идентичны у всех представителей лиссавирусов. Длина и последовательность трейлерной области более изменчивы (около 70 нуклеотидов). Последовательности 3'- и 5'-концов генома обратно комплементарны. Эта взаимодополняемость является классической особенностью представителей порядка Mononegavirales [3].The five genes in the rabies virus RNA are surrounded by two short NCRs at the 3' and 5' ends: the 3' leader region and the 5' trailer region. These sequences initiate and terminate transcription and genome replication, respectively. Leader and trailer are very rich in UTP and APR. The leading region is represented by 58 nucleotide residues, the first nine of which are identical in all representatives of lyssaviruses. The length and sequence of the trailer region is more variable (about 70 nucleotides). The sequences of the 3' and 5' ends of the genome are reverse complementary. This complementarity is a classic feature of representatives of the order Mononegavirales [3].
Вирионы имеют пулевидную форму диаметром 75 нм и длиной 100-300 нм в зависимости от штамма. Один конец конический, а другой плоский. Вирусная РНК инкапсидируется N-белком (нуклеопротеином) (450 а.о.) с образованием спирального нуклеокапсида, в котором каждый N-протомер связывается с девятью нуклеотидами [9, 10, 11]. Нуклеокапсид связан со значительным количеством Р-белка (фосфопротеина) (297 а.о.). L-белок (РНК-зависимая РНК-полимераза) - белок с наибольшей длиной (2130 а.о.). Вирион состоит из следующих функциональных структур: рибонуклеопротеин (РНП), расположенный внутри вириона, и внешняя белково-липидная составляющая. РНК, N-, Р- и L-белок образуют РНП, который является компонентом, активно участвующим в транскрипции и репликации. РНП покрыт липидным бислоем, полученным из плазматической мембраны клетки-хозяина в процессе зарождения. Рибонуклеопротеин является важным иммуногенным компонентом вакцинных препаратов против бешенства. М-белок (матричный) (202 а.о.) и G-белок (гликопротеин) (505 а.о.) являются мембраносвязанными белками. М-белок расположен под вирусной мембраной и соединяет нуклеокапсид и липидный бислой. G-белок - интегральный трансмембранный белок, который участвует в проникновении вируса в клетку [4].Virions are bullet-shaped with a diameter of 75 nm and a length of 100-300 nm, depending on the strain. One end is conical and the other is flat. Viral RNA is encapsidated by an N-protein (nucleoprotein) (450 aa) to form a helical nucleocapsid, in which each N-protomer binds to nine nucleotides [9, 10, 11]. The nucleocapsid is associated with a significant amount of P-protein (phosphoprotein) (297 aa). L-protein (RNA-dependent RNA polymerase) is the longest protein (2130 aa). The virion consists of the following functional structures: ribonucleoprotein (RNP), located inside the virion, and an external protein-lipid component. RNA, N-, P- and L-protein form RNP, which is a component actively involved in transcription and replication. The RNP is covered by a lipid bilayer derived from the host cell plasma membrane during nucleation. Ribonucleoprotein is an important immunogenic component of rabies vaccine preparations. M protein (matrix) (202 aa) and G protein (glycoprotein) (505 aa) are membrane-bound proteins. The M protein is located under the viral membrane and connects the nucleocapsid and the lipid bilayer. G protein is an integral transmembrane protein that is involved in the penetration of the virus into the cell [4].
N-белок (нуклеопротеин) представляет собой двухдоменный белок с положительно заряженной щелью между двумя доменами с общим молекулярным весом 57 кДа и длиной 450 а.о. Данный белок упаковывает геномную РНК и формирует спиральный нуклеокапсид, который позволяет защитить РНК ВБ от клеточных РНК-аз и факторов, которые распознают чужеродные нуклеиновые кислоты, чтобы начать синтез интерферона [14, 15]. Нуклеопротеин образует комплекс с РНК вируса бешенства, формируя позитивный и негативный РНП, соответственно. При анализе нуклеотидных последовательностей N-гена вируса выявлено наличие высококонсерватиных областей. С помощью моноклональных антител на N-белке выявлены следующие линейные эпитопы антигенных сайтов: сайт I (313-337 а.о.), сайт IV (358-367 а.о.), а также конформационно зависимые сайты II и III. Обнаружено, что антигенные участки сайта I формируются на незрелой форме нуклеопротеина, а эпитопы сайта IV - после полного созревания N-белка [3]. Рибонуклеопротеин в лабораторной практике применяют для получения специфических тест-систем по качественному и количественному определению, в том числе в сырье для антирабических вакцин [4].The N protein (nucleoprotein) is a two-domain protein with a positively charged cleft between the two domains with a total molecular weight of 57 kDa and a length of 450 aa. This protein packages genomic RNA and forms a helical nucleocapsid, which allows protecting the IP RNA from cellular RNases and factors that recognize foreign nucleic acids in order to begin the synthesis of interferon [14, 15]. The nucleoprotein forms a complex with the RNA of the rabies virus, forming positive and negative RNP, respectively. Analysis of the nucleotide sequences of the virus N-gene revealed the presence of highly conserved regions. Using monoclonal antibodies, the following linear epitopes of antigenic sites were identified on the N protein: site I (313-337 aa), site IV (358-367 aa), as well as conformation-dependent sites II and III. It was found that the antigenic regions of site I are formed on the immature form of the nucleoprotein, and the epitopes of site IV are formed after complete maturation of the N protein [3]. In laboratory practice, ribonucleoprotein is used to obtain specific test systems for qualitative and quantitative determination, including in raw materials for rabies vaccines [4].
G-белок (гликопротеин) находится в наружном слое оболочки вириона, состоит из 524 а.о. и содержит 2 гидроформных элемента. Молекулярный вес гликопротеина составляет 70 кДа для фракции G1 и 65 кДа для фракции G2. Не гликолизированная часть белка погружена в билипидный слой. Гликопротеин составляет примерно 45% от общего количества вирусных белков. Каждая молекула G-белка содержит две олигосахаридные цепи, соединенные с гидрофильной составляющей. Данный белок имеет 4 области: сигнальный пептид, эктодомен, трансмембранный и цитоплазматический домен [3]. Гликопротеин играет ключевую роль в адгезии вириона к мембране клетки-хозяина и в связывании с вируснейтрализующими антителами, а также в нейроинвазивности, поскольку его точечная мутация в положении 333 (аргинин или лизин) полностью устраняет вирулентность, и делеция его гена устраняет транснейронное распространение [19]. Более того, у авирулентных штаммов нейроинвазивность восстанавливается путем генетической замены или трансплантации гликопротеином, полученным из вирулентных штаммов. При отсутствии положительно заряженной аминокислоты в позиции 333 вирион не поражает нервные клетки. Замена аргинина в данной позиции на глютамин или изолейцин снижает нейропатогенность. Мутанты с замененной аминокислотой не могут инфицировать нейроны в связи с отсутствием возможности распознавать рецепторы клеток. В дополнение к связыванию с нейрональными рецепторами, гликопротеин вируса бешенства способствует слиянию вируса и клеточной мембраны и придает вириону транспортные свойствам внутри клетки [3, 4].G-protein (glycoprotein) is located in the outer layer of the virion envelope and consists of 524 aa. and contains 2 hydroform elements. The molecular weight of the glycoprotein is 70 kDa for the G1 fraction and 65 kDa for the G2 fraction. The non-glycolyzed part of the protein is immersed in the bilipid layer. The glycoprotein makes up approximately 45% of the total viral proteins. Each G protein molecule contains two oligosaccharide chains connected to a hydrophilic moiety. This protein has 4 regions: signal peptide, ectodomain, transmembrane and cytoplasmic domain [3]. The glycoprotein plays a key role in virion adhesion to the host cell membrane and in binding to virus-neutralizing antibodies, as well as in neuroinvasiveness, since its point mutation at position 333 (arginine or lysine) completely abolishes virulence, and deletion of its gene eliminates transneuronal spread [19] . Moreover, in avirulent strains, neuroinvasiveness is restored by genetic replacement or transplantation with a glycoprotein derived from virulent strains. In the absence of a positively charged amino acid at position 333, the virion does not infect nerve cells. Replacing arginine at this position with glutamine or isoleucine reduces neuropathogenicity. Mutants with a substituted amino acid cannot infect neurons due to the inability to recognize cell receptors. In addition to binding to neuronal receptors, the rabies virus glycoprotein promotes the fusion of the virus and the cell membrane and gives the virion transport properties within the cell [3, 4].
Вторичная и третичная формы гликопротеина обуславливают наличие на его поверхности антигенных сайтов. На поверхности эктодомена находится 8 антигенных эпитопов. Экто- и эндодомены G-белка являются растворимыми фракциями, поэтому они не способны вызывать протективный иммунитет. Эктодомен (1-439 а.о.) играет важнейшую роль в патогенезе бешенства, а именно, в прикреплении вириона к цитоплазматической мембране клетки, в связывании с вируснейтрализующими антителами. Именно эктодомен G-белка включает в себя сайт, который отвечает за вирулентность вируса бешенства. Следует также отметить, что гликопротеин является мишенью для специфических Т-хелперов и цитотоксических Т-киллеров [4].The secondary and tertiary forms of the glycoprotein determine the presence of antigenic sites on its surface. There are 8 antigenic epitopes on the surface of the ectodomain. G protein ecto- and endodomains are soluble fractions, so they are not capable of inducing protective immunity. The ectodomain (aa 1-439) plays a critical role in the pathogenesis of rabies, namely, in the attachment of the virion to the cytoplasmic membrane of the cell and in binding to virus-neutralizing antibodies. It is the ectodomain of the G protein that includes the site that is responsible for the virulence of the rabies virus. It should also be noted that the glycoprotein is a target for specific T helper cells and cytotoxic T killer cells [4].
L-белок (Large) имеет молекулярную массу 190 кДа, длину около 2158 а.о. и является компонентом полимеразного комплекса. Это самый большой белок ВБ, L-ген занимает более половины вирусной РНК и включает в себя консервативные последовательности. Для поражения клетки вирус бешенства, имеющий РНК (-), должен содержать в составе своего вириона активный полимеразный комплекс для активации первичной транскрипции после внедрения РНП в цитоплазму и de novo синтезировать белки вируса. После этого происходит репликация геномных РНК и вторичная транскрипция [3].L-protein (Large) has a molecular weight of 190 kDa and a length of about 2158 aa. and is a component of the polymerase complex. This is the largest virus protein; the L gene occupies more than half of the viral RNA and includes conserved sequences. To infect a cell, a rabies virus containing RNA (-) must contain an active polymerase complex in its virion to activate primary transcription after the introduction of RNP into the cytoplasm and de novo synthesize viral proteins. After this, genomic RNA replication and secondary transcription occur [3].
М-белок (матриксный белок) вируса бешенства имеет небольшой молекулярный вес 20-25 кДа и длину 202 а.о. Это фосфопротеин, представленный в двух изоформах M1 и М2, которые отличаются друг от друга степенью фосфорилирования. Матриксный белок структурно представляет собой мостик между N- и G-белком. М-ген является гораздо более консервативным по сравнению с Р-белком. Считается, что этот белок образует слой между гликопротеином в оболочке вириона и спиральным ядром нуклеокапсида, состоящим из генома РНК и N-, L-, Р-белков. М-белок является основным фактором, способствующим зарождению вируса и морфогенезу вириона, в то время как G-белок играет более вспомогательную роль в этих процессах [4].The M protein (matrix protein) of the rabies virus has a small molecular weight of 20-25 kDa and a length of 202 aa. This is a phosphoprotein presented in two isoforms M 1 and M 2 , which differ from each other in the degree of phosphorylation. The matrix protein is structurally a bridge between the N and G proteins. The M gene is much more conserved compared to the P protein. It is believed that this protein forms a layer between the glycoprotein in the virion envelope and the helical core of the nucleocapsid, consisting of the RNA genome and N-, L-, P-proteins. The M protein is the main factor promoting virus nucleation and virion morphogenesis, while the G protein plays a more auxiliary role in these processes [4].
Бешенство приводит к значительным экономическим потерям, которые связаны с гибелью животных, ликвидацией последствий вспышек болезни, введением строгих ограничений, налагаемых на внутреннюю и международную торговлю продукцией животноводства, проведением профилактических и карантинных мероприятий и др. В соответствии с Кодексом наземных животных и Руководством МЭБ по диагностическим тестам и вакцинам для борьбы с бешенством должен соблюдаться комплекс мер по вакцинопрофилактике диких плотоядных животных - программа по оральной вакцинации; вакцинопрофилактика домашних животных; современная лечебно-профилактическая вакцинация людей, обратившихся за антирабической помощью, профилактическая вакцинация людей групп риска, прежде всего, профессионального риска; контроль проводимых антирабических мероприятий, включающих в себя блок задач и методик [4].Rabies leads to significant economic losses associated with the death of animals, elimination of the consequences of disease outbreaks, the introduction of strict restrictions imposed on domestic and international trade in animal products, the implementation of preventive and quarantine measures, etc. In accordance with the Terrestrial Animal Code and the OIE Guidelines for Diagnostic tests and vaccines to combat rabies must comply with a set of measures for vaccine prevention of wild carnivores - an oral vaccination program; vaccination of domestic animals; modern therapeutic and prophylactic vaccination of people who have applied for rabies treatment, preventive vaccination of people at risk, especially occupational risk; control of ongoing anti-rabies measures, which include a block of tasks and techniques [4].
Живые аттенуированные вакцины, изготовленные на основе вируса бешенства, широко применяются во многих странах для профилактики данного заболевания. В России и странах СНГ применяют вакцину против бешенства, разработанную с применением штамма «РВ-97». Полногеномная нуклеотидная последовательность данного представителя вируса бешенства представлена в GenBank (EF 542830.1) [5].Live attenuated vaccines made from the rabies virus are widely used in many countries to prevent this disease. In Russia and the CIS countries, a rabies vaccine developed using the RV-97 strain is used. The full genome nucleotide sequence of this representative of the rabies virus is presented in GenBank (EF 542830.1) [5].
Выбор подходов для разработки живой вакцины, способной защищать животных без наличия клинических признаков инфекции после иммунизации, является актуальным. Для реализации данной задачи создан вакцинный генно-инженерный штамм «ВНИИЗЖ-G333» вируса бешенства с использованием метода клонирования по Гибсону in vitro и плазмидных конструкции, который включает в себя редактированные локусы вирулентности.The choice of approaches to develop a live vaccine capable of protecting animals without clinical signs of infection after immunization is relevant. To achieve this task, a genetically engineered vaccine strain “ARRIAH-G333” of the rabies virus was created using the Gibson in vitro cloning method and plasmid constructs, which include edited virulence loci.
Учитывая, что штаммы «РВ-97» и «ВНИИЗЖ-G333» применяются для производства вакцинных препаратов, но при этом отличаются друг от друга по свойствам, а именно, штамм «ВНИИЗЖ-G333» не является патогенным за счет точечных мутаций, важно использовать диагностические инструменты, которые могут быстро и специфически дифференцировать геном вируса бешенства штаммов «РВ-97» и «ВНИИЗЖ-G333», что важно при контроле качества сырья при изготовлении вакцинных препаратов и подтверждения использования для производства антирабических вакцин именно из генно-модифицированного штамма «ВНИИЗЖ-G333».Considering that the strains “RV-97” and “ARRIAH-G333” are used for the production of vaccine preparations, but at the same time differ from each other in properties, namely, the strain “ARRIAH-G333” is not pathogenic due to point mutations, it is important to use diagnostic tools that can quickly and specifically differentiate the genome of the rabies virus strains “RV-97” and “ARRIAH-G333”, which is important when monitoring the quality of raw materials in the manufacture of vaccine preparations and confirming the use of the genetically modified strain “ARRIAH” for the production of rabies vaccines -G333".
В связи с этим целесообразно провести поиск способа дифференциации генома генетически модифицированного штамма «ВНИИЗЖ-G333» от вакцинного штамма «РВ-97» вируса бешенства. Для решения поставленной задачи требуется провести молекулярно-биологический анализ генома вируса бешенства, что даст возможность разработать метод для контроля качества и определения специфичности используемого вакцинного сырья.In this regard, it is advisable to search for a way to differentiate the genome of the genetically modified strain “ARRIAH-G333” from the vaccine strain “RV-97” of the rabies virus. To solve this problem, it is necessary to conduct a molecular biological analysis of the genome of the rabies virus, which will make it possible to develop a method for quality control and determination of the specificity of the vaccine raw materials used.
В настоящее время методы молекулярно-биологического анализа находят широкое применение в диагностике различных инфекционных заболеваний. Благодаря созданию нового поколения флуоресцирующих красителей и технологическим усовершенствованиям платформ количественной ПНР анализ кривой плавления с высоким разрешением стал важным и перспективным методом генотипирования микроорганизмов, который возможно применять для дифференциации вакцинных штаммов от полевых изолятов вирусов [6, 7].Currently, molecular biological analysis methods are widely used in the diagnosis of various infectious diseases. Thanks to the development of a new generation of fluorescent dyes and technological improvements in quantitative PNR platforms, high-resolution melting curve analysis has become an important and promising method for genotyping microorganisms, which can be used to differentiate vaccine strains from field virus isolates [6, 7].
Проведено изучение истории исследований, предшествующих появлению предложенной технологии. В 1960-х годах плавление двухцепочечной ДНК контролировалось по поглощению ультрафиолетового излучения (гиперхромный эффект). Анализ требовал количества ДНК в мкг и часто занимал часы, в то время как образцы медленно нагревались со скоростью 0,1-1,0°С/мин. В современном анализе плавления ДНК используется флуоресценция, и поскольку это более чувствительный метод, для него требуется всего несколько нг ДНК (количества, которые легко получить с помощью ПЦР) [8].The history of research preceding the emergence of the proposed technology was studied. In the 1960s, the melting of double-stranded DNA was controlled by the absorption of ultraviolet radiation (hyperchromic effect). The analysis required microgram quantities of DNA and often took hours while samples were slowly heated at a rate of 0.1–1.0°C/min. Modern DNA melting assay uses fluorescence, and because it is a more sensitive method, it requires only a few ng of DNA (amounts that are easily obtained by PCR) [8].
Флуоресцентный анализ плавления ДНК стал популярным с появлением в 1997 году прибора для ПЦР в реальном времени LightCycler®. Данный прибор позволяет достовернее контролировать температуру и обеспечить высокую скорость плавления 0,1-1,0°С/сек, сократив время плавления до нескольких минут. Индикатором флуоресценции, использованным еще в 1997 году, был краситель SYBR®Green I, чувствительный и удобный краситель для мониторинга амплификации и плавления амплифицированных продуктов в режиме реального времени [9].Fluorescent DNA melting analysis became popular with the introduction of the LightCycler ® real-time PCR instrument in 1997. This device allows you to more reliably control the temperature and ensure a high melting rate of 0.1-1.0 ° C/sec, reducing the melting time to several minutes. The fluorescence indicator used as early as 1997 was SYBR ® Green I, a sensitive and convenient dye for monitoring the amplification and melting of amplified products in real time [9].
Анализ плавления с высоким разрешением - новый метод, представленный в 2003 году, который использует сбор данных с высокой плотностью и обнаруживает небольшие различия в последовательностях фрагментов ПЦР только путем прямого плавления. Кривые плавления можно использовать для сканирования мутаций, сопоставления последовательностей и анализа мультиплексного генотипирования. Благодаря своей скорости и простоте, популярность этого метода в последние годы увеличивается [8, 10].High-resolution melting analysis is a new method introduced in 2003 that uses high-density data acquisition and detects small differences in PCR fragment sequences only by direct melting. Melting curves can be used for mutation scanning, sequence alignment, and multiplex genotyping analysis. Due to its speed and simplicity, the popularity of this method has been increasing in recent years [8, 10].
Анализ плавления ампликонов с высоким разрешением представляет собой количественный анализ кривой плавления фрагмента ДНК после реакции амплификации. Для данного метода требуется система ПЦР-детекции в режиме реального времени с высокой термостабильностью и чувствительностью. Комбинация улучшенного инструментария количественной детекции продуктов ПЦР и насыщающих ДНК-связывающих красителей позволила идентифицировать генетические вариации в последовательностях нуклеиновых кислот путем контролируемого плавления двухцепочечного ампликона [11, 12, 13].High-resolution amplicon melting analysis is a quantitative analysis of the melting curve of a DNA fragment after an amplification reaction. This method requires a real-time PCR detection system with high thermal stability and sensitivity. The combination of improved quantitative detection of PCR products and saturating DNA-binding dyes has made it possible to identify genetic variations in nucleic acid sequences through controlled melting of the double-stranded amplicon [11, 12, 13].
Анализ кривых плавления с высоким разрешением дает возможность выявлять новые варианты генов, проводить скрининг образцов ДНК на однонуклеотидные полиморфизмы, выявлять вставки/делеции и другие неизвестные мутации, и определять процент метилированной ДНК в образцах. Данный анализ проводится в амплификаторах в режиме реального времени [14, 15, 16].High-resolution melt curve analysis makes it possible to identify new gene variants, screen DNA samples for single nucleotide polymorphisms, identify insertions/deletions and other unknown mutations, and determine the percentage of methylated DNA in samples. This analysis is carried out in thermal cyclers in real time [14, 15, 16].
Сущность представленного метода заключается в следующем: после проведения ПНР с интеркалирующим красителем смесь постепенно нагревают, и при достижении определенной температуры двухцепочечные молекулы ДНК начинают разъединяться, флуорофор постепенно высвобождается, и флуоресценция падает. Изменение свечения детектируется оптической системой амплификатора. При этом ампликоны с разной последовательностью «плавятся» при разной температуре. Чувствительность метода достигает одного нуклеотида, благодаря чему с помощью данного анализа можно проводить детекцию однонуклеотидных полиморфизмов [13].The essence of the presented method is as follows: after carrying out PPR with an intercalating dye, the mixture is gradually heated, and when a certain temperature is reached, double-stranded DNA molecules begin to separate, the fluorophore is gradually released, and the fluorescence decreases. The change in luminescence is detected by the optical system of the amplifier. In this case, amplicons with different sequences “melt” at different temperatures. The sensitivity of the method reaches one nucleotide, due to which this analysis can be used to detect single nucleotide polymorphisms [13].
Следует отметить, что основываясь на функциональном тестировании имеющихся в настоящее время приборов, получение 10 точек данных на градус Цельсия во время операций плавки, вероятно, является минимальным требованием для обеспечения определенного уровня сканирования мутаций. «Высокое разрешение» будет означать большее количество точек данных на °С [15].It should be noted that based on functional testing of currently available instruments, obtaining 10 data points per degree Celsius during smelting operations is likely the minimum requirement to provide a certain level of mutation scanning. “High resolution” would mean more data points per °C [15].
Прототипным вариантом проведения дифференциального анализа является постановка полимеразной цепной реакции с электрофорезом с оригинальными праймерами и с последующим секвенированием по Сенгеру [16]. Однако, данный метод является очень дорогостоящим, продолжительным во времени, поскольку предполагает проведение дополнительных этапов работы с последующим расшифровыванием нуклеотидной последовательности и анализом их с помощью BioEdit и MEGA 7 или аналогов. Исходя из этого, необходимо разработать альтернативный способ исследования образцов.The prototype option for differential analysis is a polymerase chain reaction with electrophoresis with original primers and subsequent Sanger sequencing [16]. However, this method is very expensive and time-consuming, since it involves additional stages of work followed by deciphering the nucleotide sequence and analyzing them using BioEdit and MEGA 7 or analogues. Based on this, it is necessary to develop an alternative method for studying samples.
Техническим решением изобретения является разработка чувствительного и специфичного, экспрессного способа дифференциации генома генетически-модифицированного вакцинного штамма «ВНИИЗЖ-G333» от производственного штамма «РВ-97» методом полимеразной цепной реакции в режиме реального времени с анализом пиков высокого разрешения с целью устранения вышеуказанных недостатков.The technical solution of the invention is the development of a sensitive and specific, rapid method for differentiating the genome of the genetically modified vaccine strain "ARRIAH-G333" from the production strain "RV-97" using the polymerase chain reaction method in real time with analysis of high-resolution peaks in order to eliminate the above disadvantages.
Данная задача решена благодаря разработке способа дифференциации генома генетически модифицированного штамма «ВНИИЗЖ-G333» от вакцинного штамма «РВ-97» вируса бешенства методом полимеразной цепной реакции в режиме реального времени с анализом пиков высокого разрешения. Суть метода заключается в следующем: проводится дизайн праймеров с тем расчетом, чтобы амплифицировать фрагмент ДНК содержащий мутацию, наличие которой нужно подтвердить в генетической конструкции. ПЦР проводится в присутствии интеркалирующего красителя, который встраивается в двуцепочечную ДНК, после чего ее можно обнаружить с помощью считывания флуоресцентного сигнала. Фрагмент анализируемого фрагмента ДНК отличается от генетической конструкции, содержащей мутацию, по нуклеотидному составу. Полученный участок постепенно нагревают в широком диапазоне температур. При достижении температуры плавления двуцепочечная молекула ДНК (дцДНК) распадается на отдельные цепи. При этом пропадает флуоресцентный сигнал специфичного для дцДНК красителя. Для каждого варианта нуклеотидного состава характерна своя температура плавления. Анализируя кривые плавления фрагментов ДНК можно уверенно определять нуклеотидный состав этих фрагментов, а значит - дифференцировать мутантный вариант генетической конструкции от всех прочих [1, 15].This problem was solved thanks to the development of a method for differentiating the genome of the genetically modified strain “ARRIAH-G333” from the vaccine strain “RV-97” of the rabies virus using real-time polymerase chain reaction with high-resolution peak analysis. The essence of the method is as follows: primers are designed in order to amplify a DNA fragment containing a mutation, the presence of which needs to be confirmed in the genetic construct. PCR is carried out in the presence of an intercalating dye, which is incorporated into the double-stranded DNA, after which it can be detected by reading the fluorescent signal. The fragment of the analyzed DNA fragment differs from the genetic construct containing the mutation in its nucleotide composition. The resulting area is gradually heated over a wide temperature range. When the melting temperature is reached, the double-stranded DNA (dsDNA) molecule breaks down into individual chains. In this case, the fluorescent signal of the dsDNA-specific dye disappears. Each variant of the nucleotide composition has its own melting temperature. By analyzing the melting curves of DNA fragments, one can confidently determine the nucleotide composition of these fragments, and therefore differentiate the mutant version of the genetic construct from all others [1, 15].
Разработанный способ дает возможность: 1) сократить время проведения анализа до 2-3 ч; 2) применять современный интеркалирующий краситель EvaGreen, который обеспечивает более высокую флуоресценцию по сравнению с SYBR Green, что повышает точность и чувствительность проводимого анализа; 3) увеличить чувствительность и специфичность анализа за счет использования высокоспецифичных оригинальных праймеров, рассчитанных для таргетного участка ДНК вируса бешенства. Данная разработка позволит расширить арсенал средств для проведения контроля качества сырья при производстве аттенуированных вакцин против бешенства.The developed method makes it possible to: 1) reduce the analysis time to 2-3 hours; 2) use the modern intercalating dye EvaGreen, which provides higher fluorescence compared to SYBR Green, which increases the accuracy and sensitivity of the analysis; 3) increase the sensitivity and specificity of the analysis through the use of highly specific original primers designed for the target region of the rabies virus DNA. This development will expand the arsenal of tools for quality control of raw materials in the production of attenuated rabies vaccines.
Сущность изобретения отражена на графических изображениях:The essence of the invention is reflected in graphic images:
Фиг. 1 - График накопления флуоресцентного сигнала при исследовании пяти пар праймеров для вируса бешенства штаммов «ВНИИЗЖ-G333» и «РВ-97».Fig. 1 - Graph of fluorescent signal accumulation during the study of five pairs of primers for rabies virus strains “ARRIAH-G333” and “RV-97”.
Фиг. 2 - Анализ кривых плавления при анализе пяти пар олигонуклеотидных праймеров для вируса бешенства штаммов «ВНИИЗЖ-G333» и «РВ-97».Fig. 2 - Analysis of melting curves when analyzing five pairs of oligonucleotide primers for rabies virus strains “ARRIAH-G333” and “RV-97”.
Сущность изобретения пояснена в перечне последовательностей, в котором:The essence of the invention is explained in the list of sequences, in which:
SEQ ID NO: 1 представляет последовательность нуклеотидов штамма «ВНИИЗЖ-G333» вакцинного генетически модифицированного вируса бешенства;SEQ ID NO: 1 represents the nucleotide sequence of the ARRIAH-G333 strain of the vaccine genetically modified rabies virus;
SEQ ID NO: 2 представляет последовательность аминокислот штамма «ВНИИЗЖ-G333» вакцинного генетически модифицированного вируса бешенства.SEQ ID NO: 2 represents the amino acid sequence of the ARRIAH-G333 strain of the vaccine genetically modified rabies virus.
Сущность изобретения заключается в новом подходе по разработке способа дифференциации генома генетически модифицированного штамма «ВНИИЗЖ-G333» от вакцинного штамма «РВ-97» вируса бешенства методом полимеразной цепной реакции в режиме реального времени с анализом пиков высокого разрешения. Заявляемый способ основан на: 1) элюировании РНК вируса бешенства из исследуемого биологического материала; 2) проведении амплификации специфического фрагмента кДНК G-гена вируса бешенства размером 77 п.н. с применением разработанных оригинальных олигонуклеотидных специфических праймеров F2-RabV333 (5'-AGGCTGAGGCTCACTACAAG-3') и R2-RabV333 (5'-CCCTTCGACTCTTAAACACCCT-3') (таблицы 1, 2, 3); 3) проведении плавления ампликонов в разработанном режиме с учетов пиков высокого разрешения; 4) детекции результатов анализа с определением максимального значения температуры плавления и проведении инструментального дифференциального анализа генома генетически модифицированного штамма «ВНИИЗЖ-G333» от вакцинного штамма «РВ-97» вируса бешенства методом полимеразной цепной реакции в режиме реального времени с анализом пиков высокого разрешения.The essence of the invention lies in a new approach to developing a method for differentiating the genome of the genetically modified strain "ARRIAH-G333" from the vaccine strain "RV-97" of the rabies virus using the polymerase chain reaction method in real time with high-resolution peak analysis. The inventive method is based on: 1) elution of rabies virus RNA from the biological material being studied; 2) carrying out amplification of a specific cDNA fragment of the G-gene of the rabies virus measuring 77 bp. using the developed original oligonucleotide specific primers F2-RabV 333 (5'-AGGCTGAGGCTCACTACAAG-3') and R2-RabV 333 (5'-CCCTTCGACTCTTAAACACCCT-3') (Tables 1, 2, 3); 3) carrying out melting of amplicons in the developed mode taking into account high-resolution peaks; 4) detection of analysis results with determination of the maximum melting temperature and conducting instrumental differential analysis of the genome of the genetically modified strain "ARRIAH-G333" from the vaccine strain "RV-97" of the rabies virus using the polymerase chain reaction method in real time with analysis of high-resolution peaks.
В публикациях многих авторов показана необходимость проведения дифференциации вакцинных штаммов и полевых изолятов вируса бешенства. По данным проведенного анализа литературных данных, в настоящее время доступно несколько анализов для определения вируса бешенства с помощью ПЦР и ПЦР в реальном времени [7, 8, 9, 14], но при этом ни один из них не предназначен для дифференциации генетически модифицированного штамма «ВНИИЗЖ-G333» от вакцинного штамма «РВ-97» вируса бешенства. При анализе публикаций способ дифференциации данных штаммов вируса бешенства с помощью молекулярно-генетических методов также не представлен. Таким образом, сведений об аналогах предлагаемого способа дифференциации генома генетически модифицированного штамма «ВНИИЗЖ-G333» от вакцинного штамма «РВ-97» вируса бешенства методом полимеразной цепной реакции в режиме реального времени с анализом пиков высокого разрешения авторами не обнаружено. Прототипом следует считать анализ нуклеотидных последовательностей с помощью секвенирования по Сэнгеру.The publications of many authors show the need to differentiate vaccine strains and field isolates of the rabies virus. According to the analysis of literature data, several tests are currently available for determining the rabies virus using PCR and real-time PCR [7, 8, 9, 14], but none of them are designed to differentiate a genetically modified strain “ ARRIAH-G333" from the vaccine strain "RV-97" of the rabies virus. When analyzing publications, a method for differentiating these rabies virus strains using molecular genetic methods is also not presented. Thus, the authors did not find information about analogues of the proposed method for differentiating the genome of the genetically modified strain “ARRIAH-G333” from the vaccine strain “RV-97” of the rabies virus using the polymerase chain reaction method in real time with analysis of high-resolution peaks. The prototype should be considered the analysis of nucleotide sequences using Sanger sequencing.
Разработанный способ дифференциации генома генетически модифицированного штамма «ВНИИЗЖ-G333» от вакцинного штамма «РВ-97» вируса бешенства методом полимеразной цепной реакции в режиме реального времени с анализом пиков высокого разрешения по сравнению с прототипом отличается экономической выгодой и экспрессностью выполнения анализа, что позволяет быстро проводить контроль сырья при изготовлении вакцинных препаратов.The developed method for differentiating the genome of the genetically modified strain "ARRIAH-G333" from the vaccine strain "RV-97" of the rabies virus using the polymerase chain reaction method in real time with analysis of high-resolution peaks in comparison with the prototype is characterized by economic benefit and rapidity of analysis, which allows for rapid carry out control of raw materials during the manufacture of vaccine preparations.
В отличие от прототипа разработанный способ позволил провести анализ выравнивания множественных нуклеотидных последовательностей G-гена штаммов «ВНИИЗЖ-G333» и «РВ-97» вируса бешенства и идентифицировать область с 1054…1056-нуклеотидными заменами GAA на GAA, уникальной для вакцинного штамма «ВНИИЗЖ-G333». Данный способ предусматривает проведение реакции амплификации специфического фрагмента кДНК вируса бешенства в диапазоне 1028…1104 п.н. с применением разработанных оригинальных олигонуклеотидных специфических праймеров F2-RabV333 и R2-RabV333 для амплификации фрагмента размером 109 п.н. Разработанный способ предусматривает проведение плавления ампликонов в разработанном режиме с учетов пиков высокого разрешения, а также детекцию результатов анализа с определением максимального значения температуры плавления и проведением инструментального дифференциального анализа генома указанных штаммов вируса бешенства методом полимеразной цепной реакции в режиме реального времени с анализом пиков высокого разрешения. Таким образом, актуально применять предложенный способ дифференциации генома генетически модифицированного штамма «ВНИИЗЖ-G333» от вакцинного штамма «РВ-97» вируса бешенства методом полимеразной цепной реакции в режиме реального времени с анализом пиков высокого разрешения.In contrast to the prototype, the developed method made it possible to analyze the alignment of multiple nucleotide sequences of the G gene of the ARRIAH-G333 and RV-97 strains of the rabies virus and to identify the region with 1054...1056-nucleotide substitutions of GAA with GAA, unique to the ARRIAH vaccine strain -G333". This method involves carrying out an amplification reaction of a specific cDNA fragment of the rabies virus in the range of 1028...1104 bp. using the developed original oligonucleotide specific primers F2-RabV 333 and R2-RabV 333 to amplify a fragment of 109 bp. The developed method involves melting amplicons in a developed mode taking into account high-resolution peaks, as well as detecting analysis results with determining the maximum melting temperature and conducting instrumental differential analysis of the genome of the specified rabies virus strains using the polymerase chain reaction method in real time with analysis of high-resolution peaks. Thus, it is relevant to apply the proposed method for differentiating the genome of the genetically modified strain “ARRIAH-G333” from the vaccine strain “RV-97” of the rabies virus using the polymerase chain reaction method in real time with high-resolution peak analysis.
Ключевым элементом заявляемого способа является определение с высоким разрешением пиковых значений температур плавления амплифицированных продуктов ПЦР и дифференциация генома штаммов «ВНИИЗЖ-G333» и «РВ-97» вируса бешенства по результатам анализа максимумов графиков плавления ампликонов.The key element of the proposed method is the determination with high resolution of peak melting temperatures of amplified PCR products and differentiation of the genome of the strains “ARRIAH-G333” and “RV-97” of the rabies virus based on the results of analysis of the maximums of the amplicon melting graphs.
Сопоставительный анализ с прототипом позволяет сделать вывод, что новизна и изобретательский уровень заявляемого изобретения заключаются в применении способа ПЦР в режиме реального времени, оригинальных специфичных олигонуклеотидных праймеров F2-RabV333 и R2-RabV333, рассчитанных для амплификации участка кДНК G-гена вируса бешенства и технологии анализа пиков высокого разрешения для графиков плавления продуктов ПЦР.A comparative analysis with the prototype allows us to conclude that the novelty and inventive step of the claimed invention lies in the use of the real-time PCR method, the original specific oligonucleotide primers F2-RabV 333 and R2-RabV 333 , designed to amplify the cDNA section of the G-gene of the rabies virus and high-resolution peak analysis technologies for melting plots of PCR products.
Сущность предлагаемого изобретения пояснена на графическом материале - Анализ кривых плавления при анализе пяти пар олигонуклеотидных праймеров для вируса бешенства штаммов «ВНИИЗЖ-G333» и «РВ-97» (фиг. 2).The essence of the proposed invention is illustrated in graphic material - Analysis of melting curves when analyzing five pairs of oligonucleotide primers for the rabies virus strains “ARRIAH-G333” and “RV-97” (Fig. 2).
На основном этапе исследования проводят выделение нуклеиновой кислоты из анализируемых образцов, содержащих вирус бешенства с применением твердофазного способа с использованием набора «РИБО-сорб» в соответствии с инструкцией производителя («Интерлабсервис»).At the main stage of the study, nucleic acid is isolated from analyzed samples containing the rabies virus using a solid-phase method using the RIBO-sorb kit in accordance with the manufacturer’s instructions (Interlabservice).
На следующем этапе проводят ПЦР в режиме реального времени для исследования стандартных образцов и проб. Стандартными образцами являются положительные контроли, представляющие собой индивидуальные суспензии вируса бешенства штаммов «ВНИИЗЖ-G333» и «РВ-97». В качестве отрицательного контроля используют деионизированную воду без нуклеаз MilliQ. Проводят обратную транскрипцию с применением следующих реагентов: деионизированная вода - 50 мкл, буфер 5-кратный - 20 мкл, дезоксирибонуклеозидтрифосфаты - 10 мкл, праймеры - по 4 мкл, MMLV-ревертаза - 2 мкл, элюат РНК - 12 мкл.At the next stage, real-time PCR is performed to study standard samples and samples. Standard samples are positive controls, which are individual suspensions of the rabies virus strains “ARRIAH-G333” and “RV-97”. MilliQ nuclease-free deionized water was used as a negative control. Reverse transcription is carried out using the following reagents: deionized water - 50 μl, 5-fold buffer - 20 μl, deoxyribonucleoside triphosphates - 10 μl, primers - 4 μl, MMLV-revertase - 2 μl, RNA eluate - 12 μl.
Для постановки ПЦР в режиме реального времени готовят реакционную смесь в соответствии с наставлением к набору "SsoFast™ EvaGreen® Supermix". Кроме EvaGreen, используют дополнительные компоненты: деионизированная вода - 25 мкл, PCR buffer 10х - 5 мкл, хлорид магния 25 мМ - 5 мкл, праймеры - по 2 мкл, Taq ДНК-полимераза - 1 мкл, кДНК - 6 мкл. Итоговый объем смеси для проведения одной реакции составляет 25 мкл.To perform real-time PCR, prepare the reaction mixture in accordance with the instructions for the "SsoFast™ EvaGreen ® Supermix" kit. In addition to EvaGreen, additional components are used: deionized water - 25 µl, PCR buffer 10x - 5 µl, magnesium chloride 25 mM - 5 µl, primers - 2 µl, Taq DNA polymerase - 1 µl, cDNA - 6 µl. The final volume of the mixture for one reaction is 25 μl.
Постановку обратной транскрипции и ПЦР в режиме реального времени осуществляют в детектирующем термоциклере CFX-96 (Bio-Rad, США) при температурных и временных параметрах, сведения о которых представлены в таблице 4.Reverse transcription and real-time PCR are carried out in a detecting thermal cycler CFX-96 (Bio-Rad, USA) under temperature and time parameters, information about which is presented in Table 4.
Обратную транскрипцию осуществляют при температуре 42°С в течение 20 минут. Предварительную денатурацию проводят при температуре 98°С в течение 2 минут. ПЦР в режиме реального времени включает в себя 3 подэтапа: денатурацию, отжиг олигонуклеотидов, элонгацию. Денатурацию осуществляют при температуре 95°С в течение 5 секунд, отжиг олигонуклеотидов и элонгацию - при температуре 60°С в течение 20 секунд. Далее проводят важный этап для осуществления дифференциального анализа - плавление, начиная с 65 до 90°С.Увеличение температуры составляет - 0,1°С за каждый шаг. При этом после первого шага плавления требуется ждать 90 секунд при температуре первого шага. Для каждого последующего шага время ожидания составляет 2 секунды.Reverse transcription is carried out at 42°C for 20 minutes. Preliminary denaturation is carried out at a temperature of 98°C for 2 minutes. Real-time PCR includes 3 substeps: denaturation, annealing of oligonucleotides, elongation. Denaturation is carried out at a temperature of 95°C for 5 seconds, annealing of oligonucleotides and elongation at a temperature of 60°C for 20 seconds. Next, an important step for carrying out differential analysis is carried out - melting, starting from 65 to 90 ° C. The temperature increase is - 0.1 ° C for each step. In this case, after the first melting step, you need to wait 90 seconds at the temperature of the first step. For each subsequent step, the waiting time is 2 seconds.
Для детекции сигнала устанавливают канал HRM, для которого длина волны источника составляет 460 нм, детектора - 610 нм. В качестве красителя применяется EvaGreen. Данный флуорофор можно анализировать также в системе детекции с длиной волны 488 нм по рекомендации производителя набора "SsoFast™ EvaGreen® Supermix".To detect the signal, an HRM channel is installed, for which the source wavelength is 460 nm, the detector wavelength is 610 nm. EvaGreen is used as a dye. This fluorophore can also be analyzed in a detection system with a wavelength of 488 nm as recommended by the manufacturer of the SsoFast™ EvaGreen ® Supermix kit.
Исследование кривой плавления с высоким разрешением для анализа данных и профилей плавления образцов выполняют с использованием программного обеспечения для сканирования генов того детектирующего амплификатора, на котором осуществляют реакцию амплификации и процесс плавления (в частности, CFX 96). Проводят построение кривых плавления в виде параболических функций и детектируют пики высокого разрешения для полученных графиков. Выявляют, что для вакцинных штаммов «ВНИИЗЖ-G333» и «РВ-97» характерны определенные, очень узкие диапазоны температуры плавления, по данным которых можно судить о принадлежности исследуемого образца к одному из указанных производственных штаммов вируса бешенства.High-resolution melting curve studies for data analysis and melting profiles of samples are performed using gene scanning software from the detection cycler on which the amplification reaction and melting process is carried out (specifically CFX 96). Melting curves are plotted in the form of parabolic functions and high-resolution peaks are detected for the resulting graphs. It is revealed that the vaccine strains “ARRIAH-G333” and “RV-97” are characterized by certain, very narrow melting temperature ranges, according to which one can judge whether the test sample belongs to one of the specified production strains of the rabies virus.
Сущность предлагаемого изобретения пояснена примерами его исследования, которые не ограничивают объем изобретения.The essence of the proposed invention is illustrated by examples of its research, which do not limit the scope of the invention.
Пример 1. Разработка оригинальных олигонуклеотидных праймеров для способа дифференциации генома генетически модифицированного штамма «ВНИИЗЖ-G333» от вакцинного штамма «РВ-97» вируса бешенства методом полимеразной цепной реакции в режиме реального времени с анализом пиков высокого разрешения.Example 1. Development of original oligonucleotide primers for a method of differentiating the genome of the genetically modified strain "ARRIAH-G333" from the vaccine strain "RV-97" of the rabies virus using real-time polymerase chain reaction with high-resolution peak analysis.
Для разработки оригинальных специфичных олигонуклеотидных праймеров для использования в способе дифференциации генома генетически модифицированного штамма «ВНИИЗЖ-G333» от вакцинного штамма «РВ-97» вируса бешенства методом полимеразной цепной реакции в режиме реального времени с анализом пиков высокого разрешения проводили подборку и анализ выравнивания последовательностей G-гена вируса бешенства штаммов «ВНИИЗЖ-G333» и «РВ-97», а также полевых изолятов (всего 26). Эти последовательности выравнивали с помощью сервиса BioEdit. Анализ позволил идентифицировать область с 1054…1056-нуклеотидными заменами GAA на GAA, уникальной для вакцинного штамма «ВНИИЗЖ-G333». Данная замена была обнаружена в результате сравнительного анализа, проведенного с помощью программы BioEdit и MEGA7.To develop original specific oligonucleotide primers for use in the method of differentiating the genome of the genetically modified strain "ARRIAH-G333" from the vaccine strain "RV-97" of the rabies virus using real-time polymerase chain reaction with analysis of high-resolution peaks, a selection and analysis of the alignment of G sequences was carried out -gene of rabies virus strains “ARRIAH-G333” and “RV-97”, as well as field isolates (26 in total). These sequences were aligned using the BioEdit service. The analysis made it possible to identify a region with 1054...1056 nucleotide substitutions of GAA to GAA, unique to the vaccine strain ARRIAH-G333. This substitution was discovered as a result of a comparative analysis carried out using the BioEdit and MEGA7 programs.
В результате сравнительного анализа был выбран регион в диапазоне 950…1131 п.н. именно G-гена, поскольку именно данная область позволила разработать прямой и обратный олигонуклеотидные праймеры для однозначной дифференциации штаммов «ВНИИЗЖ-G333» и «РВ-97» вируса бешенства для оценки в анализе в ПЦР с помощью пиков высокого разрешения. Были разработаны праймеры, которые были гомологичны выбранным последовательностям и позволили проводить амплификацию фрагментов G-гена кДНК вируса бешенства. Изначально было создано 5 пар праймеров, но остановились на трех, представленных ниже:As a result of the comparative analysis, a region in the range of 950...1131 bp was selected. specifically the G-gene, since it was this region that made it possible to develop forward and reverse oligonucleotide primers for unambiguous differentiation of the “ARRIAH-G333” and “RV-97” strains of the rabies virus for evaluation in PCR analysis using high-resolution peaks. Primers were developed that were homologous to the selected sequences and allowed amplification of G gene fragments of the rabies virus cDNA. Initially, 5 pairs of primers were created, but we settled on the three presented below:
F1-RabV333 - 5'-TGATGGAGGCTGAGGCTCAC-3' иF1-RabV 333 - 5'-TGATGGAGGCTGAGGCTCAC-3' and
R1-RabV333 - 5'-ACATGAGGATGACACCTCCCT-3',R1-RabV 333 - 5'-ACATGAGGATGACACCTCCCT-3',
F2-RabV333 - 5'-AGGCTGAGGCTCACTACAAG-3' и F2-RabV 333 - 5'-AGGCTGAGGCTCACTACAAG-3' and
R2-RabV333 - 5'-CCCTTCGACTCTTAAACACCCT-3',R2-RabV 333 - 5'-CCCTTCGACTCTTAAACACCCT-3',
F5-RabV333 - 5'-CCCTTCGACTCTTAAACACCCT-3' иF5-RabV 333 - 5'-CCCTTCGACTCTTAAACACCCT-3' and
R5-RabV333 - 5'-AACACCCTTTTGAGGGG-3'.R5-RabV 333 - 5'-AACACCCTTTGAGGGG-3'.
Для подтверждения возможности применения разработанных праймеров в анализе пиков высокого разрешения для дифференциации штаммов «ВНИИЗЖ-G333» и «РВ-97» вируса бешенства провели моделирование in-silico с предсказанными ампликонами для анализируемых последовательностей нуклеотидов, используя программное обеспечение uMelt28. Вышеупомянутые праймеры были отобраны, синтезированы и очищены. Специфичность последовательностей праймеров проверяли с помощью Базового инструмента поиска локального выравнивания (NCBI/Primer-BLAST). При анализе нуклеотидных последовательностей олигонуклеотидов установили, что для праймеров не характерно образование «шпилек», а также не выявлено 3'-комплементарности и сайтов, отжигающих сами на себя. Расчет вероятности образования «шпилек» и димеров олигонуклеотидов проводили при условии, что минимальное количество пар оснований, необходимых для димеризации, - 5, а для образования «шпилек», - 4. Таким образом, были разработаны оригинальные специфичные олигонуклеотидные праймеры, которые могут позволить проводить дифференциацию генома генетически модифицированного штамма «ВНИИЗЖ-G333» от вакцинного штамма «РВ-97» вируса бешенства методом полимеразной цепной реакции в режиме реального времени с анализом пиков высокого разрешения.To confirm the possibility of using the developed primers in the analysis of high-resolution peaks for differentiating the ARRIAH-G333 and RV-97 strains of the rabies virus, in-silico modeling was carried out with predicted amplicons for the analyzed nucleotide sequences using uMelt28 software. The above primers were selected, synthesized and purified. The specificity of the primer sequences was checked using the Basic Local Alignment Search Tool (NCBI/Primer-BLAST). When analyzing the nucleotide sequences of the oligonucleotides, it was found that the primers are not characterized by the formation of “hairpins”, and that 3’-complementarity and self-annealing sites were not detected. Calculation of the probability of the formation of “hairpins” and dimers of oligonucleotides was carried out under the condition that the minimum number of base pairs required for dimerization is 5, and for the formation of “hairpins” - 4. Thus, original specific oligonucleotide primers were developed that can allow differentiation of the genome of the genetically modified strain "ARRIAH-G333" from the vaccine strain "RV-97" of the rabies virus using real-time polymerase chain reaction with high-resolution peak analysis.
Пример 2. Определение пиков высокого разрешения графиков плавления ампликонов для разработки способа дифференциации генома генетически модифицированного штамма «ВНИИЗЖ-G333» от вакцинного штамма «РВ-97» вируса бешенства методом полимеразной цепной реакции в режиме реального времени с анализом пиков высокого разрешения.Example 2. Determination of high-resolution peaks in amplicon melting graphs to develop a method for differentiating the genome of the genetically modified strain “ARRIAH-G333” from the vaccine strain “RV-97” of the rabies virus by polymerase chain reaction in real time with analysis of high-resolution peaks.
Для определения показателей, позволяющих проводить дифференциацию генома генетически модифицированного штамма «ВНИИЗЖ-G333» от вакцинного штамма «РВ-97» вируса бешенства методом полимеразной цепной реакции в режиме реального времени с анализом пиков высокого разрешения, проводили следующие этапы по исследованию штаммов вируса бешенства.To determine the indicators that allow differentiation of the genome of the genetically modified strain "ARRIAH-G333" from the vaccine strain "RV-97" of the rabies virus using the polymerase chain reaction method in real time with analysis of high-resolution peaks, the following stages were carried out in the study of rabies virus strains.
На первом этапе исследования проводили выделение нуклеиновой кислоты из анализируемых образцов, содержащих РНК вируса бешенства, с применением твердофазного способа с использованием набора «РИБО-сорб» в соответствии с инструкцией производителя. Для анализа использовали суспензии вируса бешенства штаммов «ВНИИЗЖ-G333» и «РВ-97» и полевых изолятов.At the first stage of the study, nucleic acid was isolated from analyzed samples containing rabies virus RNA using a solid-phase method using the RIBO-sorb kit in accordance with the manufacturer’s instructions. For the analysis, suspensions of rabies virus strains “ARRIAH-G333” and “RV-97” and field isolates were used.
На следующем этапе осуществляли обратную транскрипцию и ПЦР в режиме реального времени для исследования проб в соответствии с описанием, представленным выше. В реакции амплификации исследовали экстракты ДНК в цельном виде, а также в разведения от 10-1 до 10-4 с шагом 10. Для постановки реакции готовили реакционную смесь в соответствии с наставлением к набору "SsoFast™ EvaGreen® Supermix". Постановку реакции проводили в детектирующем амплификаторе марки CFX-96 (Bio-Rad, США).In the next step, reverse transcription and real-time PCR were performed to examine the samples as described above. In the amplification reaction, DNA extracts were studied in whole form, as well as in dilutions from 10 -1 to 10 -4 with a step of 10. To set up the reaction, a reaction mixture was prepared in accordance with the instructions for the "SsoFast™ EvaGreen ® Supermix" kit. The reaction was carried out in a CFX-96 detection amplifier (Bio-Rad, USA).
Исследование кривой плавления с высоким разрешением для анализа данных и профилей плавления образцов выполняли с использованием программного обеспечения для сканирования генов программного обеспечения CFX-96. Проводили построение кривых плавления в виде параболических функций и детектируют пики высокого разрешения для полученных графиков. Впоследствии провели анализ ожидаемых профилей и пиков плавления прогнозируемых ампликонов для исследуемых изолятов/штаммов с использованием программного обеспечения uMelt. Полученные данные для некоторых исследуемых образцов представлены на фиг. 1 и 2.High-resolution melting curve examination for data analysis and sample melting profiles was performed using CFX-96 software gene scanning software. Melting curves were plotted in the form of parabolic functions and high-resolution peaks were detected for the resulting graphs. Expected profiles and melting peaks of predicted amplicons for the study isolates/strains were subsequently analyzed using uMelt software. The data obtained for some of the studied samples are presented in Fig. 1 and 2.
Анализ пиков высокого разрешения проводили для образцов кДНК вируса бешенства. Изначально обратную транскрипцию и ПЦР в режиме реального времени проводили со всеми 5 парами праймеров (табл. ).High-resolution peak analysis was performed on rabies virus cDNA samples. Initially, reverse transcription and real-time PCR were performed with all 5 primer pairs (Table).
Как показал анализ, наиболее выраженная дифференциация достигается при использовании трех пар праймеров, а именно F1-RabV333 - R1-RabV333, F2-RabV333 - R2-RabV333 и F5-RabV333 - R5-RabV333. Исходя из этого, именно они были выбраны для дальнейшего исследования.As the analysis showed, the most pronounced differentiation is achieved when using three pairs of primers, namely F1-RabV 333 - R1-RabV 333 , F2-RabV 333 - R2-RabV 333 and F5-RabV 333 - R5-RabV 333 . Based on this, they were selected for further research.
Для окончательного отбора оптимальной пары праймеров были проведены дополнительные исследования. Тестировали к ДНК вируса бешенства штаммов «ВНИИЗЖ-G333» и «РВ-97» в 30 повторностях для каждого штамма и каждой пары праймеров. Результаты эксперимента представлены в таблице 5.Additional studies were carried out to finally select the optimal primer pair. We tested the DNA of the rabies virus strains “ARRIAH-G333” and “RV-97” in 30 replicates for each strain and each pair of primers. The results of the experiment are presented in Table 5.
Выявили, что для генно-модифицированного вакцинного штамма «ВНИИЗЖ-G333» вируса бешенства в отличии от других штаммов и изолятов характерен очень узкий диапазон температуры плавления, равный 80,28±0,07°С (n=30, p<0,005). При этом для штамма «РВ-97» вируса бешенства данные значения составили 81,40±0,09°С (n=30, р<0,005). Разность температур (ΔT) составила 1,12°±0,16°С при использовании второй пары праймеров F2-RabV333 - R2-RabV333. По полученным данным можно судить о принадлежности исследуемого образца к вакцинному штамму «ВНИИЗЖ-G333» или «РВ-97» вируса бешенства. При использовании пар праймеров F1-RabV333 - R1-RabV333 и F5-RabV333 - R5-RabV333 значения ΔТ были ниже 0,75±0,25 и 0,82±0,23°С, соответственно. При большем различии температурных пиков для двух штаммов - выше специфичность и достоверность проводимого анализа на этапе контроля вируссодержащего материала. При анализе полевых изолятов пиковые значения температур выходили за пределы рассматриваемых показаний, что подтверждало специфичность разработанного способа относительно генно-модифицированного штамма «ВНИИЗЖ-G333».It was found that the genetically modified vaccine strain “ARRIAH-G333” of the rabies virus, unlike other strains and isolates, is characterized by a very narrow melting temperature range of 80.28±0.07°C (n=30, p<0.005). Moreover, for the RV-97 strain of the rabies virus, these values were 81.40±0.09°C (n=30, p<0.005). The temperature difference (ΔT) was 1.12°±0.16°C when using the second pair of primers F2-RabV 333 - R2-RabV 333 . Based on the data obtained, one can judge whether the test sample belongs to the vaccine strain “ARRIAH-G333” or “RV-97” of the rabies virus. When using the primer pairs F1-RabV 333 - R1-RabV 333 and F5-RabV 333 - R5-RabV 333 , the ΔT values were below 0.75±0.25 and 0.82±0.23°C, respectively. With a greater difference in temperature peaks for two strains, the specificity and reliability of the analysis at the stage of monitoring virus-containing material is higher. When analyzing field isolates, peak temperature values exceeded the limits of the considered readings, which confirmed the specificity of the developed method relative to the genetically modified strain “ARRIAH-G333”.
Таким образом, для штамма «ВНИИЗЖ-G333» пик график плавления отличается от штамма «РВ-97» вируса бешенства. Это указывало на возможность применения разработанного способа для дифференциации генома генетически модифицированного штамма «ВНИИЗЖ-G333» от вакцинного штамма «РВ-97» вируса бешенства методом полимеразной цепной реакции в режиме реального времени с анализом пиков высокого разрешения.Thus, for the ARRIAH-G333 strain, the peak melting schedule differs from the RV-97 strain of the rabies virus. This indicated the possibility of using the developed method for differentiating the genome of the genetically modified strain “ARRIAH-G333” from the vaccine strain “RV-97” of the rabies virus using the polymerase chain reaction method in real time with high-resolution peak analysis.
Пример 3. Исследование аналитической специфичности разработанного способа дифференциации генома генетически модифицированного штамма «ВНИИЗЖ-G333» от вакцинного штамма «РВ-97» вируса бешенства методом полимеразной цепной реакции в режиме реального времени с анализом пиков высокого разрешения.Example 3. Study of the analytical specificity of the developed method for differentiating the genome of the genetically modified strain "ARRIAH-G333" from the vaccine strain "RV-97" of the rabies virus using real-time polymerase chain reaction with high-resolution peak analysis.
Специфичность анализа дифференциации генома генетически модифицированного штамма «ВНИИЗЖ-G333» от вакцинного штамма «РВ-97» вируса бешенства методом полимеразной цепной реакции в режиме реального времени с анализом пиков высокого разрешения со второй системой оригинальных праймеров оценивали путем тестирования 8 экстрактов ДНК от других патогенов жвачных животных (2 изолята вируса герпеса крупного рогатого скота - BOHV-1 404/2018, BOHV-2 95-5/2016; 3 биоматериала, содержащего Mycoplasma capricolum ssp., 3 суспензии кДНК от разных изолятов вируса чумы мелких жвачных животных - PPRV/Israel-2536/Hebron/1997, clone Karth99, clone Chirg98). Для проведения исследования использовали детектирующий амплификатор марки CFX-96 (Bio-Rad, США). В результате исследования амплификация с неспецифичными нуклеиновыми кислотами других инфекционных агентов не была обнаружена (табл. 6).The specificity of the analysis of genome differentiation of the genetically modified strain "ARRIAH-G333" from the vaccine strain "RV-97" of the rabies virus using real-time polymerase chain reaction with analysis of high-resolution peaks with a second system of original primers was assessed by testing 8 DNA extracts from other ruminant pathogens animals (2 isolates of bovine herpes virus - BOHV-1 404/2018, BOHV-2 95-5/2016; 3 biomaterials containing Mycoplasma capricolum ssp., 3 cDNA suspensions from different isolates of peste des petits ruminants virus - PPRV/Israel -2536/Hebron/1997, clone Karth99, clone Chirg98). To conduct the study, a detection amplifier of the CFX-96 brand (Bio-Rad, USA) was used. As a result of the study, amplification with nonspecific nucleic acids of other infectious agents was not detected (Table 6).
В результате исследования обнаружили, что для проб, не содержащих нуклеиновую кислоту вируса бешенства, и отрицательного контроля не формировали графики плавления и не были обнаружены пиковые значения при анализе высокого разрешения. При исследовании положительного контроля 1 обнаружен пик температуры, равный 80,28±0,07°С, положительного контроля 2 - 81,40±0,09°С (n=3, р<0,005). Таким образом, полученные результаты свидетельствовали о 100%-ной специфичности разработанного способа дифференциации генома генетически модифицированного штамма «ВНИИЗЖ-G333» от вакцинного штамма «РВ-97» вируса бешенства методом полимеразной цепной реакции в режиме реального времени с анализом пиков высокого разрешения.The study found that samples without rabies virus nucleic acid and negative controls did not generate melting curves and did not show peak values in high-resolution analysis. When studying positive control 1, a peak temperature was found equal to 80.28±0.07°C, positive control 2 - 81.40±0.09°C (n=3, p<0.005). Thus, the results obtained indicated 100% specificity of the developed method for differentiating the genome of the genetically modified strain “ARRIAH-G333” from the vaccine strain “RV-97” of the rabies virus using the polymerase chain reaction method in real time with high-resolution peak analysis.
Пример 4. Определение диагностических показателей разработанного способа дифференциации генома генетически модифицированного штамма «ВНИИЗЖ-G333» от вакцинного штамма «РВ-97» вируса бешенства методом полимеразной цепной реакции в режиме реального времени с анализом пиков высокого разрешения.Example 4. Determination of diagnostic indicators of the developed method for differentiating the genome of the genetically modified strain "ARRIAH-G333" from the vaccine strain "RV-97" of the rabies virus using the polymerase chain reaction method in real time with analysis of high-resolution peaks.
Для исследования разработанного способа дифференциации генома генетически модифицированного штамма «ВНИИЗЖ-G333» от вакцинного штамма «РВ-97» вируса бешенства методом полимеразной цепной реакции в режиме реального времени с анализом пиков высокого разрешения исследовали стандартные диагностические показатели. Для определения диагностической чувствительности разработанного способа анализировали 152 суспензии вируса бешенства штамма «ВНИИЗЖ-G333» с титрами инфекционной активности 5,5-8,5 lg ККИД50/см3, которые являлись заведомо положительными. Постановку обратной транскрипции и ПЦР в режиме реального времени с последующим плавлением ампликонов проводили с системой разработанных оригинальных праймеров F2-RabV333 - R2-RabV333. С помощью разработанного способа (предлагаемое изобретение) определили, что из 152 исследуемых образцов вируса бешенства штамма «ВНИИЗЖ-G333» все определены в качестве положительных и подтверждено наличие именно данного штамма в анализируемых суспензиях.To study the developed method for differentiating the genome of the genetically modified strain "ARRIAH-G333" from the vaccine strain "RV-97" of the rabies virus using real-time polymerase chain reaction with analysis of high-resolution peaks, standard diagnostic indicators were studied. To determine the diagnostic sensitivity of the developed method, 152 suspensions of the rabies virus strain “ARRIAH-G333” with infectious activity titers of 5.5-8.5 lg KKID 50 /cm 3 , which were obviously positive, were analyzed. Reverse transcription and real-time PCR followed by amplicon melting were carried out with the system of developed original primers F2-RabV 333 - R2-RabV 333 . Using the developed method (the proposed invention), it was determined that out of 152 studied samples of the rabies virus strain “ARRIAH-G333”, all were identified as positive and the presence of this particular strain in the analyzed suspensions was confirmed.
Для исследования специфичности метода тестировали 122 суспензии вируса бешенства других штаммов и изолятов, в том числе вакцинного штамма «РВ-97». С помощью метода секвенирования доказана видовая принадлежность указанных изолятов и штаммов. В результате исследования с помощью разработанного способа (предлагаемое изобретение) определили, что все 122 пробы содержали геном вируса бешенства, но при этом не включали в свой состав вакцинный штамм «ВНИИЗЖ-G333». Пользуясь представленными выше статистическими методами анализа определили, что в 95%-ном доверительном интервале диагностическая чувствительность (DSe) составила 97,60-100,00%, диагностическая специфичность (DSp) - 97,02-100,0%, k-критерий - 1,000; прогностичность положительного результата (PPV) - 100%, прогностичность отрицательного результата (NPV) - 100,00%, общая точность (DAc) - 98,66-100,00% (табл. 7).To study the specificity of the method, 122 suspensions of the rabies virus of other strains and isolates, including the RV-97 vaccine strain, were tested. Using the sequencing method, the species identity of these isolates and strains was proven. As a result of the study using the developed method (the proposed invention), it was determined that all 122 samples contained the genome of the rabies virus, but did not include the vaccine strain “ARRIAH-G333”. Using the statistical methods of analysis presented above, we determined that in the 95% confidence interval, diagnostic sensitivity (DSe) was 97.60-100.00%, diagnostic specificity (DSp) - 97.02-100.0%, k-test - 1,000; positive predictive value (PPV) - 100%, negative predictive value (NPV) - 100.00%, overall accuracy (DAc) - 98.66-100.00% (Table 7).
Основными преимуществами предлагаемого изобретения является возможность проводить за короткий промежуток времени (не более 3 ч) дифференциацию генома генетически модифицированного штамма «ВНИИЗЖ-G333» от вакцинного штамма «РВ-97» вируса бешенства методом полимеразной цепной реакции в режиме реального времени с анализом пиков высокого разрешения. Разработанный способ впервые применили для решения данной задачи. Выявили, что в анализируемом участке кДНК вируса бешенства штамма «ВНИИЗЖ-G333» в позициях 1054…1056 п.н. имеется тройная нуклеотидная замена GAA на GAA, уникальная для вакцинного штамма «ВНИИЗЖ-G333», что позволило разработать специфические олигонуклеотидные праймеры F2-RabV333 - R2-RabV333 для детекции данного участка кДНК G-гена с помощью ПЦР в режиме реального времени с последующим анализом температур плавления для анализируемых проб вируса. Впервые представлена дифференциация генома генетически модифицированного штамма «ВНИИЗЖ-G333» от вакцинного штамма «РВ-97» вируса бешенства методом полимеразной цепной реакции в режиме реального времени с анализом пиков высокого разрешения.The main advantages of the proposed invention is the ability to differentiate the genome of the genetically modified strain "ARRIAH-G333" from the vaccine strain "RV-97" of the rabies virus in a short period of time (no more than 3 hours) using the polymerase chain reaction method in real time with high-resolution peak analysis . The developed method was used for the first time to solve this problem. It was revealed that in the analyzed section of the cDNA of the rabies virus strain “ARRIAH-G333” in positions 1054...1056 bp. There is a triple nucleotide substitution of GAA with GAA, unique for the vaccine strain "ARRIAH-G333", which made it possible to develop specific oligonucleotide primers F2-RabV 333 - R2-RabV 333 for detection of this G-gene cDNA region using real-time PCR followed by analysis of melting temperatures for the analyzed virus samples. For the first time, the differentiation of the genome of the genetically modified strain "ARRIAH-G333" from the vaccine strain "RV-97" of the rabies virus using real-time polymerase chain reaction with high-resolution peak analysis is presented.
Разработанный способ дифференциации генома генетически модифицированного штамма «ВНИИЗЖ-G333» от вакцинного штамма «РВ-97» вируса бешенства методом полимеразной цепной реакции в режиме реального времени с анализом пиков высокого разрешения характеризуется аналитической специфичностью, равной 100%. В 95%-ном доверительном интервале диагностическая чувствительность для данного способа составляет 97,60-100,00%, диагностическая специфичность - 97,02-100,0%.The developed method for differentiating the genome of the genetically modified strain "ARRIAH-G333" from the vaccine strain "RV-97" of the rabies virus using real-time polymerase chain reaction with high-resolution peak analysis is characterized by an analytical specificity of 100%. In the 95% confidence interval, the diagnostic sensitivity for this method is 97.60-100.00%, the diagnostic specificity is 97.02-100.0%.
Источники информации, принятые во внимание при составлении описания изобретения к заявке на выдачу патента РФ на изобретение «Способ дифференциации генома генетически модифицированного штамма «ВНИИЗЖ-G333» от вакцинного штамма «РВ-97» вируса бешенства методом полимеразной цепной реакции в режиме реального времени с анализом пиков высокого разрешения»:Sources of information taken into account when drawing up the description of the invention for the application for a RF patent for the invention “Method of differentiating the genome of the genetically modified strain “ARRIAH-G333” from the vaccine strain “RV-97” of the rabies virus by real-time polymerase chain reaction with analysis high resolution peaks":
1. Cousins MM, Swan D, Magaret СА, Hoover DR, Eshleman SH. Analysis of HIV using a high resolution melting (HRM) diversity assay: automation of HRM data analysis enhances the utility of the assay for analysis of HIV incidence. PLoS One. 2012;7(12):e51359.1. Cousins MM, Swan D, Magaret SA, Hoover DR, Eshleman SH. Analysis of HIV using a high resolution melting (HRM) diversity assay: automation of HRM data analysis enhances the utility of the assay for analysis of HIV incidence. PLoS One. 2012;7(12):e51359.
2. Erali M, Voelkerding KV, Wittwer CT. High resolution melting applications for clinical laboratory medicine. Exp Mol Pathol. 2008 Aug;85(1):50-8. doi:10.1016/j.yexmp.2008.03.012. Epub 2008 Apr 13. PMID: 18502416; PMCID: PMC2606052.2. Erali M, Voelkerding KV, Wittwer CT. High resolution melting applications for clinical laboratory medicine. Exp Mol Pathol. 2008 Aug;85(1):50-8. doi:10.1016/j.yexmp.2008.03.012. Epub 2008 Apr 13. PMID: 18502416; PMCID: PMC2606052.
3. Structural aspects of rabies virus replication / A. A. Albertini, G. Schoehn, W. Weissenhorn, R.W. Ruigrok // Cell. Mol. Life Sci. - 2008 - 65(2)- P. 282-294.3. Structural aspects of rabies virus replication / A. A. Albertini, G. Schoehn, W. Weissenhorn, R.W. Ruigrok//Cell. Mol. Life Sci. - 2008 - 65(2) - P. 282-294.
4. OIE. Manual of Diagnostic Tests and Vaccines for Terrestrial Animals. - 7th ed. - Paris, 2022. - Vol. 1, Chap. 2.1.17.4. OIE. Manual of Diagnostic Tests and Vaccines for Terrestrial Animals. - 7th ed. - Paris, 2022. - Vol. 1, Chap. 2.1.17.
5. GenBank. URL: https://www.ncbi.nlm.nih.gov/nuccore/EF542830.l. (Дата обращения: 10.01.2023).5. GenBank. URL: https://www.ncbi.nlm.nih.gov/nuccore/EF542830.l. (Date of access: 01/10/2023).
6. Zhou L, Wang L, Palais R, Pryor R, Wittwer CT. High-resolution DNA melting analysis for simultaneous mutation scanning and genotyping in solution. Clin Chem. 2005 Oct;51(10): 1770-7. doi: 10.1373/clinchem.2005.054924. PMID: 16189378.6. Zhou L, Wang L, Palais R, Pryor R, Wittwer CT. High-resolution DNA melting analysis for simultaneous mutation scanning and genotyping in solution. Clin Chem. 2005 Oct;51(10): 1770-7. doi: 10.1373/clinchem.2005.054924. PMID: 16189378.
7. Garritano S, Gemignani F, Voegele C, Nguyen-Dumont T, Le Calvez-Kelm F, De Silva D, Lesueur F, Landi S, Tavtigian SV. Determining the effectiveness of High Resolution Melting analysis for SNP genotyping and mutation scanning at the TP53 locus. BMC Genet. 2009 Feb 17;10:5. doi: 10.1186/1471-2156-10-5. PMID: 19222838; PMCID: PMC2648999.7. Garritano S, Gemignani F, Voegele C, Nguyen-Dumont T, Le Calvez-Kelm F, De Silva D, Lesueur F, Landi S, Tavtigian SV. Determining the effectiveness of High Resolution Melting analysis for SNP genotyping and scanning mutation at the TP53 locus. BMC Genet. 2009 Feb 17;10:5. doi:10.1186/1471-2156-10-5. PMID: 19222838; PMCID: PMC2648999.
8. Babiuk S, Bowden TR, Boyle DB, Wallace DB, Kitching RP. Capripoxviruses: An Emerging Worldwide Threat to Sheep, Goats and Cattle. Transbound. Emerg. Dis. 2008;55:263-272.8. Babiuk S, Bowden TR, Boyle DB, Wallace DB, Kitching RP. Capripoxviruses: An Emerging Worldwide Threat to Sheep, Goats and Cattle. Transbound. Emerg. Dis. 2008;55:263-272.
9. Broyles S.S.J. Vaccinia virus transcription, 84 (9) (2003), pp. 2293-2303.9. Broyles S.S.J. Vaccinia virus transcription, 84 (9) (2003), pp. 2293-2303.
10. Er TK, Chang JG. High-resolution melting: applications in genetic disorders. Clin Chim Acta. 2012 Dec 24;414:197-201.10. Er TK, Chang JG. High-resolution melting: applications in genetic disorders. Clin Chim Acta. 2012 Dec 24;414:197-201.
1l .Huebner С, Weber R, Lloydd R. A HRM assay for identification of low level BRAF V600E and V600K mutations using the CADMA principle in FFPE specimens. Pathology. 2017 Dec;49(7):776-783.1l .Huebner S, Weber R, Lloyd R. A HRM assay for identification of low level BRAF V600E and V600K mutations using the CADMA principle in FFPE specimens. Pathology. 2017 Dec;49(7):776-783.
12. Hussmann D, Hansen LL. Methylation-Sensitive High Resolution Melting (MS-HRM). Methods Mol Biol. 2018;1708:551-571.12. Hussmann D, Hansen LL. Methylation-Sensitive High Resolution Melting (MS-HRM). Methods Mol Biol. 2018;1708:551-571.
13. Nikodem D, Clapa T, Narozna D. Technologia HRM-PCR w diagnostyce medycznej [HRM-PCR in medical diagnostic]. Postepy Biochem. 2021 Mar 4;67(1):59-63. Polish, doi: 10.18388/pb.2021_373. PMID: 34378898.13. Nikodem D, Clapa T, Narozna D. Technologia HRM-PCR w diagnostyce medycznej [HRM-PCR in medical diagnostic]. Postepy Biochem. 2021 Mar 4;67(1):59-63. Polish, doi: 10.18388/pb.2021_373. PMID: 34378898.
14. Pakbin B, Basti AA, Khanjari A, Brück WM, Azimi L, Karimi A. Development of high-resolution melting (HRM) assay to differentiate the species of Shigella isolates from stool and food samples. Sci Rep.2022 Jan 10;12(1):473.14. Pakbin B, Basti AA, Khanjari A, Brück WM, Azimi L, Karimi A. Development of high-resolution melting (HRM) assay to differentiate the species of Shigella isolates from stool and food samples. Sci Rep.2022 Jan 10;12(1):473.
15. Robinson CV, Uren Webster TM, Consuegra S. Data on optimisation of a multiplex HRM-qPCR assay for native and invasive crayfish as well as the crayfish plague in four river catchments. Data Brief. 2018 May 29; 19:1092-1109.15. Robinson CV, Uren Webster TM, Consuegra S. Data on optimization of a multiplex HRM-qPCR assay for native and invasive crayfish as well as the crayfish plague in four river catchments. Data Brief. 2018 May 29; 19:1092–1109.
16. Dwight Z, Palais R, Wittwer CT. uMELT: prediction of high-resolution melting curves and dynamic melting profiles of PCR products in a rich web application. Bioinformatics. 2011 Apr 1;27(7):1019-1020.16. Dwight Z, Palais R, Wittwer CT. uMELT: prediction of high-resolution melting curves and dynamic melting profiles of PCR products in a rich web application. Bioinformatics. 2011 Apr 1;27(7):1019-1020.
Примечание: термодинамические параметры разработанных олигонуклеотидных праймеров рассчитаны при условии:Note: the thermodynamic parameters of the developed oligonucleotide primers are calculated under the condition:
концентрация NaCl 1 М,NaCl concentration 1 M,
температура 25°С,temperature 25°C,
водородный показатель (рН) 7,0.pH value (pH) 7.0.
Примечание: «+» - наличие характерного графика плавления ампликонов,Note: “+” - presence of a characteristic amplicon melting graph,
«-» - отсутствие графика по результатам ПЦР-РВ с анализом пиков высокого разрешения.“-” - absence of a graph based on RT-PCR results with analysis of high-resolution peaks.
Примечание: DSe - диагностическая чувствительность,Note: DSe - diagnostic sensitivity,
DSp - диагностическая специфичность,DSp - diagnostic specificity,
k-критерий - индекс Каппа Коэна,k-criterion - Cohen's Kappa index,
PPV - прогностичность положительного результата,PPV - predictive value of a positive result,
NPV - прогностичность отрицательного результата,NPV - predictive value of a negative result,
DAc - общая точность.DAc - overall accuracy.
--->--->
<?xml version="1.0" encoding="UTF-8"?><?xml version="1.0" encoding="UTF-8"?>
<!DOCTYPE ST26SequenceListing PUBLIC "-//WIPO//DTD Sequence Listing <!DOCTYPE ST26SequenceListing PUBLIC "-//WIPO//DTD Sequence Listing
1.3//EN" "ST26SequenceListing_V1_3.dtd">1.3//EN" "ST26SequenceListing_V1_3.dtd">
<ST26SequenceListing dtdVersion="V1_3" fileName="RABV.xml" <ST26SequenceListing dtdVersion="V1_3" fileName="RABV.xml"
softwareName="WIPO Sequence" softwareVersion="2.1.2" softwareName="WIPO Sequence" softwareVersion="2.1.2"
productionDate="2023-08-01">productionDate="2023-08-01">
<ApplicationIdentification> <ApplicationIdentification>
<IPOfficeCode>RU</IPOfficeCode> <IPOfficeCode>RU</IPOfficeCode>
<ApplicationNumberText>0</ApplicationNumberText> <ApplicationNumberText>0</ApplicationNumberText>
<FilingDate>2023-03-11</FilingDate> <FilingDate>2023-03-11</FilingDate>
</ApplicationIdentification> </ApplicationIdentification>
<ApplicantFileReference>493</ApplicantFileReference> <ApplicantFileReference>493</ApplicantFileReference>
<EarliestPriorityApplicationIdentification> <EarliestPriorityApplicationIdentification>
<IPOfficeCode>RU</IPOfficeCode> <IPOfficeCode>RU</IPOfficeCode>
<ApplicationNumberText>0</ApplicationNumberText> <ApplicationNumberText>0</ApplicationNumberText>
<FilingDate>2023-03-11</FilingDate> <FilingDate>2023-03-11</FilingDate>
</EarliestPriorityApplicationIdentification> </EarliestPriorityApplicationIdentification>
<ApplicantName languageCode="ru">ФГБУ "Федеральный центр охраны <ApplicantName languageCode="ru">FSBI "Federal Security Center"
здоровья животных" (ФГБУ "ВНИИЗЖ")</ApplicantName>animal health" (FSBI "ARRIAH")</ApplicantName>
<ApplicantNameLatin>FGBI "ARRIAH"</ApplicantNameLatin> <ApplicantNameLatin>FGBI "ARRIAH"</ApplicantNameLatin>
<InventorName languageCode="ru">Чупин Сергей <InventorName languageCode="ru">Chupin Sergey
Александрович</InventorName>Alexandrovich</InventorName>
<InventorNameLatin> Chupin Sergey Alexandrovich</InventorNameLatin> <InventorNameLatin> Chupin Sergey Alexandrovich</InventorNameLatin>
<InventionTitle languageCode="ru">Способ дифференциации генома <InventionTitle languageCode="en">Method of genome differentiation
генетически модифицированного штамма «ВНИИЗЖ-G333» от вакцинного genetically modified strain "ARRIAH-G333" from the vaccine
штамма «РВ-97» вируса бешенства методом полимеразной цепной реакции в strain "RV-97" of the rabies virus by polymerase chain reaction in
режиме реального времени с анализом пиков высокого real-time with analysis of high peaks
разрешения</InventionTitle>permissions</InventionTitle>
<SequenceTotalQuantity>2</SequenceTotalQuantity> <SequenceTotalQuantity>2</SequenceTotalQuantity>
<SequenceData sequenceIDNumber="1"> <SequenceData sequenceIDNumber="1">
<INSDSeq> <INSDSeq>
<INSDSeq_length>1650</INSDSeq_length> <INSDSeq_length>1650</INSDSeq_length>
<INSDSeq_moltype>DNA</INSDSeq_moltype> <INSDSeq_moltype>DNA</INSDSeq_moltype>
<INSDSeq_division>PAT</INSDSeq_division> <INSDSeq_division>PAT</INSDSeq_division>
<INSDSeq_feature-table> <INSDSeq_feature-table>
<INSDFeature> <INSDFeature>
<INSDFeature_key>source</INSDFeature_key> <INSDFeature_key>source</INSDFeature_key>
<INSDFeature_location>1..1650</INSDFeature_location> <INSDFeature_location>1..1650</INSDFeature_location>
<INSDFeature_quals> <INSDFeature_quals>
<INSDQualifier> <INSDQualifier>
<INSDQualifier_name>mol_type</INSDQualifier_name> <INSDQualifier_name>mol_type</INSDQualifier_name>
<INSDQualifier_value>genomic DNA</INSDQualifier_value> <INSDQualifier_value>genomic DNA</INSDQualifier_value>
</INSDQualifier> </INSDQualifier>
<INSDQualifier id="q1"> <INSDQualifier id="q1">
<INSDQualifier_name>organism</INSDQualifier_name> <INSDQualifier_name>organism</INSDQualifier_name>
<INSDQualifier_value>FMDV</INSDQualifier_value> <INSDQualifier_value>FMDV</INSDQualifier_value>
</INSDQualifier> </INSDQualifier>
</INSDFeature_quals> </INSDFeature_quals>
</INSDFeature> </INSDFeature>
</INSDSeq_feature-table> </INSDSeq_feature-table>
<INSDSeq_sequence>aggaaagatggttcctcaggctctcctgtttgtaccccttctggttttt <INSDSeq_sequence>aggaaagatggttcctcaggctctcctgtttgtaccccttctggttttt
ccattgtgttttgggaaattccctatttacacgataccagacaagcttggtccctggagcccgattgacaccattgtgttttgggaaattccctatttacacgataccagacaagcttggtccctggagcccgattgaca
tacatcacctcagctgcccaaacaatttggtagtggaggacgaaggatgcaccaacctgtcagggttctctacatcacctcagctgcccaaacaatttggtagtggaggacgaaggatgcaccaacctgtcagggttctc
ctacatggaactaaaagttggatacatcttagccataaaaatgaacgggttcacttgcacaggcgttgtgctacatggaactaaaagttggatacatcttagccataaaaatgaacgggttcacttgcacaggcgttgtg
acggaggctgaaacctacactaacttcgttggttatgtcacaaccacgttcaaaagaaagcatttccgccacggaggctgaaacctacactaacttcgttggttatgtcacaaccacgttcaaaagaaagcatttccgcc
caacaccagatgcatgtagagccgcgtacaactggaagatggccggtgaccccagatatgaagagtctctcaacaccagatgcatgtagagccgcgtacaactggaagatggccggtgaccccagatatgaagagtctct
acaaaatccgtaccctgactaccgctggcttcgaactgtaaaaaccaccaaggagtctctcgttatcataacaaaatccgtaccctgactaccgctggcttcgaactgtaaaaaccaccaaggagtctctcgttatcata
tctccaagtgtggcagatttggacccatatgacagatcccttcactcgagggtcttccctagcgggaagttctccaagtgtggcagatttggacccatatgacagatcccttcactcgaggtcttccctagcgggaagt
gctcgggagtagcggtgtcttctacctactgctccactaaccacgattacaccatttggatgcccgagaagctcgggagtagcggtgtcttctacctactgctccactaaccacgattacaccatttggatgcccgagaa
tccgagactagggatgtcttgtgacatttttaccaatagtagagggaagagagcatccaaagggagtgagtccgagactagggatgtcttgtgacattttaccaatagtagagggaagagagcatccaaagggagtgag
acttgcggctttgtagatgaaagaggcctatataagtctttaaaaggagcatgcaaactcaagttatgtgacttgcggctttgtagatgaaagaggcctatataagtcttttaaaaggagcatgcaaactcaagttatgtg
gagttctaggacttagacttatggatggaacatgggtcgcgatgcaaacatcaaatgaaaccaaatggtggagttctaggacttagacttatggatggaacatgggtcgcgatgcaaacatcaaatgaaaccaaatggtg
ccctcccgatcagttggtgaacctgcacgactttcactcagacgaaattgagcaccttgttgtagaggagccctcccgatcagttggtgaacctgcacgactttcactcagacgaaattgagcaccttgttgtagaggag
ttggtcaggaagagagaggagtgtctggatgcactagagtccatcatgacaaccaagtcagtgagtttcattggtcaggaagagagaggagtgtctggatgcactagagtccatcatgacaaccaagtcagtgagtttca
gacgtctcagtcatttaagaaaacttgtccctgggtttggaaaagcatataccatattcaacaagaccttgacgtctcagtcatttaagaaaacttgtccctgggtttggaaaagcatataccatattcaacaagacctt
gatggaagccgatgctcactacaagtcagtcgagacttggaatgagatcatcccttcaaaagggtgtttagatggaagccgatgctcactacaagtcagtcgagacttggaatgagatcatcccttcaaaagggtgttta
agagttggggggaggtgtcatcctcatgtgaacggggtgtttttcaatggtataatattaggacctgacgagagttggggggaggtgtcatcctcatgtgaacggggtgtttttcaatggtataatattaggacctgacg
gcaatgtcttaatcccagagatgcaatcatccctcctccagcaacatatggagttgttggaatcctcggtgcaatgtcttaatcccagagatgcaatcatccctcctccagcaacatatggagttgttggaatcctcggt
tatcccccttgtgcaccccctggcagacccgtctaccattttcaaggacggtgacgaggccgaggatttttatcccccttgtgcaccccctggcagacccgtctaccattttcaaggacggtgacgaggccgaggatttt
gttgaagttcaccttcccgatgtgcacaatcaggtctcaggagttgacttgggtctcccgaactgggggagttgaagttcaccttcccgatgtgcacaatcaggtctcaggagttgacttgggtctcccgaactggggga
agtatgtattactgagtgcaggggccctgactgccttgatgttgataattttcctgatgacatgttgtagagtatgtattactgagtgcaggggccctgactgccttgatgttgataattttcctgatgacatgttgtag
aagagtcaatcgatcagaacctacgcaacacaatctcagagggacagggagggaggtgtcagtcactcccaagagtcaatcgatcagaacctacgcaacacaatctcagagggacagggagggaggtgtcagtcactccc
caaagcgggaagatcatatcttcatgggaatcacacaagagtgggggtgagaccagactgtgaggactggcaaagcgggaagatcatatcttcatgggaatcacacaagagtgggggtgagaccagactgtgaggactgg
ccgtcctttcaacgatccaagtcctgaagatcacctccccttggggggttctttttgaaaa</INSDSeqccgtcctttcaacgatccaagtcctgaagatcacctccccttggggggttctttttgaaaa</INSDSeq
_sequence>_sequence>
</INSDSeq> </INSDSeq>
</SequenceData> </SequenceData>
<SequenceData sequenceIDNumber="2"> <SequenceData sequenceIDNumber="2">
<INSDSeq> <INSDSeq>
<INSDSeq_length>550</INSDSeq_length> <INSDSeq_length>550</INSDSeq_length>
<INSDSeq_moltype>AA</INSDSeq_moltype> <INSDSeq_moltype>AA</INSDSeq_moltype>
<INSDSeq_division>PAT</INSDSeq_division> <INSDSeq_division>PAT</INSDSeq_division>
<INSDSeq_feature-table> <INSDSeq_feature-table>
<INSDFeature> <INSDFeature>
<INSDFeature_key>source</INSDFeature_key> <INSDFeature_key>source</INSDFeature_key>
<INSDFeature_location>1..550</INSDFeature_location> <INSDFeature_location>1..550</INSDFeature_location>
<INSDFeature_quals> <INSDFeature_quals>
<INSDQualifier> <INSDQualifier>
<INSDQualifier_name>mol_type</INSDQualifier_name> <INSDQualifier_name>mol_type</INSDQualifier_name>
<INSDQualifier_value>protein</INSDQualifier_value> <INSDQualifier_value>protein</INSDQualifier_value>
</INSDQualifier> </INSDQualifier>
<INSDQualifier id="q2"> <INSDQualifier id="q2">
<INSDQualifier_name>organism</INSDQualifier_name> <INSDQualifier_name>organism</INSDQualifier_name>
<INSDQualifier_value>FMDV</INSDQualifier_value> <INSDQualifier_value>FMDV</INSDQualifier_value>
</INSDQualifier> </INSDQualifier>
</INSDFeature_quals> </INSDFeature_quals>
</INSDFeature> </INSDFeature>
</INSDSeq_feature-table> </INSDSeq_feature-table>
<INSDSeq_sequence>RKDGSSGSPVCTPSGFSIVFWEIPYLHDTRQAWSLEPDHTSPQLPKQFG <INSDSeq_sequence>RKDGSSGSPVCTPSGFSIVFWEIPYLHDTRQAWSLEPDHTSPQLPKQFG
SGGRRMHQPVRVLLHGTKSWIHLSHKNERVHLHRRCDGGNLHLRWLCHNHVQKKAFPPNTRCMSRVQLEDSGGRRMHQPVRVLLHGTKSWIHLSHKNERVHLHRRCDGGNLHLRWLCHNHVQKKAFPPNTRCMSRVQLED
GRPQIRVSTKSVPLPLASNCKNHQGVSRYHISKCGRFGPIQIPSLEGLPREVLGSSGVFYLLLHPRLHHLGRPQIRVSTKSVPLPLASNCKNHQGVSRYHISKCGRFGPIQIPSLEGLPREVLGSSGVFYLLLHPRLHHL
DARESETRDVLHFYQREESIQREDLRLCRKRPIVFKRSMQTQVMWSSRTTYGWNMGRDANIKNQMVPSRSDARESETRDVLHFYQREESIQREDLRLCRKRPIVFKRSMQTQVMWSSRTTYGWNMGRDANIKNQMVPSRS
VGEPARLSSMQTQVMWSSRTTYGWNMGRDANIKNQMVLRRNAPCCRGVGQEERGVSGCTRVHHDNQVSEFVGEPARLSSMQTQVMWSSRTTYGWNMGRDANIKNQMVLRRNAPCCRGVGQEERGVSGCTRVHHDNQVSEF
QTSQSFKKTCPWVWKSIYHIQQDGSRCSLQVSRDLEDHPFKRVFKSWGEVSSSCERGVFQWYNIRTRQCLQTSQSFKKTCPWVWKSIYHIQQDGSRCSLQVSRDLEDHPFKRVFKSWGEVSSSCERGVFQWYNIRTRQCL
NPRDAIIPPPATYGVVGILGYPPCAPPGRPVYHFQGRRGRGFCSSPSRCAQSGLRSLGSPELGEVCITECNPRDAIIPPPATYGVVGILGYPPCAPPGRPVYHFQGRRGRGFCSSPSRCAQSGLRSLGSPELGEVCITEC
RGPDCLDVDNFPDDMLKSQSIRTYATQSQRDREGGVSHSPKREDHIFMGITQEWGDQTVRTGRPFNDPSPRGPDCLDVDNFPDDMLKSQSIRTYATQSQRDREGGVSHSPKREDHIFMGITQEWGDQTVRTGRPFNDPSP
EDHLPLGGSFK</INSDSeq_sequence>EDHLPLGGSFK</INSDSeq_sequence>
</INSDSeq> </INSDSeq>
</SequenceData> </SequenceData>
</ST26SequenceListing></ST26SequenceListing>
<---<---
Claims (6)
Publications (1)
| Publication Number | Publication Date |
|---|---|
| RU2812859C1 true RU2812859C1 (en) | 2024-02-05 |
Family
ID=
Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN101565758B (en) * | 2009-06-02 | 2011-08-24 | 武汉三利生物技术有限公司 | Rabies virus detecting fluorescence quantitative PCR kit and application thereof |
| RU2761535C1 (en) * | 2020-11-02 | 2021-12-09 | Федеральное государственное бюджетное учреждение "Федеральный центр охраны здоровья животных" (ФГБУ "ВНИИЗЖ") | Method for indirect determination of the number of infectious doses of rabies virus strain pb -97 in raw materials for attenuated rabies vaccine by reverse transcription and polymerase chain reaction in real time |
Patent Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN101565758B (en) * | 2009-06-02 | 2011-08-24 | 武汉三利生物技术有限公司 | Rabies virus detecting fluorescence quantitative PCR kit and application thereof |
| RU2761535C1 (en) * | 2020-11-02 | 2021-12-09 | Федеральное государственное бюджетное учреждение "Федеральный центр охраны здоровья животных" (ФГБУ "ВНИИЗЖ") | Method for indirect determination of the number of infectious doses of rabies virus strain pb -97 in raw materials for attenuated rabies vaccine by reverse transcription and polymerase chain reaction in real time |
Non-Patent Citations (1)
| Title |
|---|
| Шишков Александр Валерьевич, Пяткина Алла Александровна, Манин Борис Леонидович ДИНАМИКА АДАПТАЦИИ ВИРУСА БЕШЕНСТВА ВАКЦИННОГО ШТАММА "RV-97" К МОНОСЛОЙНОЙ КУЛЬТУРЕ КЛЕТОК ВНК-21/13 // Вестник Ульяновской ГСХА. 2021. N2 (54). * |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| KR102662675B1 (en) | Compositions and methods for detecting biological contaminants | |
| CN106471134B (en) | Methods and products for quantifying RNA transcript variants | |
| KR101394421B1 (en) | Method of detection of classical swine fever | |
| HU230244B1 (en) | Diagnostic assays for parvovirus b19 | |
| Nakagawa et al. | Molecular function analysis of rabies virus RNA polymerase L protein by using an L gene-deficient virus | |
| YU et al. | A conserved motif at the 3′ end of mouse hepatitis virus genomic RNA required for host protein binding and viral RNA replication | |
| Hickman et al. | Influenza A virus negative strand RNA is translated for CD8+ T cell immunosurveillance | |
| CN109837345B (en) | Primer and method for detecting residual DNA of mouse cells | |
| KR102555330B1 (en) | Composition For Detecting SARS-CoV-2, Kit For Detecting the Same and Method of Detecting SARS-CoV-2 Using the Same | |
| RU2812859C1 (en) | Method of differentiating arriah-g333 genome of genetically modified strain from pb-97 vaccine strain of rabies virus using real-time polymerase chain reaction with high-resolution peak analysis | |
| Tong et al. | Quantitative determination of gene expression by competitive reverse transcription–polymerase chain reaction in degraded RNA samples | |
| KR101236197B1 (en) | Differential detection of West nile virus and Japanese encephalitis virus | |
| PH12015501382B1 (en) | High resolution melt genotyping od ibv, csfv and ndv | |
| JP5315519B2 (en) | Koi herpesvirus (KHV) detection method | |
| CN111004869B (en) | Fluorescent quantitative PCR (polymerase chain reaction) primer and reference standard for identifying genetic evolutionary lineages of H1N1 subtype influenza viruses | |
| KR101617142B1 (en) | Nucleic acid test based avian influenza virus detection kit with improved detection accuracy | |
| KR101918342B1 (en) | Methods for detecting hepatitis B virus surface gene non-sense mutations | |
| CN109536644B (en) | AS-PCR primer for identifying canine distemper virus wild strain and vaccine strain and application thereof | |
| RU2786213C1 (en) | Method for differentiating the genome of the nishi vaccine strain from field isolates of sheep pox virus by real-time polymerase chain reaction with high-resolution peak analysis | |
| JP4676063B2 (en) | Gene 62 of attenuated varicella virus Oka strain and identification method of attenuated live varicella vaccine virus strain using this gene 62 | |
| JPWO2005085436A1 (en) | Detection method of carcinogenesis by hepatitis B virus | |
| US20240139306A1 (en) | Methods and compositions for detecting and producing porcine morbillivirus and vaccines thereof | |
| KR101794502B1 (en) | Astrovirus standardized positive control gene and RNA transcripts transcripted therefrom | |
| RU2773654C1 (en) | Method for indirect control of completeness of fmd virus antigen inactivation using nested reverse transcriptase polymerase chain reaction followed by electrophoresis of amplicons in agarose gel | |
| Dinh et al. | In-vitro synthesis of RNA fragments specifying envelope protein gene and RdRp gene of SARS-CoV-2 as positive standards for molecular diagnosis tests |