RU2812211C1 - Test system for determining titer of antibodies against structural proteins of asia-1 n 2356/14/2018 foot-and-mouth disease virus strain using liquid-phase blocking indirect "sandwich" version of elisa - Google Patents
Test system for determining titer of antibodies against structural proteins of asia-1 n 2356/14/2018 foot-and-mouth disease virus strain using liquid-phase blocking indirect "sandwich" version of elisa Download PDFInfo
- Publication number
- RU2812211C1 RU2812211C1 RU2023117627A RU2023117627A RU2812211C1 RU 2812211 C1 RU2812211 C1 RU 2812211C1 RU 2023117627 A RU2023117627 A RU 2023117627A RU 2023117627 A RU2023117627 A RU 2023117627A RU 2812211 C1 RU2812211 C1 RU 2812211C1
- Authority
- RU
- Russia
- Prior art keywords
- foot
- asia
- mouth disease
- disease virus
- virus strain
- Prior art date
Links
- 241000710198 Foot-and-mouth disease virus Species 0.000 title claims abstract description 164
- 238000012360 testing method Methods 0.000 title claims abstract description 59
- 101710172711 Structural protein Proteins 0.000 title claims abstract description 42
- 239000007791 liquid phase Substances 0.000 title claims description 27
- 230000000903 blocking effect Effects 0.000 title claims description 25
- 230000000694 effects Effects 0.000 claims abstract description 18
- 239000000427 antigen Substances 0.000 claims description 56
- 102000036639 antigens Human genes 0.000 claims description 56
- 108091007433 antigens Proteins 0.000 claims description 56
- 238000002965 ELISA Methods 0.000 claims description 53
- 210000002966 serum Anatomy 0.000 claims description 40
- 241001465754 Metazoa Species 0.000 claims description 33
- 238000010790 dilution Methods 0.000 claims description 28
- 239000012895 dilution Substances 0.000 claims description 28
- 239000000243 solution Substances 0.000 claims description 26
- 230000001235 sensitizing effect Effects 0.000 claims description 19
- 210000004369 blood Anatomy 0.000 claims description 15
- 239000008280 blood Substances 0.000 claims description 15
- 241000283973 Oryctolagus cuniculus Species 0.000 claims description 14
- 241000700199 Cavia porcellus Species 0.000 claims description 10
- 108060003951 Immunoglobulin Proteins 0.000 claims description 10
- 102000018358 immunoglobulin Human genes 0.000 claims description 10
- 229940072221 immunoglobulins Drugs 0.000 claims description 10
- 230000005764 inhibitory process Effects 0.000 claims description 10
- 244000309466 calf Species 0.000 claims description 7
- 239000007853 buffer solution Substances 0.000 claims description 6
- 239000003593 chromogenic compound Substances 0.000 claims description 5
- 230000004727 humoral immunity Effects 0.000 claims description 5
- 235000019333 sodium laurylsulphate Nutrition 0.000 claims description 5
- DBMJMQXJHONAFJ-UHFFFAOYSA-M Sodium laurylsulphate Chemical compound [Na+].CCCCCCCCCCCCOS([O-])(=O)=O DBMJMQXJHONAFJ-UHFFFAOYSA-M 0.000 claims description 4
- 239000012141 concentrate Substances 0.000 claims description 4
- 108091003079 Bovine Serum Albumin Proteins 0.000 claims description 3
- 108010001336 Horseradish Peroxidase Proteins 0.000 claims description 3
- 239000011545 carbonate/bicarbonate buffer Substances 0.000 claims description 2
- 239000012091 fetal bovine serum Substances 0.000 claims 1
- 239000000126 substance Substances 0.000 abstract 1
- 208000007212 Foot-and-Mouth Disease Diseases 0.000 description 23
- 108090000623 proteins and genes Proteins 0.000 description 19
- 238000006243 chemical reaction Methods 0.000 description 17
- 238000000034 method Methods 0.000 description 17
- 238000004458 analytical method Methods 0.000 description 16
- 241000700605 Viruses Species 0.000 description 13
- 235000018102 proteins Nutrition 0.000 description 12
- 102000004169 proteins and genes Human genes 0.000 description 12
- 229960005486 vaccine Drugs 0.000 description 12
- 238000004519 manufacturing process Methods 0.000 description 11
- 239000000725 suspension Substances 0.000 description 11
- 230000000890 antigenic effect Effects 0.000 description 10
- 230000035945 sensitivity Effects 0.000 description 10
- 229930006000 Sucrose Natural products 0.000 description 9
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 9
- 210000004027 cell Anatomy 0.000 description 9
- 230000002068 genetic effect Effects 0.000 description 9
- 239000005720 sucrose Substances 0.000 description 9
- 230000015572 biosynthetic process Effects 0.000 description 8
- 239000002245 particle Substances 0.000 description 8
- 238000002255 vaccination Methods 0.000 description 7
- 210000002845 virion Anatomy 0.000 description 7
- 241000283690 Bos taurus Species 0.000 description 6
- 241000700198 Cavia Species 0.000 description 6
- 239000007788 liquid Substances 0.000 description 6
- 230000003612 virological effect Effects 0.000 description 6
- 230000008901 benefit Effects 0.000 description 5
- 230000003053 immunization Effects 0.000 description 5
- 238000002649 immunization Methods 0.000 description 5
- 239000002773 nucleotide Substances 0.000 description 5
- 125000003729 nucleotide group Chemical group 0.000 description 5
- 230000003287 optical effect Effects 0.000 description 5
- HEDRZPFGACZZDS-UHFFFAOYSA-N Chloroform Chemical compound ClC(Cl)Cl HEDRZPFGACZZDS-UHFFFAOYSA-N 0.000 description 4
- 238000004113 cell culture Methods 0.000 description 4
- 238000001514 detection method Methods 0.000 description 4
- 238000011161 development Methods 0.000 description 4
- 238000002405 diagnostic procedure Methods 0.000 description 4
- 230000002163 immunogen Effects 0.000 description 4
- 239000013641 positive control Substances 0.000 description 4
- 238000002360 preparation method Methods 0.000 description 4
- 238000004062 sedimentation Methods 0.000 description 4
- 239000002356 single layer Substances 0.000 description 4
- 108091028043 Nucleic acid sequence Proteins 0.000 description 3
- 241000282887 Suidae Species 0.000 description 3
- 238000001962 electrophoresis Methods 0.000 description 3
- 230000036541 health Effects 0.000 description 3
- 230000000521 hyperimmunizing effect Effects 0.000 description 3
- 230000001900 immune effect Effects 0.000 description 3
- 210000003734 kidney Anatomy 0.000 description 3
- 239000010410 layer Substances 0.000 description 3
- 244000144972 livestock Species 0.000 description 3
- 239000000203 mixture Substances 0.000 description 3
- 238000012544 monitoring process Methods 0.000 description 3
- 239000013642 negative control Substances 0.000 description 3
- 229920002401 polyacrylamide Polymers 0.000 description 3
- 230000000405 serological effect Effects 0.000 description 3
- 238000005406 washing Methods 0.000 description 3
- CSCPPACGZOOCGX-UHFFFAOYSA-N Acetone Chemical compound CC(C)=O CSCPPACGZOOCGX-UHFFFAOYSA-N 0.000 description 2
- 101710145634 Antigen 1 Proteins 0.000 description 2
- 241000710189 Aphthovirus Species 0.000 description 2
- CURLTUGMZLYLDI-UHFFFAOYSA-N Carbon dioxide Chemical compound O=C=O CURLTUGMZLYLDI-UHFFFAOYSA-N 0.000 description 2
- 108020004414 DNA Proteins 0.000 description 2
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 2
- 241000709664 Picornaviridae Species 0.000 description 2
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 2
- 101710173681 Sulfate adenylyltransferase subunit 2 2 Proteins 0.000 description 2
- QAOWNCQODCNURD-UHFFFAOYSA-N Sulfuric acid Chemical compound OS(O)(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-N 0.000 description 2
- 239000002671 adjuvant Substances 0.000 description 2
- 125000003275 alpha amino acid group Chemical group 0.000 description 2
- 230000004071 biological effect Effects 0.000 description 2
- 230000008033 biological extinction Effects 0.000 description 2
- 238000012512 characterization method Methods 0.000 description 2
- 238000010835 comparative analysis Methods 0.000 description 2
- 230000004069 differentiation Effects 0.000 description 2
- 238000007865 diluting Methods 0.000 description 2
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 2
- 239000000839 emulsion Substances 0.000 description 2
- 210000004700 fetal blood Anatomy 0.000 description 2
- 239000012894 fetal calf serum Substances 0.000 description 2
- 229940027941 immunoglobulin g Drugs 0.000 description 2
- 229940031551 inactivated vaccine Drugs 0.000 description 2
- 208000015181 infectious disease Diseases 0.000 description 2
- 230000002458 infectious effect Effects 0.000 description 2
- 210000003292 kidney cell Anatomy 0.000 description 2
- 238000012768 mass vaccination Methods 0.000 description 2
- 244000005700 microbiome Species 0.000 description 2
- 230000000877 morphologic effect Effects 0.000 description 2
- 230000035772 mutation Effects 0.000 description 2
- 230000001717 pathogenic effect Effects 0.000 description 2
- 230000002572 peristaltic effect Effects 0.000 description 2
- 239000002953 phosphate buffered saline Substances 0.000 description 2
- 238000013081 phylogenetic analysis Methods 0.000 description 2
- 229920001184 polypeptide Polymers 0.000 description 2
- 239000002243 precursor Substances 0.000 description 2
- 230000002265 prevention Effects 0.000 description 2
- 230000008569 process Effects 0.000 description 2
- 102000004196 processed proteins & peptides Human genes 0.000 description 2
- 108090000765 processed proteins & peptides Proteins 0.000 description 2
- 238000011160 research Methods 0.000 description 2
- 239000013049 sediment Substances 0.000 description 2
- 239000007790 solid phase Substances 0.000 description 2
- 230000003595 spectral effect Effects 0.000 description 2
- 238000010186 staining Methods 0.000 description 2
- 241000701447 unidentified baculovirus Species 0.000 description 2
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 2
- 239000012224 working solution Substances 0.000 description 2
- 101150097623 1B gene Proteins 0.000 description 1
- 101150019071 1C gene Proteins 0.000 description 1
- LSDGFGPIFBOTJI-UHFFFAOYSA-N 2-(aziridin-1-yl)ethanamine Chemical compound NCCN1CC1 LSDGFGPIFBOTJI-UHFFFAOYSA-N 0.000 description 1
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 1
- 102100031974 CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 Human genes 0.000 description 1
- 241001250090 Capra ibex Species 0.000 description 1
- 108091026890 Coding region Proteins 0.000 description 1
- 241000144531 Foot-and-mouth disease virus - type Asia 1 Species 0.000 description 1
- 241000238631 Hexapoda Species 0.000 description 1
- 102100023920 Histone H1t Human genes 0.000 description 1
- 101000703754 Homo sapiens CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 Proteins 0.000 description 1
- 101000905044 Homo sapiens Histone H1t Proteins 0.000 description 1
- 108010052285 Membrane Proteins Proteins 0.000 description 1
- 241000699673 Mesocricetus auratus Species 0.000 description 1
- 108060004795 Methyltransferase Proteins 0.000 description 1
- 241000699670 Mus sp. Species 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- 229920001213 Polysorbate 20 Polymers 0.000 description 1
- 241001493546 Suina Species 0.000 description 1
- 101710140501 Sulfate adenylyltransferase subunit 2 1 Proteins 0.000 description 1
- 102100030100 Sulfate anion transporter 1 Human genes 0.000 description 1
- 101710144481 Sulfate anion transporter 1 Proteins 0.000 description 1
- 102400000368 Surface protein Human genes 0.000 description 1
- 108010067390 Viral Proteins Proteins 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 239000000443 aerosol Substances 0.000 description 1
- 150000001413 amino acids Chemical class 0.000 description 1
- 244000037640 animal pathogen Species 0.000 description 1
- 230000000840 anti-viral effect Effects 0.000 description 1
- 230000005875 antibody response Effects 0.000 description 1
- 239000012223 aqueous fraction Substances 0.000 description 1
- OHDRQQURAXLVGJ-AXMZSLBLSA-N azane;(2z)-3-ethyl-2-[(z)-(3-ethyl-6-sulfo-1,3-benzothiazol-2-ylidene)hydrazinylidene]-1,3-benzothiazole-6-sulfonic acid Chemical compound [NH4+].[NH4+].S/1C2=CC(S([O-])(=O)=O)=CC=C2N(CC)C\1=N\N=C1/SC2=CC(S([O-])(=O)=O)=CC=C2N1CC OHDRQQURAXLVGJ-AXMZSLBLSA-N 0.000 description 1
- 230000037429 base substitution Effects 0.000 description 1
- 239000003124 biologic agent Substances 0.000 description 1
- 230000006287 biotinylation Effects 0.000 description 1
- 238000007413 biotinylation Methods 0.000 description 1
- 239000000872 buffer Substances 0.000 description 1
- 238000004364 calculation method Methods 0.000 description 1
- 210000000234 capsid Anatomy 0.000 description 1
- 239000001569 carbon dioxide Substances 0.000 description 1
- 229910002092 carbon dioxide Inorganic materials 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 239000007795 chemical reaction product Substances 0.000 description 1
- 230000002860 competitive effect Effects 0.000 description 1
- 230000000295 complement effect Effects 0.000 description 1
- 239000002131 composite material Substances 0.000 description 1
- 239000000562 conjugate Substances 0.000 description 1
- 238000011109 contamination Methods 0.000 description 1
- 230000005574 cross-species transmission Effects 0.000 description 1
- 239000008367 deionised water Substances 0.000 description 1
- 229910021641 deionized water Inorganic materials 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- 239000003599 detergent Substances 0.000 description 1
- 238000009792 diffusion process Methods 0.000 description 1
- 239000013024 dilution buffer Substances 0.000 description 1
- 201000010099 disease Diseases 0.000 description 1
- 231100000676 disease causative agent Toxicity 0.000 description 1
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 1
- BTWUORFYKAZQHW-UHFFFAOYSA-L disodium;2-hydroxy-3-[4-[4-[(2-hydroxy-3-sulfonatopropyl)amino]-3-methylphenyl]-2-methylanilino]propane-1-sulfonate Chemical compound [Na+].[Na+].C1=C(NCC(O)CS([O-])(=O)=O)C(C)=CC(C=2C=C(C)C(NCC(O)CS([O-])(=O)=O)=CC=2)=C1 BTWUORFYKAZQHW-UHFFFAOYSA-L 0.000 description 1
- 238000009826 distribution Methods 0.000 description 1
- 238000011067 equilibration Methods 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 238000005194 fractionation Methods 0.000 description 1
- 238000001502 gel electrophoresis Methods 0.000 description 1
- ACGUYXCXAPNIKK-UHFFFAOYSA-N hexachlorophene Chemical compound OC1=C(Cl)C=C(Cl)C(Cl)=C1CC1=C(O)C(Cl)=CC(Cl)=C1Cl ACGUYXCXAPNIKK-UHFFFAOYSA-N 0.000 description 1
- 230000036039 immunity Effects 0.000 description 1
- 230000005847 immunogenicity Effects 0.000 description 1
- 230000002779 inactivation Effects 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- 238000011081 inoculation Methods 0.000 description 1
- 230000003993 interaction Effects 0.000 description 1
- 238000005304 joining Methods 0.000 description 1
- 210000003141 lower extremity Anatomy 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- 229910052751 metal Inorganic materials 0.000 description 1
- 239000002184 metal Substances 0.000 description 1
- WSFSSNUMVMOOMR-NJFSPNSNSA-N methanone Chemical compound O=[14CH2] WSFSSNUMVMOOMR-NJFSPNSNSA-N 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 210000003205 muscle Anatomy 0.000 description 1
- 238000006386 neutralization reaction Methods 0.000 description 1
- 108020004707 nucleic acids Proteins 0.000 description 1
- 102000039446 nucleic acids Human genes 0.000 description 1
- 150000007523 nucleic acids Chemical class 0.000 description 1
- 239000003960 organic solvent Substances 0.000 description 1
- 244000052769 pathogen Species 0.000 description 1
- 230000007918 pathogenicity Effects 0.000 description 1
- 230000001575 pathological effect Effects 0.000 description 1
- 230000000704 physical effect Effects 0.000 description 1
- 229920001223 polyethylene glycol Polymers 0.000 description 1
- -1 polyhexamethylene guanidine Polymers 0.000 description 1
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 1
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 1
- 239000002244 precipitate Substances 0.000 description 1
- 230000001681 protective effect Effects 0.000 description 1
- 235000004252 protein component Nutrition 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 238000004445 quantitative analysis Methods 0.000 description 1
- 230000035484 reaction time Effects 0.000 description 1
- 230000000601 reactogenic effect Effects 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 230000010076 replication Effects 0.000 description 1
- 238000003757 reverse transcription PCR Methods 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- 238000012216 screening Methods 0.000 description 1
- 238000012106 screening analysis Methods 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 241000894007 species Species 0.000 description 1
- 230000007480 spreading Effects 0.000 description 1
- 238000003892 spreading Methods 0.000 description 1
- 238000010561 standard procedure Methods 0.000 description 1
- 239000012089 stop solution Substances 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- 239000006228 supernatant Substances 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 230000007704 transition Effects 0.000 description 1
- 238000005199 ultracentrifugation Methods 0.000 description 1
- 238000009281 ultraviolet germicidal irradiation Methods 0.000 description 1
- 230000001018 virulence Effects 0.000 description 1
- 108700005940 virus 3ABC Proteins 0.000 description 1
- 239000011534 wash buffer Substances 0.000 description 1
- 239000003643 water by type Substances 0.000 description 1
- 238000005303 weighing Methods 0.000 description 1
Abstract
Description
Изобретение относится к области ветеринарной вирусологии и биотехнологии, в частности, созданию тест-системы для определения титра антител против структурных белков вируса ящура штамма «Азия-1 №2356/14/2018» с помощью жидкофазного блокирующего непрямого «сэндвич»-варианта ИФА.The invention relates to the field of veterinary virology and biotechnology, in particular, to the creation of a test system for determining the titer of antibodies against the structural proteins of the foot-and-mouth disease virus strain “Asia-1 No. 2356/14/2018” using a liquid-phase blocking indirect “sandwich” version of the ELISA.
Вирус ящура является представителем рода Aphthovirus семейства Picornaviridae и имеет 7 различных серотипов: О, А, Азия-1, С, SAT-1, SAT-2, SAT-3. Вирион представляет собой частицу с коэффициентом седиментации 146S, состоящую из одноцепочечного позитивного генома в виде РНК и 60 копий каждого из четырех структурных белков (VP1 [1D-ген], VP2 [1B-ген], VP3 [1С-ген] и VP4 [1А-ген]) [1]. Каждый серотип генетически разделен на различные топотипы, генетические линии и сублинии. Различия между ними определяют при анализе нуклеотидной последовательности 1D-гена (белок VP1), который характеризуется высокой геномной и антигенной вариабельностью.The foot-and-mouth disease virus is a member of the genus Aphthovirus of the Picornaviridae family and has 7 different serotypes: O, A, Asia-1, C, SAT-1, SAT-2, SAT-3. The virion is a particle with a sedimentation coefficient of 146S, consisting of a single-stranded positive genome in the form of RNA and 60 copies of each of four structural proteins (VP 1 [1D gene], VP 2 [1B gene], VP 3 [1C gene] and VP 4 [1A gene]) [1]. Each serotype is genetically divided into different topotypes, genetic lineages and sublineages. The differences between them are determined by analyzing the nucleotide sequence of the 1D gene (VP 1 protein), which is characterized by high genomic and antigenic variability.
В пределах семи серотипов были описаны более 60 генетических линий и сублиний. Антитела против одного серотипа не обеспечивают иммунную защиту против другого серотипа и даже многих других генетических линий [2].Within seven serotypes, more than 60 genetic lineages and sublineages have been described. Antibodies against one serotype do not provide immune protection against another serotype or even many other genetic lineages [2].
Белок VP1 является наиболее вариабельным, поскольку на него приходится около 90% мутаций всех структурных генов. Самыми вариабельными областями являются участки 40-60, 130-160 и 190-213 а.о. [3]. Участок поверхностного белка VP1 в регионе 130-160 а.о. отличается высокой вариабельностью, поскольку участвует в процессе связывания с рецепторами клетки-хозяина [4]. Изменчивость данного региона дает возможность вирусу ящура взаимодействовать с рецепторами клеток разных типов и облегчает переход от одного вида хозяина к другому. Серотипы вируса ящура в среднем на 86% имеют идентичные последовательностей, хотя VP1 значительно более вариабелен. Нуклеотидные последовательности кодирующей области VP1 используются для генетической характеристики штаммов ящура из-за их значимости для прикрепления и проникновения вируса в клетку, защитного иммунитета и специфичности серотипа. Филогенетический анализ на основе последовательности VP1 широко используется для вывода эволюционной динамики, эпидемиологических отношений между генетическими линиями и для отслеживания происхождения и перемещения штаммов вируса ящура [5].The VP 1 protein is the most variable, since it accounts for about 90% of the mutations of all structural genes. The most variable regions are areas 40-60, 130-160 and 190-213 aa. [3]. Section of the surface protein VP 1 in the region 130-160 a.a. is highly variable because it is involved in the process of binding to host cell receptors [4]. The variability of this region allows the foot-and-mouth disease virus to interact with receptors of different types of cells and facilitates the transition from one host species to another. Foot-and-mouth disease virus serotypes have on average 86% identical sequences, although VP 1 is much more variable. Nucleotide sequences of the VP 1 coding region are used for genetic characterization of foot-and-mouth disease strains because of their importance for viral cellular attachment and entry, protective immunity, and serotype specificity. Phylogenetic analysis based on the VP 1 sequence is widely used to infer evolutionary dynamics, epidemiological relationships between genetic lineages, and to trace the origin and movement of foot-and-mouth disease virus strains [5].
По данным WRLFMD [6] в серотип Азия-1 вируса ящура входят 1 топотип ASIA, включающий в себя 8 охарактеризованных генетических линий и некоторые изоляты, которые в настоящее время еще не отнесли ни к одной линии. Подразделения на сублинии не отмечается в настоящее время. В топотип ASIA входят следующие генетические линии: G-I, G-II, G-III, G-IV, G-V, G-VI, G-VIII, Sindh-08.According to WRLFMD [6], serotype Asia-1 of the foot-and-mouth disease virus includes 1 topotype ASIA, which includes 8 characterized genetic lineages and some isolates that have not yet been assigned to any lineage. Subdivisions into sublines are not currently noted. The ASIA topotype includes the following genetic lines: G-I, G-II, G-III, G-IV, G-V, G-VI, G-VIII, Sindh-08.
Основной стратегией, принятой мировым сообществом против ящура, является обязательная массовая вакцинация сельскохозяйственных животных [7]. Известно, что эффективность кампаний вакцинации зависит, среди прочего, от многих факторов, таких как эффективность вакцины, стратегия вакцинации и охват вакцинацией. Из-за размера и территориальной неоднородности многих стран, а также масштабов поголовья сельскохозяйственных животных кампании вакцинации против ящура столкнулись с рядом оперативных проблем. При этом абсолютно всеми доказано, что единственным способом профилактики ящура является массовая вакцинация против того генотипа ящура, который циркулирует в рассматриваемом регионе. Важным аспектом контроля проведенной вакцинации является исследование наличия и определение титра поствакцинальных антител у животных с помощью серологических методов, одними из которых являются реакция микронейтрализации (РМН) и ИФА [8].The main strategy adopted by the world community against foot and mouth disease is mandatory mass vaccination of farm animals [7]. It is known that the effectiveness of vaccination campaigns depends on many factors, such as vaccine effectiveness, vaccination strategy and vaccination coverage, among others. Due to the size and geographical heterogeneity of many countries, as well as the scale of farm animal populations, FMD vaccination campaigns have faced a number of operational challenges. At the same time, absolutely everyone has proven that the only way to prevent foot-and-mouth disease is mass vaccination against the genotype of foot-and-mouth disease that circulates in the region in question. An important aspect of monitoring vaccination is the study of the presence and determination of the titer of post-vaccination antibodies in animals using serological methods, one of which is the microneutralization reaction (MN) and ELISA [8].
На территории Российской Федерации вспышки ящура имеют спорадический характер и вызваны заносом возбудителя с территории сопредельных стран. Регионы РФ, граничащие с Китаем, Монголией, Азербайджаном и Грузией подвержены очень высокой степени риска заноса ящура. Очень важны также в этом отношения транспортные связи на юге России со странами Ближнего Востока [9].On the territory of the Russian Federation, outbreaks of foot and mouth disease are sporadic and are caused by the introduction of the pathogen from the territory of neighboring countries. Regions of the Russian Federation bordering China, Mongolia, Azerbaijan and Georgia are subject to a very high risk of introducing foot-and-mouth disease. Transport connections in the south of Russia with the countries of the Middle East are also very important in this regard [9].
Известны производственные штаммы вируса ящура серотипа Азия-1, которые применялись для специфической профилактики ящура на территории России:There are known industrial strains of foot-and-mouth disease virus serotype Asia-1, which were used for specific prevention of foot-and-mouth disease in Russia:
- штамм вируса ящура «Азия-1 №2145/Таджикистан/2011»,- foot and mouth disease virus strain “Asia-1 No. 2145/Tajikistan/2011”,
- штамм вируса ящура «Азия-1 №1987/Амурский/2005»- strain of foot and mouth disease virus “Asia-1 No. 1987/Amur/2005”
- штамм вируса ящура «Азия-1 №1946/ Шамир 3/89».- foot and mouth disease virus strain “Asia-1 No. 1946/Shamir 3/89”.
В ФГБУ «ВНИИЗЖ» в 2018 г. из проб патологического материала от крупного рогатого скота, отобранных на территории Пакистана, был выделен изолят вируса ящура типа Азия-1.In the Federal State Budgetary Institution "ARRIAH" in 2018, an isolate of foot-and-mouth disease virus type Asia-1 was isolated from samples of pathological material from cattle collected in Pakistan.
По результатам сравнительного анализа нуклеотидных последовательностей выделенный изолят принадлежит к топотипу ASIA, генетической линии Sindh-08 вируса ящура серотипа Азия-1, который значительно отличается от производственных штаммов вируса ящура серотипа Азия-1 (фиг. 1).According to the results of a comparative analysis of nucleotide sequences, the isolated isolate belongs to the ASIA topotype, the Sindh-08 genetic line of foot-and-mouth disease virus serotype Asia-1, which differs significantly from the production strains of foot-and-mouth disease virus serotype Asia-1 (Fig. 1).
Учитывая интенсивные торговые связи между Российской Федерацией и странами Западной и Центральной Азии, вероятность риска заноса ящура на территорию нашей страны остается очень высокой. Возникла задача провести исследования по изучению биологических свойств данного штамма и применить его для изготовления чувствительных и высокоспецифичных диагностических тест-систем и высоко иммуногенных вакцинных препаратов.Considering the intensive trade relations between the Russian Federation and the countries of Western and Central Asia, the likelihood of the risk of introducing foot-and-mouth disease into the territory of our country remains very high. The task arose to conduct research to study the biological properties of this strain and use it for the production of sensitive and highly specific diagnostic test systems and highly immunogenic vaccine preparations.
Изолят, послуживший источником для получения штамма «Азия-1 №2356/14/2018» вируса ящура, был выделен в 2018 году от больных ящуром КРС на территории Пакистана. Производственный штамм «Азия-1 №2356/14/2018» вируса ящура получен путем последовательных пассажей на чувствительных гетеро- и гомологичных культурах клеток.The isolate that served as the source for obtaining the Asia-1 strain No. 2356/14/2018 of the foot-and-mouth disease virus was isolated in 2018 from cattle with foot-and-mouth disease in Pakistan. The production strain “Asia-1 No. 2356/14/2018” of the foot-and-mouth disease virus was obtained by successive passages on sensitive hetero- and homologous cell cultures.
В настоящее время в качестве производственного штамма вируса ящура генотипа Asia-1/ASIA/Sindh-08 применяют данный штамм - «Азия-1 №2356/14/2018», который имеет высокое нуклеотидное и аминокислотное родство со всеми штаммами и изолятами данного генотипа, которые циркулируют в мире (фиг. 1).Currently, this strain is used as a production strain of foot-and-mouth disease virus genotype Asia-1/ASIA/Sindh-08 - “Asia-1 No. 2356/14/2018”, which has a high nucleotide and amino acid affinity with all strains and isolates of this genotype, that circulate in the world (Fig. 1).
Штамм «Азия-1 №2356/14/2018» вируса ящура депонирован во Всероссийской государственной коллекции экзотических типов вирусов ящура и других патогенов животных (ГКШМ) ФГБУ «ВНИИЗЖ» под регистрационным номером: №176 - деп / 19-66 - ГКШМ ФГБУ «ВНИИЗЖ».Strain "Asia-1 No. 2356/14/2018" of the foot-and-mouth disease virus has been deposited in the All-Russian State Collection of Exotic Types of Foot and Mouth Disease Viruses and other Animal Pathogens (GKSHM) of the Federal State Budgetary Institution "ARRIAH" under registration number: No. 176 - dep / 19-66 - GKSHM FGBU " ARRIAH".
Экспериментально подтверждена возможность использования штамма «Азия-1 №2356/14/2018» вируса ящура для изготовления средств диагностики и профилактики ящура генотипа Asia-1/ASIA/Sindh-08.The possibility of using the strain “Asia-1 No. 2356/14/2018” of the foot-and-mouth disease virus for the production of diagnostic and prevention tools for foot-and-mouth disease of the Asia-1/ASIA/Sindh-08 genotype has been experimentally confirmed.
Филогенетическое дерево выведено с использованием программы MEGA и алгоритма Neighbor-Joining. Процент повторяющихся ветвей, в которых связанные таксоны сгруппированы вместе в тесте начальной загрузки (100 повторов), показан рядом с ветвями. Эволюционные расстояния были рассчитаны с использованием метода Maximum Composite Likelihood и выражены в единицах количества замен оснований на сайт. Этот анализ включал 24 нуклеотидных последовательностей. Все позиции, содержащие пробелы и отсутствующие данные, были удалены (вариант полного удаления). В окончательном наборе данных было всего 633 позиций. Эволюционный анализ проводился в MEGA X.The phylogenetic tree was inferred using the MEGA program and the Neighbor-Joining algorithm. The percentage of replicate branches in which related taxa cluster together in the bootstrap test (100 replicates) is shown next to the branches. Evolutionary distances were calculated using the Maximum Composite Likelihood method and expressed in units of the number of base substitutions per site. This analysis included 24 nucleotide sequences. All items containing spaces and missing data were removed (complete deletion option). There were a total of 633 items in the final data set. Evolutionary analysis was carried out in MEGA X.
В связи с циркуляцией вируса ящура генотипа Asia-1/ASIA/Sindh-08 и необходимостью защиты животных от него в ФГБУ «ВНИИЗЖ» разработали вакцину, в состав которой входит антиген вируса ящура данного штамма.In connection with the circulation of the foot-and-mouth disease virus genotype Asia-1/ASIA/Sindh-08 and the need to protect animals from it, the Federal State Budgetary Institution "ARRIAH" has developed a vaccine that includes the antigen of the foot-and-mouth disease virus of this strain.
Возникла необходимость создания диагностической тест-системы для определения титра антител против структурных белков вируса ящура штамма «Азия-1 №2356/14/2018» с помощью жидкофазного блокирующего непрямого «сэндвич»-варианта ИФА.There was a need to create a diagnostic test system to determine the titer of antibodies against the structural proteins of the foot-and-mouth disease virus strain “Asia-1 No. 2356/14/2018” using a liquid-phase blocking indirect “sandwich” version of the ELISA.
Защита от ящура после вакцинации оценивается количеством специфических антител в сыворотке крови животных [10, 11]. Уровень гуморального иммунитета вакцинированного поголовья определяется путем выявления антител, специфичных к структурным белкам вируса ящура. В соответствии с рекомендациями МЭБ (OIE) [8], для определения иммунного статуса животных применяют реакцию РМН и ИФА.Protection against foot and mouth disease after vaccination is assessed by the amount of specific antibodies in the blood serum of animals [10, 11]. The level of humoral immunity of vaccinated livestock is determined by identifying antibodies specific to the structural proteins of the foot-and-mouth disease virus. In accordance with the recommendations of the OIE (OIE) [8], the RMN reaction and ELISA are used to determine the immune status of animals.
РМН считается чувствительной и специфичной, однако проведение анализа имеет ряд следующих ограничений: 1) большая продолжительность времени постановки реакции (не менее 72 ч), 2) высокая себестоимость процедуры, связанная с применением чувствительной клеточной линии, CO2-инкубатора и другого оборудования, 3) использование неинактивированного вируса ящура, который является биологическим агентом II группы опасности и предполагает проведение работ только в лабораториях уровня BSL-3.RMN is considered sensitive and specific, but the analysis has a number of limitations: 1) a long reaction time (at least 72 hours), 2) the high cost of the procedure associated with the use of a sensitive cell line, CO 2 incubator and other equipment, 3 ) the use of non-inactivated foot-and-mouth disease virus, which is a biological agent of hazard group II and requires work to be carried out only in BSL-3 level laboratories.
В свою очередь, ИФА обладает многими преимуществами, включая экспрессность, высокую специфичность и чувствительность, пригодность для крупномасштабного скрининга полевых образцов и отсутствие требований к специальным лабораторным условиям, например, культуре клеток или среде углекислого газа, а также не предполагает проведение работ с микроорганизмами повышенного уровня опасности [12]. Исходя из этого, ИФА целесообразно применять для определения титра антител против структурных белков вируса ящура штамма «Азия-1 №2356/14/2018».In turn, ELISA has many advantages, including rapidity, high specificity and sensitivity, suitability for large-scale screening of field samples and no requirement for special laboratory conditions, for example, cell culture or carbon dioxide environment, and does not involve working with high-level microorganisms dangers [12]. Based on this, it is advisable to use ELISA to determine the titer of antibodies against the structural proteins of the foot-and-mouth disease virus strain “Asia-1 No. 2356/14/2018”.
Особым вариантом проведения ИФА является «сэндвич»-вариант, который обычно предполагает применение пар подобранных антител, где каждое антитело специфично для другого, неперекрывающегося эпитопа антигена. Первые антитела принято называть сенсибилизирующими и предназначены они для захвата антигена. Вторые антитела - детекторные, необходимы для обнаружения антигена. Указанный вариант ИФА имеет следующие преимущества: 1) высокая специфичность реакции; 2) подходит для скринингового анализа полевых образцов разной степени очистки; 3) высокая чувствительность реакции [13].A special option for performing ELISA is the “sandwich” option, which usually involves the use of pairs of matched antibodies, where each antibody is specific for a different, non-overlapping epitope of the antigen. The first antibodies are usually called sensitizing antibodies and are designed to capture the antigen. The second antibodies are detector antibodies, necessary to detect the antigen. This version of ELISA has the following advantages: 1) high specificity of the reaction; 2) suitable for screening analysis of field samples of varying degrees of purification; 3) high sensitivity of the reaction [13].
Отдельное место среди вариантов ИФА отводится жидкофазному блокирующему непрямому «сэндвич»-варианту ИФА, который характеризуется рядом преимуществ:A special place among ELISA options is given to the liquid-phase blocking indirect “sandwich” ELISA option, which is characterized by a number of advantages:
1) данный анализ максимально приближен к классической реакции нейтрализации, поскольку формирование иммунного комплекса происходит в жидкой фазе как наиболее естественных условиях;1) this analysis is as close as possible to the classical neutralization reaction, since the formation of the immune complex occurs in the liquid phase as the most natural conditions;
2) эпитопы антигена наиболее доступны в пространстве для специфичных антител, что позволяет повысить чувствительность и специфичность реакции [14].2) antigen epitopes are most accessible in space for specific antibodies, which allows increasing the sensitivity and specificity of the reaction [14].
Sharma G.K. и др. (2015) предложили тест-систему для выявления антител против вируса ящура типов А, О, Азия-1 с помощью жидкофазного блокирующего непрямого «сэндвич»-варианта ИФА [15]. Данная методика позволяла идентифицировать широкий спектр противоящурных антител, но при этом специфичность по отношению к антигену вируса ящура генотипа Asia-1/ASIA/Sindh-08 не более 48%, а, следовательно, точное выявление иммуноглобулинов G не представляется возможным. Авторы тест-системы применяли моноклональные антитела, использование которых увеличивало спектр выявления различных генотипов вируса ящура в рамках одного серотипа, но при этом существенно снижалась специфичность относительно выявления антител против изолятов/штаммов конкретного генотипа, в частности генотипа Asia-1/ASIA/Sindh-08.Sharma G.K. et al. (2015) proposed a test system for detecting antibodies against foot-and-mouth disease virus types A, O, Asia-1 using a liquid-phase blocking indirect “sandwich” version of ELISA [15]. This technique made it possible to identify a wide range of anti-foot-and-mouth antibodies, but the specificity for the antigen of the foot-and-mouth disease virus genotype Asia-1/ASIA/Sindh-08 was no more than 48%, and, therefore, accurate detection of immunoglobulins G was not possible. The authors of the test system used monoclonal antibodies, the use of which increased the range of detection of various genotypes of foot-and-mouth disease virus within one serotype, but at the same time the specificity with respect to the detection of antibodies against isolates/strains of a specific genotype, in particular the Asia-1/ASIA/Sindh-08 genotype, was significantly reduced. .
Указанная выше тест-система не представлена на рынке в качестве наборов для детекции противоящурных антител в сыворотках крови животных и остается в качестве недоступной для широкого потребителя. В свою очередь, на мировом рынке в настоящее время имеются европейские наборы для детекции антител против вируса ящура серотипа Asia-1 - IZSLER (Италия) и PrioCHECK (Нидерланды).The above test system is not presented on the market as kits for the detection of foot-and-mouth disease antibodies in animal blood sera and remains unavailable to the general consumer. In turn, the world market currently has European kits for detecting antibodies against foot-and-mouth disease virus serotype Asia-1 - IZSLER (Italy) and PrioCHECK (Netherlands).
Тест-система в наборе IZSLER предназначена для детекции противоящурных антител с помощью твердофазного прямого «сэндвич»-варианта ИФА [16]. Достоинством данного набора является применение моноклональных антител, однако они были получены гораздо раньше 2018 года (период, когда появился производственный штамм «Азия-1 №2356/14/2018») и не могут с высокой достоверностью и точностью детектировать специфические антитела в сыворотках крови животных. Специфичность и чувствительность указанной тест-системы для выявления антител против вируса ящура генотипа Asia-1/ASIA/Sindh-08 ниже 45%, что подтверждают данные РМН. Таким образом, тест-система IZSLER на серотип Азия-1 не позволяет получать достоверных результатов в отношении изолятов и штаммов вируса ящура широко распространенного в Азии и Ближнего Востока генотипа Asia-1/ASIA/Sindh-08.The test system in the IZSLER kit is designed for the detection of anti-foot-and-mouth disease antibodies using a solid-phase direct “sandwich” ELISA version [16]. The advantage of this kit is the use of monoclonal antibodies, however, they were obtained much earlier than 2018 (the period when the production strain “Asia-1 No. 2356/14/2018” appeared) and cannot detect specific antibodies in animal blood sera with high reliability and accuracy . The specificity and sensitivity of this test system for detecting antibodies against foot-and-mouth disease virus genotype Asia-1/ASIA/Sindh-08 is below 45%, which is confirmed by RMN data. Thus, the IZSLER test system for serotype Asia-1 does not allow obtaining reliable results against isolates and strains of the foot-and-mouth disease virus of the Asia-1/ASIA/Sindh-08 genotype, which is widespread in Asia and the Middle East.
Наиболее близким прототипом для разработанной нами тест-системы является тест-система PrioCHECK (Prionics Lelystad B.V., Netherlands) для выявления антител к антигену вирусу ящура серотипа Азия-1 [17].The closest prototype for the test system we developed is the PrioCHECK test system (Prionics Lelystad B.V., Netherlands) for detecting antibodies to the antigen of foot-and-mouth disease virus serotype Asia-1 [17].
Комплектующие для соответствующего набора представлены ниже:The components for the corresponding kit are presented below:
Компонент 1 - Планшеты иммунологические.Component 1 - Immunological tablets.
Компонент 2 - Конъюгат (30х). Разбавленный конъюгат не стабилен, готовят непосредственно перед применением.Component 2 - Conjugate (30x). The diluted conjugate is not stable; prepare immediately before use.
Компонент 3 - Буфер для разведения (5х).Component 3 - Dilution Buffer (5x).
Компонент 4 - Неиммунная сыворотка крови лошади.Component 4 - Non-immune horse blood serum.
Компонент 5 - Деминерализованная вода.Component 5 - Demineralized water.
Компонент 6 - Промывочный буфер (200х).Component 6 - Wash buffer (200x).
Компонент 7 - Референтная сыворотка 1 (позитивная) (жидкая).Component 7 - Reference serum 1 (positive) (liquid).
Компонент 8 - Референтная сыворотка 2 (менее позитивная) (жидкая).Component 8 - Reference serum 2 (less positive) (liquid).
Компонент 9 - Референтная сыворотка 3 (еще менее позитивная) (жидкая).Component 9 - Reference serum 3 (even less positive) (liquid).
Компонент 10 - Референтная сыворотка 4 (отрицательный контроль) (жидкая).Component 10 - Reference serum 4 (negative control) (liquid).
Компонент 11 - Субстрат хромогена (ТМВ).Component 11 - Chromogen substrate (TMB).
Компонент 12 - Стоп-раствор (1 N раствор серной кислоты). Данные отражены в инструкции производителя.Component 12 - Stop solution (1 N sulfuric acid solution). The data is reflected in the manufacturer's instructions.
Тест-система PrioCHECK включает в себя конъюгат, который представляет собой меченые моноклональные антитела против вируса ящура серотипа Азия-1, исходя из этого является типоспецифичной, но без более узкой дифференциации. Прототипная тест-система разработана была еще в конце 90-гг XX в. В ней применяются антитела против антигенов вируса ящура различных генотипов серотипа Азия-1, кроме появившихся позднее, в частности штамма «Азия-1 №2356/14/2018». Изоляты и штаммы данной линии имеют существенные отличия от других линий серотипа Азия-1 (фиг. 1). Анализируя нуклеотидную и аминокислотную последовательность высоко вариабельного белка VP1 вируса ящура, ученые пришли к выводу о наличии достаточного количества существенных замен, позволяющих отнести вирус к иному генотипу.The PrioCHECK test system includes a conjugate, which is a labeled monoclonal antibody against foot-and-mouth disease virus serotype Asia-1, and therefore is type-specific, but without a narrower differentiation. The prototype test system was developed back in the late 90s of the 20th century. It uses antibodies against foot-and-mouth disease virus antigens of various genotypes of the Asia-1 serotype, except for those that appeared later, in particular the Asia-1 strain No. 2356/14/2018. Isolates and strains of this line have significant differences from other lines of the Asia-1 serotype (Fig. 1). Analyzing the nucleotide and amino acid sequence of the highly variable VP 1 protein of the foot-and-mouth disease virus, scientists came to the conclusion that there are a sufficient number of significant substitutions to classify the virus as a different genotype.
Исходя из выше представленного, прототипная тест-система не является высокочувствительной и специфичной по отношению к вирусу ящура генотипа Asia-1/ASIA/Sindh-08. Данная тест-система выявляет антитела к антигену вируса ящура указанного генотипа не более, чем на 48%. Исходя из этого требуется разработать чувствительную, специфичную тест-систему для определения титра антител против структурных белков вируса ящура штамма «Азия-1 №2356/14/2018» с помощью жидкофазного блокирующего непрямого «сэндвич»-варианта ИФА.Based on the above, the prototype test system is not highly sensitive and specific to the foot and mouth disease virus genotype Asia-1/ASIA/Sindh-08. This test system detects antibodies to the foot-and-mouth disease virus antigen of the specified genotype by no more than 48%. Based on this, it is necessary to develop a sensitive, specific test system for determining the titer of antibodies against the structural proteins of the foot-and-mouth disease virus strain “Asia-1 No. 2356/14/2018” using a liquid-phase blocking indirect “sandwich” version of the ELISA.
Прототипная тест-система основана на твердофазном конкурентном «сэндвич»-варианте ИФА [17], однако эта форма отдалена по своей чувствительности и специфичности от РМН относительно возможностей улавливания антигенных сайтов по сравнению с жидкофазным блокирующим непрямым «сэндвич»-вариантом ИФА.The prototype test system is based on a solid-phase competitive “sandwich” version of the ELISA [17], however, this form is remote in its sensitivity and specificity from RMN in terms of the ability to capture antigenic sites compared to the liquid-phase blocking indirect “sandwich” version of the ELISA.
Прототипный вариант предполагает наличие в своем составе контрольных сывороток крови животных в жидком виде, что снижает сохранность компонентов тест-системы в течение длительного периода времени и создает риски контаминации микроорганизмами.The prototype version assumes the presence of control animal blood sera in liquid form, which reduces the safety of the test system components over a long period of time and creates risks of contamination by microorganisms.
Для прототипного варианта рабочий раствор конъюгата, который используется в процессе анализа, не стабилен и быстро разрушается. В составе набора он представлен в виде 30-кратного концентрата. В таком состоянии в отличии от лиофилизированного компонента срок хранения заметно сокращается.For the prototype version, the working solution of the conjugate, which is used in the analysis process, is not stable and is quickly destroyed. As part of the kit, it is presented in the form of a 30-fold concentrate. In this state, unlike the lyophilized component, the shelf life is noticeably reduced.
В прототипной тест-системе применяется прямой конъюгат, что удобно в применении, однако при этом повышается вероятность шумовых фоновых явлений, что может негативно отражаться на конечных результатах определения титра антител.The prototype test system uses a direct conjugate, which is convenient to use, but this increases the likelihood of background noise, which can negatively affect the final results of determining the antibody titer.
Учитывая найденные ограничения в применении имеющихся тест-систем, в том числе прототипной, для проведения точного количественного анализа уровня гуморального иммунитета животных после инокуляции противоящурными вакцинами, содержащими инактивированный вирус ящура штамма «Азия-1 №2356/14/2018», актуальной является разработка тест-системы для определения титра антител против структурных белков вируса ящура указанного штамма с помощью жидкофазного блокирующего непрямого «сэндвич»-варианта ИФА с учетом приведенных выше недостатков.Considering the found limitations in the use of existing test systems, including the prototype, for conducting an accurate quantitative analysis of the level of humoral immunity of animals after inoculation with foot-and-mouth disease vaccines containing inactivated foot-and-mouth disease virus strain "Asia-1 No. 2356/14/2018", the development of a test is relevant - systems for determining the titer of antibodies against the structural proteins of the foot-and-mouth disease virus of the specified strain using a liquid-phase blocking indirect “sandwich” version of ELISA, taking into account the above disadvantages.
В РФ на сегодняшний день существует тест-система на основе жидкофазного блокирующего непрямого "сэндвич"-варианта ИФА для определения титра антител против вируса ящура штамма «А №2269/ВНИИЗЖ/2015» генотипа A/ASIA/G-VII в сыворотках крови животных после иммунизации [18].In the Russian Federation, today there is a test system based on a liquid-phase blocking indirect “sandwich” version of the ELISA to determine the titer of antibodies against the foot-and-mouth disease virus strain “A No. 2269/ARNIAH/2015” genotype A/ASIA/G-VII in the blood serum of animals after immunization [18].
При этом в мире не запатентована тест-система на основе жидкофазного блокирующего непрямого «сэндвич»-варианта ИФА, которая позволила бы с высокой достоверностью количественно определять титр антител против структурных белков вируса ящура штамма «Азия-1 №2356/14/2018».At the same time, there is no patent in the world for a test system based on a liquid-phase blocking indirect “sandwich” version of ELISA, which would make it possible to quantify the titer of antibodies against the structural proteins of the foot-and-mouth disease virus strain “Asia-1 No. 2356/14/2018” with high reliability.
Целью изобретения является создание тест-системы для определения титра антител против структурных белков вируса ящура штамма «Азия-1 №2356/14/2018» с помощью жидкофазного блокирующего непрямого «сэндвич»-варианта ИФА.The purpose of the invention is to create a test system for determining the titer of antibodies against the structural proteins of the foot-and-mouth disease virus strain “Asia-1 No. 2356/14/2018” using a liquid-phase blocking indirect “sandwich” version of the ELISA.
Поставленная цель достигается тем, что предлагаемая тест-система содержит следующие лиофильно высушенные иммуноспецифические компоненты с высокой степенью активности:This goal is achieved by the fact that the proposed test system contains the following freeze-dried immunospecific components with a high degree of activity:
1) культуральный инактивированный лиофилизированный вирус ящура штамма «Азия-1 №2356/14/2018»;1) cultural inactivated lyophilized foot and mouth disease virus strain “Asia-1 No. 2356/14/2018”;
2) сенсибилизирующие антитела - иммуноглобулины G кролика против структурных белков вируса ящура штамма «Азия-1 №2356/14/2018»;2) sensitizing antibodies - rabbit immunoglobulins G against the structural proteins of the foot-and-mouth disease virus strain “Asia-1 No. 2356/14/2018”;
3) детекторные антитела - иммуноглобулины G морской свинки против структурных белков вируса ящура штамма «Азия-1 №2356/14/2018»;3) detector antibodies - guinea pig immunoglobulins G against the structural proteins of the foot-and-mouth disease virus strain “Asia-1 No. 2356/14/2018”;
4) контроль 1 (сильноположительный контроль) - положительная сыворотка крови телят к антигену вируса ящура штамма «Азия-1 №2356/14/2018» с процентом ингибиции 80-100%;4) control 1 (strongly positive control) - positive calf blood serum to the antigen of the foot-and-mouth disease virus strain “Asia-1 No. 2356/14/2018” with an inhibition percentage of 80-100%;
5) контроль 2 (положительный контроль) - положительная сыворотка крови телят к антигену вируса ящура штамма «Азия-1 №2356/14/2018» с процентом ингибиции от 50,0% до 79,9%;5) control 2 (positive control) - positive calf blood serum to the antigen of the foot-and-mouth disease virus strain “Asia-1 No. 2356/14/2018” with a percentage of inhibition from 50.0% to 79.9%;
6) контроль 3 (отрицательный контроль) - сыворотка крови телят, не содержащая антитела к антигену вирусу ящура;6) control 3 (negative control) - calf blood serum that does not contain antibodies to the foot-and-mouth disease virus antigen;
7) фетальная сыворотка крови;7) fetal blood serum;
8) антивидовой конъюгат - иммуноглобулины кролика против Ig G морской свинки, конъюгированные с пероксидазой хрена.8) anti-species conjugate - rabbit immunoglobulins against guinea pig Ig G, conjugated with horseradish peroxidase.
Предлагаемая тест-система содержит неспецифические компоненты: карбонатно-бикарбонатный буферный раствор (КББР) (рН 9,5-9,7), 20-кратный концентрат буферного раствора, хромогенный субстрат - AzBTS-диаммоний (diammonium 2,2'-azino-bis(3-ethylbenzothiazoline-6-sulfonate), «стоп»-раствор - 1,0%-ный раствор лаурилсульфата натрия (SLS).The proposed test system contains nonspecific components: carbonate-bicarbonate buffer solution (CBBR) (pH 9.5-9.7), 20-fold buffer solution concentrate, chromogenic substrate - AzBTS-diammonium (diammonium 2,2'-azino-bis (3-ethylbenzothiazoline-6-sulfonate), “stop” solution - 1.0% sodium lauryl sulfate (SLS).
Цель достигается благодаря тому, что метод жидкофазного блокирующего непрямого «сэндвич»-варианта ИФА наиболее приближен к классической РМН в культуре клеток IB-RS-2, поскольку все антигенные сайты полных частиц вируса ящура штамма «Азия-1 №2356/14/2018» находятся в свободном состоянии в жидкой фазе, открыты для связывания со специфическими сенсибилизирующими и детекторными антителами. Реакция основана на взаимодействии иммуноглобулинов G исследуемой сыворотки крови животного и инактивированного вируса ящура штамма «Азия-1 №2356/14/2018» в жидкой фазе с образованием иммунных комплексов. Параллельно с этим проводится сенсибилизация лунок плоскодонного планшета антителами кролика против вируса ящура того же штамма.The goal is achieved due to the fact that the liquid-phase blocking indirect “sandwich” ELISA method is closest to the classical RMN in IB-RS-2 cell culture, since all antigenic sites of complete particles of foot-and-mouth disease virus strain “Asia-1 No. 2356/14/2018” are in a free state in the liquid phase, open to binding to specific sensitizing and detector antibodies. The reaction is based on the interaction of immunoglobulins G of the animal blood serum under study and the inactivated foot-and-mouth disease virus strain “Asia-1 No. 2356/14/2018” in the liquid phase with the formation of immune complexes. In parallel with this, the wells of the flat-bottomed plate are sensitized with rabbit antibodies against the foot-and-mouth disease virus of the same strain.
Сенсибилизированные лунки подвергают обработке с помощью фетальной сыворотки крови, добавляют полученные иммунные комплексы из круглодонного планшета, инкубируют, вносят восстановленную из лиофильного высушенного состояния суспензию детекторных антител. Образовавшийся сложный иммунный комплекс выявляют с помощью антител против иммуноглобулинов G морской свинки, конъюгированных с пероксидазой хрена и хромогенного субстрата.Sensitized wells are treated with fetal blood serum, the resulting immune complexes from a round-bottom plate are added, incubated, and a suspension of detector antibodies restored from a lyophilized dried state is added. The resulting complex immune complex is detected using antibodies against guinea pig immunoglobulin G conjugated to horseradish peroxidase and a chromogenic substrate.
Технический результат от изобретения заключается в разработке современной, специфической против структурных белков вируса ящура штамма «Азия-1 №2356/14/2018» и чувствительной тест-системы, предназначенной для определения антител против указанного антигена методом жидкофазного блокирующего непрямого «сэндвич»-варианта ИФА на основе применения антигена вируса ящура штамма «Азия-1 №2356/14/2018» и при получении иммуноспецифических компонентов реакции.The technical result of the invention is the development of a modern, specific against the structural proteins of the foot-and-mouth disease virus strain "Asia-1 No. 2356/14/2018" and a sensitive test system designed to determine antibodies against the specified antigen using the liquid-phase blocking indirect "sandwich" version of ELISA based on the use of the antigen of the foot-and-mouth disease virus strain “Asia-1 No. 2356/14/2018” and upon obtaining immunospecific reaction components.
В отличии от прототипа в разработанной тест-системе применяется культуральный концентрированный в 500 раз инактивированный вирус ящура штамма «Азия-1 №2356/14/2018», который представлен в виде лиофильно высушенной суспензии. Данный факт дает возможность количественно определять гуморальный иммунитет против структурных белков вируса ящура указанного штамма с высокими показателями чувствительности (более 99%) и специфичности (100%), что более чем на 52% выше по сравнению с наиболее близким прототипом. Кроме того, лиофилизированный компонент остается стабильным не менее 4 лет по сравнению с антигеном в нативном состоянии, что является преимуществом в использовании данной тест-системы. Активность полученного антигена вируса ящура штамма «Азия-1 №2356/14/2018» составляет 1:3000.Unlike the prototype, the developed test system uses a culturally concentrated 500-fold inactivated foot-and-mouth disease virus strain “Asia-1 No. 2356/14/2018”, which is presented in the form of a freeze-dried suspension. This fact makes it possible to quantify humoral immunity against the structural proteins of the foot-and-mouth disease virus of the specified strain with high rates of sensitivity (more than 99%) and specificity (100%), which is more than 52% higher than the closest prototype. In addition, the lyophilized component remains stable for at least 4 years compared to the antigen in its native state, which is an advantage in using this test system. The activity of the obtained antigen of the foot-and-mouth disease virus strain “Asia-1 No. 2356/14/2018” is 1:3000.
В отличии от прототипа применяются сенсибилизирующие и детекторные антитела кролика и морской свинки, соответственно, высокоспецифичные по отношению к структурным белкам, представляющим собой антиген, вируса ящура штамма «Азия-1 №2356/14/2018». Указанные в тест-системе ИФА иммуноглобулины G кролика и морской свинки против указанного штамма вируса ящура получены в виде лиофильного компонента, что позволяет JgG находится в стабильном состоянии не менее 4 лет с активностью не менее 1:10000 и 1:4000, соответственно.Unlike the prototype, sensitizing and detector antibodies of rabbit and guinea pig are used, respectively, highly specific to the structural proteins that represent the antigen of the foot-and-mouth disease virus strain “Asia-1 No. 2356/14/2018”. The rabbit and guinea pig immunoglobulins G indicated in the ELISA test system against the specified strain of foot-and-mouth disease virus were obtained in the form of a lyophilic component, which allows JgG to remain in a stable state for at least 4 years with an activity of at least 1:10000 and 1:4000, respectively.
В отличии от прототипа сыворотки крови телят, сильно положительный и положительный контроли получены против высокоочищенного концентрированного инактивированного вируса ящура штамма «Азия-1 №2356/14/2018», что позволяет достичь высокой специфичности и чувствительности при контроле работы тест-системы. Указанные компоненты представлены в виде лиофильно высушенных суспензий, что позволяет хранить их не менее 4 лет с сохранением высокой активности в ИФА. Для контроля 1 активность составляет не менее 1:5000, для контроля 2 - не менее 1:5000. Активность компонентов высокая, что позволяет экономно расходовать компоненты реакции.Unlike the prototype calf blood serum, strongly positive and positive controls were obtained against highly purified concentrated inactivated foot-and-mouth disease virus strain “Asia-1 No. 2356/14/2018”, which makes it possible to achieve high specificity and sensitivity when monitoring the operation of the test system. These components are presented in the form of freeze-dried suspensions, which allows them to be stored for at least 4 years while maintaining high activity in ELISA. For control 1, the activity is at least 1:5000, for control 2 - at least 1:5000. The activity of the components is high, which allows for economical use of reaction components.
В отличии от прототипа для блокирования открытых сайтов связывания применяется очищенная фетальная сыворотка телят, белковые составляющие которой обеспечивают полное закрытие пустых участков на дне иммунологического планшета. Данный компонент также представлен в лиофильном виде, что позволяет хранить его в данном состоянии не менее 4 лет.Unlike the prototype, purified fetal calf serum is used to block open binding sites, the protein components of which ensure complete closure of empty areas at the bottom of the immunological plate. This component is also presented in lyophilic form, which allows it to be stored in this state for at least 4 years.
В отличии от прототипного варианта представленная тест-система предусматривает контроль антигена и конъюгата, что дает возможность учитывать фоновые значения и, тем самым, получать достоверные данные по значениям оптической плотности и титру антител против структурных белков вируса ящура штамма «Азия-1 №2356/14/2018».Unlike the prototype version, the presented test system provides for control of the antigen and conjugate, which makes it possible to take into account background values and, thereby, obtain reliable data on optical density values and antibody titer against the structural proteins of the foot-and-mouth disease virus strain “Asia-1 No. 2356/14” /2018".
В отличии от прототипа в предложенной тест-системе применяются антитела кроличьи к иммуноглобулину G морской свинки H&L (HRP), что позволяет повышать специфичность анализа и получать более достоверные результаты определения титра антител против структурных белков вируса ящура штамма «Азия-1 №2356/14/2018» в сыворотках крови животных. Активность конъюгата составляет 1:4000.Unlike the prototype, the proposed test system uses rabbit antibodies to guinea pig immunoglobulin G H&L (HRP), which makes it possible to increase the specificity of the analysis and obtain more reliable results for determining the titer of antibodies against the structural proteins of the foot-and-mouth disease virus strain “Asia-1 No. 2356/14/ 2018" in animal blood serum. The activity of the conjugate is 1:4000.
Разработанная тест-система основана на специфическом блокировании антигена (структурных белков) вируса ящура штамма «Азия-1 №2356/14/2018» антителами, содержащимися в исследуемой пробе сыворотки в жидкой фазе. Смесь «исследуемая сыворотка/антиген» переносится в лунки планшета, предварительно иммобилизованного сенсибилизирующими антителами кролика против штамма «Азия-1 №2356/14/2018». Наличие антител к структурным белкам вируса ящура данного генотипа в исследуемой пробе будет выражаться в формировании иммунного комплекса и уменьшении количества свободного антигена, который связывается сенсибилизирующими антителами. Фиксированный в лунках антиген взаимодействует с детекторными антителами морской свинки, которые выявляются в реакции с иммунопероксидазным конъюгатом против иммуноглобулинов G морской свинки и последующим окрашиванием с помощью хромогенного субстрата. Интенсивность окрашивания обратно пропорциональна титру антител. Интенсивность цветной реакции учитывают с помощью спектрофотометра.The developed test system is based on the specific blocking of the antigen (structural proteins) of the foot and mouth disease virus strain “Asia-1 No. 2356/14/2018” by antibodies contained in the test serum sample in the liquid phase. The test serum/antigen mixture is transferred into the wells of a plate previously immobilized with rabbit sensitizing antibodies against the Asia-1 strain No. 2356/14/2018. The presence of antibodies to the structural proteins of the foot-and-mouth disease virus of a given genotype in the test sample will be expressed in the formation of an immune complex and a decrease in the amount of free antigen that is bound by sensitizing antibodies. The antigen fixed in the wells interacts with guinea pig detector antibodies, which are detected in a reaction with an immunoperoxidase conjugate against guinea pig immunoglobulins G and subsequent staining with a chromogenic substrate. The intensity of staining is inversely proportional to the antibody titer. The intensity of the color reaction is taken into account using a spectrophotometer.
Сущность изобретения отражена на графических изображениях:The essence of the invention is reflected in graphic images:
Фиг. 1 - Филогенетическая принадлежность штамма «Азия-1 №2356/14/2018» вируса ящура.Fig. 1 - Phylogenetic affiliation of the strain “Asia-1 No. 2356/14/2018” of the foot-and-mouth disease virus.
Фиг. 2 - Седиментационный профиль фракций антигена вируса ящура штамма «Азия-1 №2356/14/2018».Fig. 2 - Sedimentation profile of antigen fractions of the foot-and-mouth disease virus strain “Asia-1 No. 2356/14/2018”.
Фиг. 3 - Электрофореграмма для антигена вируса ящура штамма «Азия-1 №2356/14/2018» в 12% полиакриламидном геле. Примечание: 1 - фракция с 50% сахарозы, 2-6 - фракции с 40% сахарозы, 7-11 - фракции с 30% сахарозы, 12-14 -фракции с 20% сахарозы.Fig. 3 - Electropherogram for the antigen of the foot-and-mouth disease virus strain “Asia-1 No. 2356/14/2018” in 12% polyacrylamide gel. Note: 1 - fraction with 50% sucrose, 2-6 - fractions with 40% sucrose, 7-11 - fractions with 30% sucrose, 12-14 - fractions with 20% sucrose.
Сущность изобретения пояснена в перечне последовательностей, в котором:The essence of the invention is explained in the list of sequences, in which:
SEQ ID NO: 1 представляет последовательность нуклеотидов гена, кодирующего белок VP1 штамма «Азия-1 №2356/14/2018» вируса ящура;SEQ ID NO: 1 represents the nucleotide sequence of the gene encoding the VP 1 protein of the strain “Asia-1 No. 2356/14/2018” of the foot-and-mouth disease virus;
SEQ ID NO: 2 представляет последовательность аминокислот белка VP1 штамма «Азия-1 №2356/14/2018»вируса ящура.SEQ ID NO: 2 represents the amino acid sequence of the VP 1 protein of the “Asia-1 No. 2356/14/2018” foot-and-mouth disease virus strain.
На подготовительном этапе исследования лиофилизированные иммуноспецифические компоненты тест-системы (антиген вируса ящура штамма «Азия-1 №2356/14/2018», иммунопероксидазный конъюгат, положительные и отрицательный контроли, сенсибилизирующие и детекторные антитела) восстанавливают до необходимого объема деионизированной водой.At the preparatory stage of the study, lyophilized immunospecific components of the test system (foot-and-mouth disease virus antigen strain “Asia-1 No. 2356/14/2018”, immunoperoxidase conjugate, positive and negative controls, sensitizing and detector antibodies) are reduced to the required volume with deionized water.
Проводят приготовление рабочих растворов.Working solutions are prepared.
Раствор №1 (КББР). Готовят по стандартной методике 50 мл раствора с водородным показателем 9,5-9,7.Solution No. 1 (CBBR). Prepare 50 ml of a solution with a pH value of 9.5-9.7 using standard methods.
Раствор №2 (Wash-раствор). Готовят 2 л стандартного буферного раствора TBS с добавлением 0,1% tween-20 с водородным показателем 7,5-7,6. Рабочий Wash-раствор готовят разведением концентрата в 20 раз.Solution No. 2 (Wash solution). Prepare 2 liters of standard TBS buffer solution with the addition of 0.1% tween-20 with a pH value of 7.5-7.6. The working wash solution is prepared by diluting the concentrate 20 times.
Раствор №3 (буфер для восстановления антител и конъюгата). Рабочий буферный раствор для разведения антител и иммунопероксидазного конъюгата готовится непосредственно перед использованием из рабочего Wash-раствора с добавлением 10% фетальной сыворотки телят.Solution No. 3 (buffer for the recovery of antibodies and conjugate). A working buffer solution for diluting antibodies and immunoperoxidase conjugate is prepared immediately before use from a working Wash solution with the addition of 10% fetal calf serum.
Этапы проведения жидкофазного блокирующего непрямого «сэндвич»-варианта ИФА для определения титра антител против структурных белков вируса ящура штамма «Азия-1 №2356/14/2018» представлены ниже.The stages of conducting a liquid-phase blocking indirect “sandwich” version of the ELISA to determine the titer of antibodies against the structural proteins of the foot-and-mouth disease virus strain “Asia-1 No. 2356/14/2018” are presented below.
1. Иммобилизация сенсибилизирующих антител против структурных белков вируса ящура. Восстановленную суспензию сенсибилизирующих антител против структурных белков вируса ящура штамма «Азия-1 №2356/14/2018» готовят в разведении 1:10 000 в КББР (раствор №1). Во все лунки иммунологического 96-луночного планшета вносят по 100 мкл суспензии данных антител, накрывают крышкой и инкубируют в течение 18-20 ч при температуре (2-4)°С.1. Immobilization of sensitizing antibodies against the structural proteins of the foot-and-mouth disease virus. A restored suspension of sensitizing antibodies against the structural proteins of the foot-and-mouth disease virus strain “Asia-1 No. 2356/14/2018” is prepared at a dilution of 1:10,000 in CBDR (solution No. 1). 100 μl of a suspension of these antibodies is added to all wells of an immunological 96-well plate, covered with a lid and incubated for 18-20 hours at a temperature of (2-4)°C.
2. Промывание лунок планшета осуществляют с использованием Wash-раствора 2 раза.2. The wells of the plate are washed using Wash solution 2 times.
3. Образование иммунного комплекса в жидкой фазе. Параллельно с иммобилизацией планшета проводят серологическую реакцию связывания антигена с испытуемыми и контрольными пробами сыворотки крови животных. Готовят следующие разведения сывороток крови животных: 4,0; 4,5; 5,0; 5,5; 6,0; 6,5; 7,0; 7,5; 8,0; 8,5; 9,0; 9,5; 10,0; 10,5 log2 SN50 (1:16-1:1448) в растворе №2. Для этого во все лунки планшета за исключением лунок Н1-6, которые оставляют для контроля антигена (КА) и контроля конъюгата (КК), вносят по 0,047 см3 (47 мкл) буферного раствора и 0,003 см3 (3 мкл) пробы. В лунки HI-6 вносят по 0,05 см3 (50 мкл) буферного раствора. Испытуемые и контрольные пробы располагают на планшете согласно таблице 1. Положительной считается сыворотка при титре антител ≥ 5,0 log2 SN50 (≥1:32).3. Formation of an immune complex in the liquid phase. In parallel with the immobilization of the tablet, a serological reaction of antigen binding is carried out with test and control samples of animal blood serum. The following dilutions of animal blood serum are prepared: 4.0; 4.5; 5.0; 5.5; 6.0; 6.5; 7.0; 7.5; 8.0; 8.5; 9.0; 9.5; 10.0; 10.5 log 2 SN 50 (1:16-1:1448) in solution No. 2. To do this, 0.047 cm 3 (47 μl) of a buffer solution and 0.003 cm 3 (3 μl) of a sample are added to all wells of the plate with the exception of wells H1-6, which are left for antigen control (CA) and conjugate control (CC). 0.05 cm 3 (50 μl) of buffer solution is added to the wells of HI-6. Test and control samples are placed on the plate according to Table 1. Serum is considered positive if the antibody titer is ≥ 5.0 log 2 SN 50 (≥ 1:32).
В качестве контроля 1 используют сильно положительную сыворотку крови КРС/свиней против вируса ящура штамма «Азия-1 №2356/14/2018» - процент ингибиции (PI) 80-100%, контроля 2 - положительную сыворотку крови КРС/свиней против вируса ящура штамма «Азия-1 №2356/14/2018» - PI=50,0-79,9%, контроля 3 - нормальную сыворотку КРС/свиней - PI<50%.As control 1, strongly positive blood serum of cattle/pigs is used against the foot-and-mouth disease virus strain “Asia-1 No. 2356/14/2018” - percentage of inhibition (PI) 80-100%, control 2 - positive blood serum of cattle/pigs against the foot-and-mouth disease virus strain "Asia-1 No. 2356/14/2018" - PI=50.0-79.9%, control 3 - normal cattle/pig serum - PI<50%.
Во все лунки планшета добавляют по 0,05 см3 рабочего разведения антигена в растворе №2 в соответствии с разведением 1:3000. После перемешивания содержимого лунок планшета проводят в течение 1 часа при температуре (2-4)°С.Add 0.05 cm 3 of a working dilution of the antigen in solution No. 2 to all wells of the plate in accordance with a dilution of 1:3000. After mixing the contents of the wells, the plate is carried out for 1 hour at a temperature of (2-4)°C.
4. Улавливание антигена. В промытые лунки иммобилизованного планшета вносят по 0,05 см3 смеси контрольных и испытуемых проб и антигена, планшет закрывают крышкой и инкубируют в течение 60±2 мин при температуре (37±1)°С.4. Antigen capture. 0.05 cm 3 of a mixture of control and test samples and antigen is added to the washed wells of the immobilized plate, the plate is closed with a lid and incubated for 60±2 minutes at a temperature of (37±1)°C.
5. Промывание лунок планшета. Проводят, как представлено выше (п. 2). Процедуру повторяют 3 раза.5. Washing the wells of the plate. Carry out as described above (item 2). The procedure is repeated 3 times.
6. Внесение детекторных антител. Во все лунки планшета, за исключением лунок с КК (контроль конъюгата), куда добавляют по 0,05 см3 раствора №3, вносят по 0,05 см3 рабочего разведения детекторных антител (1:4000) в растворе №3. Планшет накрывают крышкой и инкубируют в течение 60±2 мин при температуре (37±1)°С.6. Addition of detector antibodies. In all wells of the plate, with the exception of wells with QC (conjugate control), where 0.05 cm 3 of solution No. 3 is added, 0.05 cm 3 of the working dilution of detector antibodies (1:4000) in solution No. 3 is added. The plate is covered with a lid and incubated for 60±2 minutes at a temperature of (37±1)°C.
7. Промывание лунок планшета. Проводят, как представлено выше (п. 2). Процедуру повторяют 3 раза.7. Washing the wells of the plate. Carry out as described above (item 2). The procedure is repeated 3 times.
8. Внесение конъюгата. Во все лунки планшета вносят по 0,05 см3 рабочего разведения конъюгата (1:4000) в растворе №3. Планшет накрывают крышкой и инкубируют в течение 60±2 мин при температуре (37±1)°С.8. Addition of the conjugate. Add 0.05 cm 3 of the working dilution of the conjugate (1:4000) in solution No. 3 to all wells of the plate. The plate is covered with a lid and incubated for 60±2 minutes at a temperature of (37±1)°C.
9. Промывание лунок планшета. Проводят, как представлено выше (п. 2). Процедуру повторяют 4 раза.9. Washing the wells of the plate. Carry out as described above (item 2). The procedure is repeated 4 times.
10. Проявление цветной реакции. Во все лунки планшета вносят по 0,05 см3 хромогенного субстрата AzBTS-диаммоний, закрывают крышкой и выдерживают 15-20 минут при температуре (20±2)°С.10. Manifestation of color reaction. Add 0.05 cm 3 of the chromogenic substrate AzBTS-diammonium to all wells of the plate, cover with a lid and incubate for 15-20 minutes at a temperature of (20±2)°C.
11. Торможение реакции. Реакцию останавливают добавлением в каждую лунку планшета 0,05 см3 1,0%-ного раствора SLS.11. Inhibition of the reaction. The reaction is stopped by adding 0.05 cm 3 of a 1.0% SLS solution to each well of the plate.
12. Определение значения молярной экстинкции и титра антител по данным ИФА. Результаты анализа учитывают инструментальным способом. Сразу после остановки реакции измеряют молярную экстинкцию (ε(λ)) продуктов реакции в каждой лунке при длине волны 420 нм, используя спектрофотометр для микропланшетов с вертикальным лучом света. Значения ε(λ) переводят в значение процента ингибиции (PI, %) по формуле:12. Determination of the molar extinction value and antibody titer according to ELISA data. The results of the analysis are taken into account in an instrumental way. Immediately after stopping the reaction, measure the molar extinction (ε(λ)) of the reaction products in each well at a wavelength of 420 nm using a microplate spectrophotometer with a vertical light beam. The values of ε(λ) are converted into the percentage of inhibition (PI, %) using the formula:
где - среднее значение оптической плотности смеси сыворотки с инактивированным вирусом ящура штамма «Азия-1 №2356/14/2018»;Where - average optical density of the mixture of serum with inactivated foot-and-mouth disease virus strain “Asia-1 No. 2356/14/2018”;
- среднее значение оптической плотности контроля антигена; - average optical density of the antigen control;
- среднее значение оптической плотности контроля конъюгата. - average optical density of the control conjugate.
Достоверность проводимого анализа с помощью предложенной тест-системы определяется при удовлетворении следующим критериям:The reliability of the analysis performed using the proposed test system is determined if the following criteria are met:
- разница между значениями и не менее 0,4 оптических единиц (о.е.);- difference between values And not less than 0.4 optical units (p.u.);
- контроль 1 имеет значение PI>75%;- control 1 has a PI value>75%;
- контроль 2 имеет значение PI в пределах 50,0-74,9%;- control 2 has a PI value in the range of 50.0-74.9%;
- контроль 3 имеет значение PI<50%.- control 3 has a value of PI<50%.
Сыворотки крови, для которых значение PI≥50%, считают положительными и содержащими антитела к структурным белкам вируса ящура штамма «Азия-1 №2356/14/2018». Значение PI<50% в сыворотке крови обследуемых животных является отрицательным. Исходя из полученных данных берут последнее разведение сыворотки, для которого процент ингибиции составляет ≥ 50%. Данное разведение считают титром антител против ящура, вызванного вирусом ящура штамма «Азия-1 №2356/14/2018» и выражают в log2SN50.Blood sera for which the PI value≥50% are considered positive and contain antibodies to the structural proteins of the foot-and-mouth disease virus strain “Asia-1 No. 2356/14/2018”. A PI value <50% in the blood serum of the examined animals is negative. Based on the data obtained, take the last serum dilution for which the percentage of inhibition is ≥ 50%. This dilution is considered the titer of antibodies against foot and mouth disease caused by the foot and mouth disease virus strain “Asia-1 No. 2356/14/2018” and is expressed in log 2 SN 50 .
В результате проведенных экспериментов были оттитрованы оригинальные компоненты реакции. Активность детекторных антител в ИФА составила 1:4000, сенсибилизирующих антител - 1:10000, антивидового конъюгата - 1:4000; антигена вируса ящура штамма «Азия-1 №2356/14/2018» - 1:3000, контроля 1 - 1:5000, контроля 2 - 1:5000. С использованием разработанной тест-системы проведено исследование образцов сывороток крови животных с определением антител и проведен сравнительный анализ с результатами РМН в чувствительной перевиваемой монослойной клеточной линии почки свиньи (IB-RS-2) [8].As a result of the experiments, the original components of the reaction were titrated. The activity of detector antibodies in ELISA was 1:4000, sensitizing antibodies - 1:10000, anti-species conjugate - 1:4000; foot and mouth disease virus antigen strain "Asia-1 No. 2356/14/2018" - 1:3000, control 1 - 1:5000, control 2 - 1:5000. Using the developed test system, a study of animal blood serum samples was carried out to determine antibodies and a comparative analysis was carried out with the results of RMN in a sensitive continuous monolayer pig kidney cell line (IB-RS-2) [8].
Разработанная тест-система дает возможность тестировать одновременно в формате одного 96-луночного планшета 6 проб сывороток в следующих разведениях, выраженных в двоичном логарифме: 4,0; 4,5; 5,0; 5,5; 6,0;.6,5; 7,0; 7,5; 8,0; 8,5; 9,0: 9,5; 10,0; 10,5 log2 SN50 (1:16-1:1448).The developed test system makes it possible to test simultaneously in the format of one 96-well plate 6 serum samples in the following dilutions, expressed in binary logarithm: 4.0; 4.5; 5.0; 5.5; 6.0;.6.5; 7.0; 7.5; 8.0; 8.5; 9.0: 9.5; 10.0; 10.5 log 2 SN 50 (1:16-1:1448).
Для работы применяли антиген (структурные белки, 146S компонент) вируса ящура штамма «Азия-1 №2356/14/2018».For the work, we used the antigen (structural proteins, 146S component) of the foot and mouth disease virus strain “Asia-1 No. 2356/14/2018”.
Контроль штамма «Азия-1 №2356/14/2018» вируса ящура на специфичность.Monitoring the strain “Asia-1 No. 2356/14/2018” of the foot-and-mouth disease virus for specificity.
Специфичность штамма «Азия-1 №2356/14/2018» генотипа Asia-1/ASIA/Sindh-08 вируса ящура определена с помощью ОТ-ПЦР с последующим секвенированием 1D-гена, соответствующего белку VP1, в котором наиболее часто возникают мутации. По результатам исследования нуклеотидной последовательности указанного гена была выявлена принадлежность штамма «Азия-1 №2356/14/2018» к генотипу Asia-1/ASIA/Sindh-08. Расчет проводился в соответствии с Байесовской теорией вероятности. Специфичность подтверждена также в реакции связывания комплемента со штаммоспецифической сывороткой. Концентрация общего вирусного белка в исследуемом антигене вируса ящура штамма «Азия-1 №2356/14/2018» составила 3,95 мкг/мл, концентрация 146S компонента - 2,92 мкг/мл (74%), 146S+75S компонента - 3,79 мкг/мл (96%), 12 S частиц - 0,16 мкг/мл (4%). Экспериментально подтверждена возможность использования штамма «Азия-1 №2356/14/2018» генотипа Asia-1/ASIA/Sindh-08 вируса ящура для разработки диагностических тест-систем.The specificity of the Asia-1 strain No. 2356/14/2018 of the Asia-1/ASIA/Sindh-08 genotype of foot-and-mouth disease virus was determined using RT-PCR followed by sequencing of the 1D gene corresponding to the VP 1 protein, in which mutations most often occur. Based on the results of a study of the nucleotide sequence of this gene, it was revealed that the strain “Asia-1 No. 2356/14/2018” belongs to the genotype Asia-1/ASIA/Sindh-08. The calculation was carried out in accordance with Bayesian probability theory. Specificity was also confirmed in the complement fixation reaction with strain-specific serum. The concentration of the total viral protein in the studied antigen of the foot-and-mouth disease virus strain "Asia-1 No. 2356/14/2018" was 3.95 μg/ml, the concentration of the 146S component was 2.92 μg/ml (74%), the 146S+75S component was 3 .79 µg/ml (96%), 12 S particles - 0.16 µg/ml (4%). The possibility of using the strain “Asia-1 No. 2356/14/2018” of the Asia-1/ASIA/Sindh-08 genotype of the foot-and-mouth disease virus for the development of diagnostic test systems has been experimentally confirmed.
Морфологические признаки.Morphological characteristics.
Штамм «Азия-1 №2356/14/2018» вируса ящура относится к семейству Picornaviridae, роду Aphthovirus, серотипу А, генотипу Asia-1/ASIA/Sindh-08 и обладает морфологическими признаками, характерными для возбудителя ящура: форма вириона икосаэдрическая, размер 25 нм. Вирион состоит из молекулы РНК, заключенной в белковую оболочку, которая состоит из 32 капсомеров с кубическим типом симметрии.Strain “Asia-1 No. 2356/14/2018” of the foot-and-mouth disease virus belongs to the family Picornaviridae, genus Aphthovirus, serotype A, genotype Asia-1/ASIA/Sindh-08 and has morphological characteristics characteristic of the causative agent of foot-and-mouth disease: icosahedral virion shape, size 25 nm. The virion consists of an RNA molecule enclosed in a protein shell, which consists of 32 capsomers with cubic type of symmetry.
Антигенные свойства.Antigenic properties.
По своим антигенным свойствам штамм «Азия-1 №2356/14/2018» вируса ящура стабильно нейтрализуется гомологичной антисывороткой. У переболевших животных в сыворотке крови образуются антитела, выявляемые в ИФА и РМН.According to its antigenic properties, the strain “Asia-1 No. 2356/14/2018” of the foot-and-mouth disease virus is stably neutralized by a homologous antiserum. In animals that have recovered from the disease, antibodies are formed in the blood serum, which are detected in ELISA and RMN.
При гипериммунизации морских свинок концентрированный антиген из инактивированного вируса ящура штамма «Азия-1 №2356/14/2018» индуцирует образование вирусоспецифических антител, выявляемых в РСК в разведении не менее 1:4000.When hyperimmunizing guinea pigs, the concentrated antigen from the inactivated foot-and-mouth disease virus strain “Asia-1 No. 2356/14/2018” induces the formation of virus-specific antibodies detected in RSC at a dilution of at least 1:4000.
Антигенное родство штамма «Азия-1 №2356/14/2018» вируса ящура с имеющимися производственными штаммами вируса ящура серотипа Asia-1 исследовано серологическим методом в перекрестной РМН. Штамм «Азия-1 №2356/14/2018» антигенно отличается от производственных штаммов «Азия-1 №2145/Таджикистан/2011», «Азия-1 №1987/Амурский/2005», штамм вируса ящура «Азия-1 №1946/ Шамир 3/89».The antigenic affinity of the foot-and-mouth disease virus strain “Asia-1 No. 2356/14/2018” with the existing production strains of the foot-and-mouth disease virus serotype Asia-1 was studied by the serological method in a cross-sectional RMN. The strain “Asia-1 No. 2356/14/2018” is antigenically different from the production strains “Asia-1 No. 2145/Tajikistan/2011”, “Asia-1 No. 1987/Amur/2005”, and the foot-and-mouth disease strain “Asia-1 No. 1946” / Shamir 3/89".
Антигенное соответствие (r1) для штамма «Азия-1 №2145/Таджикистан/2011» составило 0,29, «Азия-1 №1987/Амурский/2005» - 0,29, «Азия-1 №1946/ Шамир 3/89» - 0,18. При значении r1≥0,3 полевой изолят и производственный штамм являются родственными, и вакцина из производственного штамма будет защищать от эпизоотического полевого вируса, при значении r1<0,3 полевой изолят отличается от производственного штамма, и вакцина из данного штамма не защищает от эпизоотического полевого вируса.Antigenic correspondence (r 1 ) for the strain “Asia-1 No. 2145/Tajikistan/2011” was 0.29, “Asia-1 No. 1987/Amur/2005” - 0.29, “Asia-1 No. 1946/Shamir 3/ 89" - 0.18. With a value of r 1 ≥0.3, the field isolate and the production strain are related, and the vaccine from the production strain will protect against the epizootic field virus; with the value of r 1 <0.3, the field isolate differs from the production strain, and the vaccine from this strain does not protect from an epizootic field virus.
Биотехнологические характеристики.Biotechnological characteristics.
Штамм «Азия-1 №2356/14/2018» репродуцируется в перевиваемых монослойных клеточных линиях почки сибирского горного козерога (ПСГК-30), почки свиньи IB-RS-2, почки новорожденного сирийского хомячка ВНК-21/SUSP/ARRIAH, и в течение 12-15 часов инкубирования вирус в указанных культурах клеток накапливается от 6,90 до 8,85 lg ТЦД50/см3.Strain “Asia-1 No. 2356/14/2018” is reproduced in continuous monolayer cell lines of Siberian mountain ibex kidney (PSGK-30), pig kidney IB-RS-2, newborn Syrian hamster kidney VNK-21/SUSP/ARRIAH, and in During 12-15 hours of incubation, the virus in these cell cultures accumulates from 6.90 to 8.85 lg TCD 50 /cm 3 .
Генотаксономическая характеристика.Genotaxonomic characteristics.
Штамм «Азия-1 №2356/14/2018» вируса ящура серотипа Азия-1 является РНК (+) - содержащим вирусом. Нуклеиновая кислота представлена одноцепочной линейной молекулой с молекулярной массой 2,85×106 Да. Вирион имеет белковую оболочку, состоящую из четырех структурных белков VP1, VP2, VP3 и VP4.Strain “Asia-1 No. 2356/14/2018” of foot-and-mouth disease virus serotype Asia-1 is an RNA (+)-containing virus. Nucleic acid is represented by a single-chain linear molecule with a molecular weight of 2.85×10 6 Da. The virion has a protein shell consisting of four structural proteins VP 1 , VP 2 , VP 3 and VP 4 .
Основным антигенным белком является VP1. В вирионе содержится приблизительно 31,5% РНК и 68,5% белка. Вирионная РНК является инфекционной и участвует в образовании белков-предшественников в инфицированных клетках. Предшественники расщепляются с образованием более стабильных структурных и неструктурных полипептидов. Из 8 неструктурных полипептидов, накапливающихся в инфицированных клетках, один является РНК-зависимой РНК-полимеразой, участвующей в репликации РНК новых вирионов.The main antigenic protein is VP 1 . The virion contains approximately 31.5% RNA and 68.5% protein. Virion RNA is infectious and is involved in the formation of precursor proteins in infected cells. The precursors are cleaved to form more stable structural and nonstructural polypeptides. Of the 8 nonstructural polypeptides that accumulate in infected cells, one is an RNA-dependent RNA polymerase involved in the RNA replication of new virions.
Физические свойства.Physical properties.
Для данного вируса при константе седиментации полных вирусных частиц 146 S, константе диффузии 1,40 см2/с молекулярная масса составляет 8,08×106Д. Размер вириона 25 нм, масса составляет 8,42×10-18 г. For this virus, with a sedimentation constant of complete viral particles of 146 S and a diffusion constant of 1.40 cm 2 /s, the molecular weight is 8.08 × 10 6 D. The size of the virion is 25 nm, the mass is 8.42 × 10 -18 g.
Устойчивость к внешним факторам.Resistance to external factors.
Штамм «Азия-1 №2356/14/2018» устойчив к эфиру, хлороформу, ацетону и другим органическим растворителям и детергентам. Наиболее стабилен при рН 7,5-7,8. Сдвиги водородного показателя как в кислую, так и в щелочную сторону ведут к инактивации вируса. Вирусная частица чувствительна к формальдегиду, УФ-облучению, γ-облучению, высоким температурам.Strain “Asia-1 No. 2356/14/2018” is resistant to ether, chloroform, acetone and other organic solvents and detergents. Most stable at pH 7.5-7.8. Shifts in the pH value both to the acidic and alkaline sides lead to inactivation of the virus. The viral particle is sensitive to formaldehyde, UV irradiation, γ-irradiation, and high temperatures.
Дополнительные признаки и свойства.Additional characteristics and properties.
Иммуногенная активность - иммуногенен в составе инактивированной вакцины.Immunogenic activity - immunogenic as part of an inactivated vaccine.
Антигенная активность - введение инактивированного вируса ящура штамма «Азия-1 №2356/14/2018» морским свинкам, кроликам, свиньям, овцам, КРС индуцирует образование вирусспецифических антител.Antigenic activity - the introduction of inactivated foot-and-mouth disease virus strain "Asia-1 No. 2356/14/2018" to guinea pigs, rabbits, pigs, sheep, and cattle induces the formation of virus-specific antibodies.
Реактогенность - реактогенными свойствами не обладает.Reactogenicity - does not have reactogenic properties.
Патогенность - антиген не патогенен для парнокопытных животных, новорожденных мышат, морских свинок.Pathogenicity - the antigen is not pathogenic for artiodactyl animals, newborn mice, guinea pigs.
Вирулентность - антиген не вирулентен для естественно-восприимчивых животных при контактном, аэрозольном и парентеральном заражении.Virulence - the antigen is not virulent for naturally susceptible animals during contact, aerosol and parenteral infection.
Стабильность - не инактивированный вирус сохраняет исходные биологические свойства при культивировании в чувствительных биологических системах в течение 5 пассажей (срок наблюдения).Stability - non-inactivated virus retains its original biological properties when cultivated in sensitive biological systems for 5 passages (observation period).
Сущность изобретения пояснена примерами его использования, которые не ограничивают объем изобретения.The essence of the invention is illustrated by examples of its use, which do not limit the scope of the invention.
Пример 1. Получение антигена вируса ящура штамма «Азия-1 №2356/14/2018».Example 1. Obtaining the antigen of the foot and mouth disease virus strain “Asia-1 No. 2356/14/2018”.
Для получения антигена вируса ящура штамма «Азия-1 №2356/14/2018» для диагностических целей проводили суспензионное культивирование вируса в клеточной линии BHK-21/SUSP/ARPJAH в течение 8-9 ч с получением вирусной суспензии с титром инфекционной активности не ниже 6,5 lg ТЦД50/см3. Полученную вирусную суспензию инактивировали с помощью аминоэтилэтиленимина и осветляли полигексаметиленгуанидином.To obtain the antigen of the foot-and-mouth disease virus strain "Asia-1 No. 2356/14/2018" for diagnostic purposes, suspension cultivation of the virus was carried out in the cell line BHK-21/SUSP/ARPJAH for 8-9 hours to obtain a viral suspension with a titer of infectious activity no lower 6.5 lg TCD 50 / cm 3 . The resulting viral suspension was inactivated with aminoethylethylenimine and clarified with polyhexamethylene guanidine.
Инактивированную культуральную суспензию, содержащую антиген вирус ящура, осветляли в течение 30 мин. при 6000 об/мин и 4°С. Надосадочную жидкость отбирали и добавляли в нее полиэтиленгликоль с молекулярным весом 6000 Д (ПЭГ-6000) до конечной концентрации 8,5% и хлорид натри (сухой) до конечной концентрации 0,85%, интенсивно перемешивали и выдерживали при температуре 2±1°С в течение 18-24 часов. Вирусную суспензию осаждали при 6000 об/мин в течение 60 мин., осадок растворяли в 1/15 М растворе фосфатно-солевого буфера, концентрируя в 500 раз (1/500 от первоначального объема).The inactivated cultural suspension containing the foot-and-mouth disease virus antigen was clarified for 30 minutes. at 6000 rpm and 4°C. The supernatant liquid was taken and polyethylene glycol with a molecular weight of 6000 D (PEG-6000) was added to it to a final concentration of 8.5% and sodium chloride (dry) to a final concentration of 0.85%, mixed intensively and kept at a temperature of 2±1°C within 18-24 hours. The viral suspension was precipitated at 6000 rpm for 60 minutes, the sediment was dissolved in a 1/15 M solution of phosphate-buffered saline, concentrating 500 times (1/500 of the original volume).
К полученному преципитату добавляли 50% хлороформа, интенсивно перемешивали и фракционировали с помощью центрифуги в течение 30 мин. при 3000 об/мин. Отбирали верхнюю водную фракцию, содержащую антиген вируса ящура штамма «Азия-1 №2356/14/2018». Отбирали 100 мкл образца для последующего электрофоретического анализа в 12% полиакриламидном геле в денатурирующих условиях.50% chloroform was added to the resulting precipitate, mixed vigorously and fractionated using a centrifuge for 30 min. at 3000 rpm. The upper aqueous fraction containing the antigen of the foot-and-mouth disease virus strain “Asia-1 No. 2356/14/2018” was selected. 100 μl of sample was taken for subsequent electrophoretic analysis in a 12% polyacrylamide gel under denaturing conditions.
На следующем этапе проводили получение 146S частиц вируса ящура штамма «Азия-1 №2356/14/2018» (данный компонент является структурным, состоит из структурных белков вируса, является иммуногенным).At the next stage, 146S particles of foot and mouth disease virus strain “Asia-1 No. 2356/14/2018” were obtained (this component is structural, consists of structural proteins of the virus, and is immunogenic).
Для выделения полных частиц с коэффициентом седиментации 146S готовили линейный градиент сахарозы с концентрациями 50, 40, 30, 20% (по направлению слоев в центрифужной пробирке снизу вверх). Суспензию антигена вируса ящура штамма «Азия-1 №2356/14/2018» вносили по 15 мл в центрифужные пробирки, затем последовательно подслаивали растворы сахарозы, начиная с 20%-го и заканчивая 50%-м раствором. Пробирки помещали в металлические центрифужные стаканы и после тщательно выполненного уравновешивания центрифугировали при скорости 30000 об/мин и температуре 2±1°С в течение 4 часов. Фракционирование градиента сахарозы производили с помощью перистальтического насоса, отбирая фракции по 1,0 мл в отдельные пробирки. Начало и конец пика 146S компонента определяли по спектральному профилю на спектрограмме, объединяя фракции, входящие в этот диапазон.To isolate complete particles with a sedimentation coefficient of 146S, a linear gradient of sucrose was prepared with concentrations of 50, 40, 30, 20% (in the direction of the layers in the centrifuge tube from bottom to top). A suspension of the antigen of the foot-and-mouth disease virus strain “Asia-1 No. 2356/14/2018” was added in 15 ml quantities to centrifuge tubes, then sucrose solutions were successively layered, starting with a 20% solution and ending with a 50% solution. The tubes were placed in metal centrifuge beakers and, after careful equilibration, were centrifuged at a speed of 30,000 rpm and a temperature of 2±1°C for 4 hours. Fractionation of the sucrose gradient was carried out using a peristaltic pump, collecting 1.0 ml fractions into separate tubes. The beginning and end of the peak of the 146S component were determined from the spectral profile on the spectrogram, combining fractions included in this range.
При использовании перистальтического насоса сначала оценивали визуально пробирку с градиентом сахарозы. Опалесцирующий слой, содержащий 146S компонент, располагается приблизительно в 30%-м слое сахарозы. 146S компонент переосаждали с помощью ультрацентрифугирования в течение 4 часов при скорости 25000 об/мин. и температуре 2±1°С и ресуспендировали осадок в 1/15 М фосфатно-солевом буферном растворе.When using a peristaltic pump, the sucrose gradient tube was first assessed visually. The opalescent layer containing the 146S component is located in approximately 30% sucrose layer. The 146S component was reprecipitated by ultracentrifugation for 4 hours at 25,000 rpm. and temperature 2±1°C and resuspended the sediment in 1/15 M phosphate-buffered saline solution.
Результаты спектрометрического исследования полученных фракций антигена вируса ящура штамма «Азия-1 №2356/14/2018» в виде антигенного профиля представлены на фиг. 2. Анализ проводили для 16 фракций, пики наблюдали для фракций №4-7. Проведен электрофорез полученных фракций в 12% полиакриламидном геле в денатурирующих условиях фракций, в которых возможно нахождение 146S компонента вируса ящура данного штамма (фиг. 3). Данные гель-электрофореза подтверждают результаты спектрального профиля.The results of a spectrometric study of the obtained antigen fractions of the foot-and-mouth disease virus strain “Asia-1 No. 2356/14/2018” in the form of an antigenic profile are presented in Fig. 2. The analysis was carried out for 16 fractions, peaks were observed for fractions No. 4-7. Electrophoresis of the obtained fractions was carried out in a 12% polyacrylamide gel under denaturing conditions of fractions in which the 146S component of the foot-and-mouth disease virus of this strain could be found (Fig. 3). Gel electrophoresis data confirm the spectral profile results.
Пример 2. Получение гипериммунной сыворотки крови кроликов (сенсибилизирующие антитела) против антигена вируса ящура штамма «Азия-1 №2356/14/2018».Example 2. Preparation of hyperimmune rabbit blood serum (sensitizing antibodies) against the antigen of the foot-and-mouth disease virus strain “Asia-1 No. 2356/14/2018”.
Для получения специфических сывороток крови против вируса ящура штамма «Азия-1 №2356/14/2018» использовали клинически здоровых кроликов средней упитанности массой 2,5-3,0 кг.To obtain specific blood sera against the foot and mouth disease virus strain “Asia-1 No. 2356/14/2018,” clinically healthy rabbits of average fatness weighing 2.5-3.0 kg were used.
Для гипериммунизации животных применяли концентрированный очищенный антиген вируса ящура штамма «Азия-1 №2356/14/2018», полученный как описано в примере 1, из которого готовили эмульсию с использованием масляного адъюванта Montanide ISA-201 R VG (в соотношении адъювант/антиген = 70/30 по массе). Полученную вакцину вводили в мышцу задних конечностей кролика на 0, 14 и 28 дни в объеме 0,5 см3. Через 7 дней после последней иммунизации у кроликов отбирали кровь, содержащую сенсибилизирующие антитела, которую лиофильно высушивали и хранили при температуре (1-3)°С.For hyperimmunization of animals, a concentrated purified antigen of the foot and mouth disease virus strain “Asia-1 No. 2356/14/2018” was used, obtained as described in example 1, from which an emulsion was prepared using the oil adjuvant Montanide ISA-201 R VG (in the ratio adjuvant/antigen = 70/30 by weight). The resulting vaccine was injected into the muscle of the hind limbs of a rabbit on days 0, 14 and 28 in a volume of 0.5 cm 3 . 7 days after the last immunization, blood containing sensitizing antibodies was collected from rabbits, which was freeze-dried and stored at a temperature of (1-3)°C.
Пример 3. Получение гипериммунной сыворотки крови морских свинок (детекторные антитела) против антигена вируса ящура штамма «Азия-1 №2356/14/2018».Example 3. Obtaining hyperimmune blood serum of guinea pigs (detector antibodies) against the antigen of the foot and mouth disease virus strain “Asia-1 No. 2356/14/2018”.
Для гипериммунизации морских свинок использовали эмульсию очищенного препарата концентрированного антигена вируса ящура штамма «Азия-1 №2356/14/2018», полученного как описано в примере 1. Приготовление вакцины и схема иммунизации такая, как в примере 2.For hyperimmunization of guinea pigs, an emulsion of a purified preparation of a concentrated antigen of the foot and mouth disease virus strain “Asia-1 No. 2356/14/2018” was used, obtained as described in example 1. The preparation of the vaccine and the immunization scheme are the same as in example 2.
Пример 4. Определение активности в ИФА антигена вируса ящура штамма «Азия-1 №2356/14/2018», сенсибилизирующих и детекторных антител к нему.Example 4. Determination of the activity in ELISA of the antigen of the foot-and-mouth disease virus strain “Asia-1 No. 2356/14/2018”, sensitizing and detector antibodies to it.
Образцы сывороток крови животных проверяли на активность и специфичность в жидкофазном блокирующем непрямом «сэндвич»-варианте ИФА. Проведен подбор оптимальных рабочих разведений указанных компонентов для получения достоверных результатов в ИФА. Полученные данные анализа представлены в таблицах 2, 3, 4.Animal blood serum samples were tested for activity and specificity in a liquid-phase blocking indirect “sandwich” version of the ELISA. The selection of optimal working dilutions of these components was carried out to obtain reliable results in ELISA. The obtained analysis data are presented in tables 2, 3, 4.
Для анализа исследовали следующие разведения сенсибилизирующих антител: 1:8000, 1:9000, 1:10000, 1:11000. Разведения остальных компонентов были постоянны: для антигена - 1:3000, для детекторных антител - 1:4000, конъюгата - 1:4000. В качестве контрольных сывороток для анализа применяли сыворотки, специфичные к определенным штаммам вируса ящура с активностью 8,0 log2 SN50. Их таблицы 2 следует, что при разведении сенсибилизирующих антител 1:10000 достигалось получение достоверного результата (1:256 или 8,0 log2 SN50). При меньших разведений антител наблюдали высокие фоновые значения, что не позволяло получить корректный результат.При большем разведении отмечали снижение детектируемых значений уровня гуморального иммунитета в сыворотках крови животных. При исследовании неспецифических и отрицательных сывороток получали отрицательные результаты, что свидетельствовало о высокой специфичности разработанного способа.For analysis, the following dilutions of sensitizing antibodies were studied: 1:8000, 1:9000, 1:10000, 1:11000. The dilutions of the remaining components were constant: for antigen - 1:3000, for detector antibodies - 1:4000, conjugate - 1:4000. Sera specific to certain strains of foot-and-mouth disease virus with an activity of 8.0 log 2 SN 50 were used as control sera for analysis. Their table 2 shows that with a dilution of sensitizing antibodies of 1:10000, a reliable result was achieved (1:256 or 8.0 log 2 SN 50 ). At lower dilutions of antibodies, high background values were observed, which did not allow obtaining a correct result. At higher dilutions, a decrease in the detected values of the level of humoral immunity in the blood sera of animals was noted. When studying nonspecific and negative sera, negative results were obtained, which indicated the high specificity of the developed method.
Для анализа исследовали следующие разведения детекторных антител: 1:3000, 1:3500, 1:4000, 1:4500. Разведения остальных компонентов были постоянны: для антигена - 1:3000, для сенсибилизирующих антител - 1:10000, конъюгата - 1:4000. В качестве контрольных сывороток для анализа применяли сыворотки, специфичные к определенным штаммам вируса ящура с активностью 8,0 log2 SN50. Их таблицы 3 следует, что при разведении детекторных антител 1:4000 достигалось получение достоверного результата (1:256 или 8,0 log2 SN50). При меньших разведений антител наблюдали высокие фоновые значения, что не позволяло получить корректный результат.При большем разведении наблюдали снижение детектируемого значения титра антител в сыворотках крови животных. При исследовании неспецифических и отрицательных сывороток отмечали отрицательные результаты, что свидетельствовало о высокой специфичности разработанного способа.For analysis, the following dilutions of detector antibodies were studied: 1:3000, 1:3500, 1:4000, 1:4500. The dilutions of the remaining components were constant: for antigen - 1:3000, for sensitizing antibodies - 1:10000, conjugate - 1:4000. Sera specific to certain strains of foot-and-mouth disease virus with an activity of 8.0 log 2 SN 50 were used as control sera for analysis. Their table 3 shows that with a dilution of detector antibodies of 1:4000, a reliable result was achieved (1:256 or 8.0 log 2 SN 50 ). At lower dilutions of antibodies, high background values were observed, which did not allow obtaining a correct result. At higher dilutions, a decrease in the detectable value of antibody titer in the blood sera of animals was observed. When studying nonspecific and negative sera, negative results were noted, which indicated the high specificity of the developed method.
Для анализа исследовали следующие разведения антигена: 1:1500, 1:2000, 1:2500, 1:3000. Разведения остальных компонентов были постоянны: для детекторных антител - 1:4000, для сенсибилизирующих антител - 1:10000, конъюгата - 1:4000. В качестве контрольных сывороток для анализа применяли сыворотки, специфичные к определенным штаммам вируса ящура с активностью 8,0 log2 SN50. Их таблицы 4 следует, что при разведении антигена 1:3000 достигалось получение достоверного результата (1:256 или 8,0 log2 SN50). При меньших разведениях наблюдали высокие фоновые значения, что не позволяло получить корректный результат. При большем разведении наблюдали снижение детектируемого значения титра антител в сыворотках крови животных.The following antigen dilutions were tested for analysis: 1:1500, 1:2000, 1:2500, 1:3000. The dilutions of the remaining components were constant: for detector antibodies - 1:4000, for sensitizing antibodies - 1:10000, conjugate - 1:4000. Sera specific to certain strains of foot-and-mouth disease virus with an activity of 8.0 log 2 SN 50 were used as control sera for analysis. Their table 4 shows that when the antigen was diluted 1:3000, a reliable result was achieved (1:256 or 8.0 log 2 SN 50 ). At lower dilutions, high background values were observed, which did not allow obtaining a correct result. At higher dilutions, a decrease in the detectable value of antibody titer in animal blood sera was observed.
При исследовании неспецифических и отрицательных сывороток отмечали отрицательные результаты, что свидетельствовало о высокой специфичности разработанной тест-системы.When examining nonspecific and negative sera, negative results were noted, which indicated the high specificity of the developed test system.
Таким образом, в ходе лабораторных исследований доказано, что рабочие разведения антигена вируса ящура штамма «Азия-1 №2356/14/2018», сенсибилизирующих и детекторных антител составили 1:3000, 1:10000, 1:4000, соответственно.Thus, in the course of laboratory studies it was proven that the working dilutions of the antigen of the foot and mouth disease virus strain “Asia-1 No. 2356/14/2018”, sensitizing and detector antibodies were 1:3000, 1:10000, 1:4000, respectively.
Пример 5. Применение тест-системы для определения титра антител против структурных белков вируса ящура штамма «Азия-1 №2356/14/2018» с помощью жидкофазного блокирующего непрямого «сэндвич»-варианта ИФА.Example 5. Use of a test system to determine the titer of antibodies against the structural proteins of the foot-and-mouth disease virus strain “Asia-1 No. 2356/14/2018” using a liquid-phase blocking indirect “sandwich” version of the ELISA.
Исследовали 12 сывороток крови животных, полученных после иммунизации инактивированными сорбированными вакцинами против ящура, содержащими антиген вируса ящура штамма «Азия-1 №2356/14/2018». Определены значения титра антител против структурных белов вируса ящура с применением разработанной тест-системы ИФА, а также данные сыворотки были исследованы в РМН в чувствительной перевиваемой монослойной клеточной линии IB-RS-2, рекомендованной МЭБ (OIE) [8]. Полученные результаты отражены в таблице 5, из которой следует, что степень корреляции результатов разработанной тест-системы ИФА (предлагаемое изобретение) и классического метода РМН высокая (приближено к 100%).We studied 12 animal blood sera obtained after immunization with inactivated sorbed vaccines against foot-and-mouth disease containing the antigen of the foot-and-mouth disease virus strain “Asia-1 No. 2356/14/2018”. The values of the antibody titer against the structural proteins of the foot-and-mouth disease virus were determined using the developed ELISA test system, and the serum data were examined in the RMN in the sensitive continuous monolayer cell line IB-RS-2, recommended by the OIE (OIE) [8]. The results obtained are reflected in Table 5, from which it follows that the degree of correlation between the results of the developed ELISA test system (the proposed invention) and the classical RMN method is high (close to 100%).
Пример 6. Определение диагностических показателей разработанной тест-системы для определения титра антител против структурных белков вируса ящура штамма «Азия-1 №2356/14/2018» с помощью жидкофазного блокирующего непрямого «сэндвич»-варианта ИФА (предлагаемое изобретение).Example 6. Determination of diagnostic parameters of the developed test system for determining the titer of antibodies against the structural proteins of the foot-and-mouth disease virus strain “Asia-1 No. 2356/14/2018” using a liquid-phase blocking indirect “sandwich” version of the ELISA (the proposed invention).
Для исследования представленной тест-системы (предлагаемое изобретение) для определения титра антител против структурных белков вируса ящура штамма «Азия-1 №2356/14/2018» с помощью жидкофазного блокирующего непрямого «сэндвич»-варианта ИФА исследовали стандартные диагностические показатели. Для определения чувствительности предложенной тест-системы анализировали 625 сывороток крови животных, которые являлись заведомо положительными по данным РМН в чувствительной перевиваемой монослойной клеточной линии почки свиньи IB-RS-2. Уровень антител для данных сывороток крови находилась в диапазоне 5,5-10,5 log2 SN50. Постановку ИФА проводили, как отражено выше. Разработанной тест-системой (предлагаемое изобретение) определили, что из 625 образцов сывороток крови 623 определены в качестве положительных, а 2 - в качестве отрицательных (титр антител по данным ИФА составил 1:22). Для исследования специфичности метода тестировали 202 отрицательных сывороток крови животных. В результате исследования с помощью ИФА (предлагаемое изобретение) определили, что из 202 отрицательных проб - 202 определены в качестве отрицательных. Определили, что в 95%-ном доверительном интервале диагностическая чувствительность (DSe) составила 98,85-99,96%, диагностическая специфичность (DSp) - 98,19-100,00%, k-критерий - 0,993; прогностичность отрицательного результата (NPV) - 96,50-99,88%, общая точность (DAc) - 99,13-99,97% (таблица 6).To study the presented test system (the proposed invention) to determine the titer of antibodies against the structural proteins of the foot-and-mouth disease virus strain “Asia-1 No. 2356/14/2018” using a liquid-phase blocking indirect “sandwich” version of the ELISA, standard diagnostic indicators were examined. To determine the sensitivity of the proposed test system, 625 animal blood sera were analyzed, which were obviously positive according to RMN data in the sensitive continuous monolayer pig kidney cell line IB-RS-2. The antibody level for these blood sera was in the range of 5.5-10.5 log 2 SN 50 . ELISA was performed as described above. The developed test system (the proposed invention) determined that out of 625 blood serum samples, 623 were identified as positive, and 2 as negative (antibody titer according to ELISA data was 1:22). To study the specificity of the method, 202 negative animal blood sera were tested. As a result of the study using ELISA (the proposed invention), it was determined that out of 202 negative samples, 202 were identified as negative. It was determined that in the 95% confidence interval, diagnostic sensitivity (DSe) was 98.85-99.96%, diagnostic specificity (DSp) - 98.19-100.00%, k-criterion - 0.993; negative predictive value (NPV) - 96.50-99.88%, overall accuracy (DAc) - 99.13-99.97% (Table 6).
Таким образом предлагаемая «Тест-система для определения титра антител против структурных белков вируса ящура штамма «Азия-1 №2356/14/2018» с помощью жидкофазного блокирующего непрямого «сэндвич»-варианта ИФА» является специфичной и чувствительной, позволяющей быстро в течение 4 часов провести анализ сывороток крови животных с определением титра антител против структурных белков вируса ящура штамма «Азия-1 №2356/14/2018». Генотип Asia-1/ASIA/Sindh-08 и именно данная его модификация в виде штамма «Азия-1 №2356/14/2018» является актуальным и быстро распространяющимся на территории Азии, а также в странах Ближнего Востока. Разработанная тест-система будет направлена на подтверждение высокой эффективности производимых в РФ противоящурных инактивированных вакцин, содержащих антиген данного генотипа, и, тем самым, на защиту территории России и граничащих с ней на юге стран от распространения вируса ящура генотипа Asia-1/ASIA/Sindh-08.Thus, the proposed “Test system for determining the titer of antibodies against the structural proteins of the foot-and-mouth disease virus strain “Asia-1 No. 2356/14/2018” using a liquid-phase blocking indirect “sandwich” ELISA version” is specific and sensitive, allowing rapid hours to analyze animal blood sera to determine the titer of antibodies against the structural proteins of the foot-and-mouth disease virus strain “Asia-1 No. 2356/14/2018”. The genotype Asia-1/ASIA/Sindh-08 and this particular modification of it in the form of the strain “Asia-1 No. 2356/14/2018” is relevant and rapidly spreading throughout Asia, as well as in the countries of the Middle East. The developed test system will be aimed at confirming the high efficiency of foot-and-mouth disease inactivated vaccines produced in the Russian Federation containing the antigen of this genotype, and, thereby, protecting the territory of Russia and the countries bordering it in the south from the spread of foot-and-mouth disease virus genotype Asia-1/ASIA/Sindh -08.
Источники информации, принятые во внимание при составлении описания изобретения к заявке на выдачу патента РФ на изобретение «Тест-система для определения титра антител против структурных белков вируса ящура штамма «Азия-1 №2356/14/2018» с помощью жидкофазного блокирующего непрямого «сэндвич»-варианта ИФА»:Sources of information taken into account when drawing up a description of the invention for the application for a RF patent for the invention “Test system for determining the titer of antibodies against the structural proteins of the foot-and-mouth disease virus strain “Asia-1 No. 2356/14/2018” using a liquid-phase blocking indirect “sandwich” "ELISA variant":
1. Poonsuk K, Giménez-Lirola L, Zimmerman JJ. A review of foot-and-mouth disease virus (FMDV) testing in livestock with an emphasis on the use of alternative diagnostic specimens. Anim Health Res Rev. 2018 Dec; 19(2): 100-112. doi: 10.1017/S1466252318000063. Epub 2018 Oct 22. PMID: 30345947.1. Poonsuk K, Giménez-Lirola L, Zimmerman JJ. A review of foot-and-mouth disease virus (FMDV) testing in livestock with an emphasis on the use of alternative diagnostic specimens. Anim Health Res Rev. 2018 Dec; 19(2): 100-112. doi: 10.1017/S1466252318000063. Epub 2018 Oct 22. PMID: 30345947.
2. Ijaz M, Ali MM, Awan F, Ishaq M, Ahmad A. FMD virus spillover from domestic livestock caused outbreak in captive wild ungulates: First report from Pakistan. Acta Trop. 2022 Jul; 231:106439. doi: 10.1016/j.actatropica.2022.106439. Epub 2022 Apr 1. PMID: 35378060.2. Ijaz M, Ali MM, Awan F, Ishaq M, Ahmad A. FMD virus spillover from domestic livestock caused outbreak in captive wild ungulates: First report from Pakistan. Acta Trop. 2022 Jul; 231:106439. doi: 10.1016/j.actatropica.2022.106439. Epub 2022 Apr 1. PMID: 35378060.
3. Zhang L, Zhang J, Chen HT, Zhou JH, Ma LN, Ding YZ, Liu YS. Research in advance for FMD novel vaccines. Virol J. 2011 Jun 3;8:268. doi: 10.1186/1743-422X-8-268. PMID: 21635788; PMCID: PMC3118361.3. Zhang L, Zhang J, Chen HT, Zhou JH, Ma LN, Ding YZ, Liu YS. Research in advance for FMD novel vaccines. Virol J 2011 Jun 3;8:268. doi:10.1186/1743-422X-8-268. PMID: 21635788; PMCID: PMC3118361.
4. Nguyen NH, Nguyen TQ, Lai DC, Nguyen Thi MD, Nguyen MN. Phylogenetic and genotypic characteristics of the foot-and-mouth disease virus from outbreaks in southern Vietnam, 2019. Virology. 2023 May; 582:43-47. doi: 10.1016/j.virol.2023.03.010. Epub 2023 Mar 23. PMID: 37004382.4. Nguyen NH, Nguyen TQ, Lai DC, Nguyen Thi MD, Nguyen MN. Phylogenetic and genotypic characteristics of the foot-and-mouth disease virus from outbreaks in southern Vietnam, 2019. Virology. May 2023; 582:43-47. doi: 10.1016/j.virol.2023.03.010. Epub 2023 Mar 23. PMID: 37004382.
5. Hassan AM, Zaher MR, Hassanien RT, Abd-E1-Moniem MI, Habashi AR, Ibraheem EM, Shahein MA, El Zowalaty ME, Hagag NM. Molecular detection, phylogenetic analysis and genetic diversity of recently isolated foot-and-mouth disease virus serotype A African topotype, Genotype IV. Virol J. 2022 Jan 3; 19(1): 1. doi: 10.1186/s12985-021-01693-y. PMID: 34980196; PMCID: PMC8722054.5. Hassan AM, Zaher MR, Hassanien RT, Abd-E1-Moniem MI, Habashi AR, Ibraheem EM, Shahein MA, El Zowalaty ME, Hagag NM. Molecular detection, phylogenetic analysis and genetic diversity of recently isolated foot-and-mouth disease virus serotype A African topotype, Genotype IV. Virol J. 2022 Jan 3; 19(1): 1. doi: 10.1186/s12985-021-01693-y. PMID: 34980196; PMCID: PMC8722054.
6. Reference Laboratory Reports. Quarterly Reports from the WRLFMD. URL: https://www.wrlfmd.org/ref-lab-reports. (Дата обращения: 05.04.2023).6. Reference Laboratory Reports. Quarterly Reports from the WRLFMD. URL: https://www.wrlfmd.org/ref-lab-reports. (Date of access: 04/05/2023).
7. Sirdar MM, Fosgate GT, Blignaut B, Mampane LR, Rikhotso OB, Du Plessis B, Gummow B. Spatial distribution of foot-and-mouth disease (FMD) outbreaks in South Africa (2005-2016). Trop Anim Health Prod. 2021 Jun 28; 53(3):376. doi: 10.1007/s 11250-021-02807-y. PMID: 34181093.7. Sirdar MM, Fosgate GT, Blignaut B, Mampane LR, Rikhotso OB, Du Plessis B, Gummow B. Spatial distribution of foot-and-mouth disease (FMD) outbreaks in South Africa (2005-2016). Trop Anim Health Prod. 2021 Jun 28; 53(3):376. doi: 10.1007/s 11250-021-02807-y. PMID: 34181093.
8. OIE. Manual of diagnostic tests and vaccines for terrestrial animals. - Paris, 2018. - Chapter 2.1.8.8. OIE. Manual of diagnostic tests and vaccines for terrestrial animals. - Paris, 2018. - Chapter 2.1.8.
9. Fana EM, Mpoloka SW, Leteane M, Seoke L, Masoba K, Mokopasetso M, Rapharing A, Kabelo T, Made P, Hyera J. A Five-Year Retrospective Study of Foot-and-Mouth Disease Outbreaks in Southern Africa, 2014 to. 2018. Vet Med Int. 2021 Dec 31;2021:7438809. doi: 10.1155/2021/7438809. PMID: 35003620; PMCID: PMC8741390.9. Fana EM, Mpoloka SW, Leteane M, Seoke L, Masoba K, Mokopasetso M, Rapharing A, Kabelo T, Made P, Hyera J. A Five-Year Retrospective Study of Foot-and-Mouth Disease Outbreaks in Southern Africa, 2014 to. 2018. Vet Med Int. 2021 Dec 31;2021:7438809. doi: 10.1155/2021/7438809. PMID: 35003620; PMCID: PMC8741390.
10. Kenney M, Waters RA, Rieder E, Pega J, Perez-Filguera M, Golde WT. Enhanced sensitivity in detection of antiviral antibody responses using biotinylation of foot-and-mouth disease virus (FMDV) capsids. J Immunol Methods. 2017 Nov; 450:1-9. doi: 10.1016/j.jim.2017.07.001. Epub 2017 Jul 6. PMID: 28689695.10. Kenney M, Waters RA, Rieder E, Pega J, Perez-Filguera M, Golde WT. Enhanced sensitivity in detection of antiviral antibody responses using biotinylation of foot-and-mouth disease virus (FMDV) capsids. J Immunol Methods. 2017 Nov; 450:1-9. doi: 10.1016/j.jim.2017.07.001. Epub 2017 Jul 6. PMID: 28689695.
11. Sørensen KJ, de Strieker K, Dyrting КС, Grazioli S, Haas B. Differentiation of foot-and-mouth disease virus infected animals from vaccinated animals using a blocking ELISA based on baculovirus expressed FMDV 3ABC antigen and a 3ABC monoclonal antibody. Arch Virol. 2005 Apr; 150(4):805-14. doi: 10.1007/s00705-004-0455-z. Epub 2005 Jan 13. PMID: 15645377.11. Sørensen KJ, de Strieker K, Dyrting KS, Grazioli S, Haas B. Differentiation of foot-and-mouth disease virus infected animals from vaccinated animals using a blocking ELISA based on baculovirus expressed FMDV 3ABC antigen and a 3ABC monoclonal antibody. Arch Virol. 2005 Apr; 150(4):805-14. doi: 10.1007/s00705-004-0455-z. Epub 2005 Jan 13. PMID: 15645377.
12. Oem J.K., Park J.H., Lee K.N., Kim Y.J., Kye S.J., Park J.Y., Song H.J. Characterization of recombinant foot-and-mouth disease virus pentamer-like structures expressed by baculovirus and their use as diagnostic antigens in a blocking ELISA // Vaccine. - 2007. - V. 25(20). - P. 4112-412.12. Oem J.K., Park J.H., Lee K.N., Kim Y.J., Kye S.J., Park J.Y., Song H.J. Characterization of recombinant foot-and-mouth disease virus pentamer-like structures expressed by baculovirus and their use as diagnostic antigens in a blocking ELISA // Vaccine. - 2007. - V. 25(20). - P. 4112-412.
13. Cao Y., Lu Z., Sun J., Bai X., Sun P., Bao H., Chen Y., Guo J., Li D., Liu X., Liu Z. Synthesis of empty capsid-like particles of Asia I foot-and-mouth disease virus in insect cells and their immunogenicity in guinea pigs // Vet. Microbiol. - 2009. - V. 137 (1-2). - P. 10-17.13. Cao Y., Lu Z., Sun J., Bai X., Sun P., Bao H., Chen Y., Guo J., Li D., Liu X., Liu Z. Synthesis of empty capsid- like particles of Asia I foot-and-mouth disease virus in insect cells and their immunogenicity in guinea pigs // Vet. Microbiol. - 2009. - V. 137 (1-2). - P. 10-17.
14. Hamblin C., Barnett I.T., Hedger R.S. A new enzyme-linked immunosorbent assay (ELISA) for the detection of antibodies against foot-and-mouth disease virus. I. Development and method of ELISA // J. Immunol. Methods. - 1986. - V. 93(1). - P. 115-121.14. Hamblin C., Barnett I.T., Hedger R.S. A new enzyme-linked immunosorbent assay (ELISA) for the detection of antibodies against foot-and-mouth disease virus. I. Development and method of ELISA // J. Immunol. Methods. - 1986. - V. 93(1). - P. 115-121.
15. Sharma GK, Mahajan S, Matura R, Subramaniam S, Mohapatra JK, Pattnaik B. Quantitative single dilution liquid phase blocking ELISA for sero-monitoring of foot-and-mouth disease in India. Biologicals. 2015 May; 43(3):158-164.15. Sharma GK, Mahajan S, Matura R, Subramaniam S, Mohapatra JK, Pattnaik B. Quantitative single dilution liquid phase blocking ELISA for sero-monitoring of foot-and-mouth disease in India. Biologicals. May 2015; 43(3):158-164.
16. IZSLER ELISA. URL: https://www.fao.org/fileadmin/user_upload/eufmd/docs/Open_Session2012/Appendices/75_New_Elisa_for_diagnosis_Brocchi_.pdf (Дата обращения: 18.04.2023).16. IZSLER ELISA. URL: https://www.fao.org/fileadmin/user_upload/eufmd/docs/Open_Session2012/Appendices/75_New_Elisa_for_diagnosis_Brocchi_.pdf (Date of access: 04/18/2023).
17. PrioCHECK ELISA. URL: http://vetprofilab.ru/f/priocheck_fmdv_antibody_elisa_kit_cut.pdf (Дата обращения: 20.03.2023).17. PrioCHECK ELISA. URL: http://vetprofilab.ru/f/priocheck_fmdv_antibody_elisa_kit_cut.pdf (Access date: 03/20/2023).
18. Патент РФ №2787714, 11.01.2023. Тест-система на основе жидкофазного блокирующего непрямого «сэндвич»-варианта ИФА для определения титра антител против вируса ящура штамма А №2269/ВНИИЗЖ/2015 генотипа A/ASIA/G-VII в сыворотках крови животных после иммунизации // Заявка №2022108324 / Луговская Н.Н., Доронин М.И., Михалишин Д.В., Гочмурадов Ы.М., Оковытая Т.В., Борисов А.В.18. RF Patent No. 2787714, 01/11/2023. Test system based on a liquid-phase blocking indirect “sandwich” version of ELISA for determining the antibody titer against foot-and-mouth disease virus strain A No. 2269/ARNIAH/2015 genotype A/ASIA/G-VII in animal blood sera after immunization // Application No. 2022108324 / Lugovskaya N.N., Doronin M.I., Mikhalishin D.V., Gochmuradov Y.M., Okovytaya T.V., Borisov A.V.
--->--->
<?xml version="1.0" encoding="UTF-8"?><?xml version="1.0" encoding="UTF-8"?>
<!DOCTYPE ST26SequenceListing PUBLIC "-//WIPO//DTD Sequence Listing <!DOCTYPE ST26SequenceListing PUBLIC "-//WIPO//DTD Sequence Listing
1.3//EN" "ST26SequenceListing_V1_3.dtd">1.3//EN" "ST26SequenceListing_V1_3.dtd">
<ST26SequenceListing dtdVersion="V1_3" fileName="ELISA FMDV SAT-2 <ST26SequenceListing dtdVersion="V1_3" fileName="ELISA FMDV SAT-2
VII.xml" softwareName="WIPO Sequence" softwareVersion="2.1.2" VII.xml" softwareName="WIPO Sequence" softwareVersion="2.1.2"
productionDate="2023-05-05">productionDate="2023-05-05">
<ApplicationIdentification> <ApplicationIdentification>
<IPOfficeCode>RU</IPOfficeCode> <IPOfficeCode>RU</IPOfficeCode>
<ApplicationNumberText>0</ApplicationNumberText> <ApplicationNumberText>0</ApplicationNumberText>
<FilingDate>2023-05-05</FilingDate> <FilingDate>2023-05-05</FilingDate>
</ApplicationIdentification> </ApplicationIdentification>
<ApplicantFileReference>505</ApplicantFileReference> <ApplicantFileReference>505</ApplicantFileReference>
<EarliestPriorityApplicationIdentification> <EarliestPriorityApplicationIdentification>
<IPOfficeCode>RU</IPOfficeCode> <IPOfficeCode>RU</IPOfficeCode>
<ApplicationNumberText>0</ApplicationNumberText> <ApplicationNumberText>0</ApplicationNumberText>
<FilingDate>2023-05-05</FilingDate> <FilingDate>2023-05-05</FilingDate>
</EarliestPriorityApplicationIdentification> </EarliestPriorityApplicationIdentification>
<ApplicantName languageCode="ru">ФГБУ "Федеральный центр охраны <ApplicantName languageCode="ru">FSBI "Federal Security Center"
здоровья животных" (ФГБУ "ВНИИЗЖ")</ApplicantName>animal health" (FSBI "ARRIAH")</ApplicantName>
<ApplicantNameLatin>FGBI "ARRIAH"</ApplicantNameLatin> <ApplicantNameLatin>FGBI "ARRIAH"</ApplicantNameLatin>
<InventorName languageCode="ru">Доронин Максим <InventorName languageCode="ru">Doronin Maxim
Игоревич</InventorName>Igorevich</InventorName>
<InventorNameLatin>Doronin Maksim Igorevich </InventorNameLatin> <InventorNameLatin>Doronin Maksim Igorevich </InventorNameLatin>
<InventionTitle languageCode="ru">Тест-система для определения титра <InventionTitle languageCode="en">Test system for titer determination
антител против структурных белков вируса ящура штамма «Азия-1 antibodies against structural proteins of foot and mouth disease virus strain "Asia-1"
№2356/14/2018» с помощью жидкофазного блокирующего непрямого No. 2356/14/2018" using liquid-phase blocking indirect
«сэндвич»-варианта ИФА</InventionTitle>“sandwich” version of ELISA</InventionTitle>
<SequenceTotalQuantity>2</SequenceTotalQuantity> <SequenceTotalQuantity>2</SequenceTotalQuantity>
<SequenceData sequenceIDNumber="1"> <SequenceData sequenceIDNumber="1">
<INSDSeq> <INSDSeq>
<INSDSeq_length>633</INSDSeq_length> <INSDSeq_length>633</INSDSeq_length>
<INSDSeq_moltype>DNA</INSDSeq_moltype> <INSDSeq_moltype>DNA</INSDSeq_moltype>
<INSDSeq_division>PAT</INSDSeq_division> <INSDSeq_division>PAT</INSDSeq_division>
<INSDSeq_feature-table> <INSDSeq_feature-table>
<INSDFeature> <INSDFeature>
<INSDFeature_key>source</INSDFeature_key> <INSDFeature_key>source</INSDFeature_key>
<INSDFeature_location>1..633</INSDFeature_location> <INSDFeature_location>1..633</INSDFeature_location>
<INSDFeature_quals> <INSDFeature_quals>
<INSDQualifier> <INSDQualifier>
<INSDQualifier_name>mol_type</INSDQualifier_name> <INSDQualifier_name>mol_type</INSDQualifier_name>
<INSDQualifier_value>genomic DNA</INSDQualifier_value> <INSDQualifier_value>genomic DNA</INSDQualifier_value>
</INSDQualifier> </INSDQualifier>
<INSDQualifier id="q1"> <INSDQualifier id="q1">
<INSDQualifier_name>organism</INSDQualifier_name> <INSDQualifier_name>organism</INSDQualifier_name>
<INSDQualifier_value>FMDV</INSDQualifier_value> <INSDQualifier_value>FMDV</INSDQualifier_value>
</INSDQualifier> </INSDQualifier>
</INSDFeature_quals> </INSDFeature_quals>
</INSDFeature> </INSDFeature>
</INSDSeq_feature-table> </INSDSeq_feature-table>
<INSDSeq_sequence>actaccaccactggcgagtcggcagacccagtcacaaccacggttgaga <INSDSeq_sequence>actaccaccactggcgagtcggcagacccagtcacaaccacggttgaga
actacggaggagagacccagacggctagacggctccacaccgacgtcggttttgttcttgacaggtttgtactacggagggagagacccagacggctagacggctccacaccgacgtcggttttgttcttgacaggtttgt
gagactcacgcaacctaaggccacccagactcttgacctcatgcagatccccccatacacgttggttggggagactcacgcaacctaaggccacccagactcttgacctcatgcagatccccccatacacgttggttggg
gcgttgcttcggtctgcgacgtactacttctcagacctggaggttgcgctcgtccacacaggcccggtcagcgttgcttcggtctgcgacgtactacttctcagacctggaggttgcgctcgtccacacaggcccggtca
cgtgggtgcccaacggcgcgcccaagaccgccttggactgccagaccaacccaactgcttaccagaagcacgtgggtgcccaacggcgcgcccaagaccgccttggactgccagaccaacccaactgcttaccagaagca
gcccatcacacgcctggccctcccttacaccgccccccaccgtgtgctggcgacagtgtacaacgggaaagcccatcacacgcctggccctcccttacaccgccccccaccgtgtgctggcgacagtgtacaacgggaaa
acagcctacggggcggaggccccaaggcgcggtgaccttgcagccattgcgcagagggtgagcgccagctacagcctacggggcggaggccccaaggcgcggtgaccttgcagccattgcgcagagggtgagcgccagct
tgcctacttccttcaactacggcgcagttaaggccgaaaacatcactgagctgttgatccgcatgaaacgtgcctacttccttcaactacggcgcagttaaggccgaaaacatcactgagctgttgatccgcatgaaacg
cgcggagacatactgccccaggcctttgctggctcttgacaccacccaagaccgccgcaagcaggagatccgcggagacatactgccccaggcctttgctggctcttgacaccacccaagaccgccgcaagcaggagatc
attgcacctgaaaagcaggtgtta</INSDSeq_sequence>attgcacctgaaaagcaggtgtta</INSDSeq_sequence>
</INSDSeq> </INSDSeq>
</SequenceData> </SequenceData>
<SequenceData sequenceIDNumber="2"> <SequenceData sequenceIDNumber="2">
<INSDSeq> <INSDSeq>
<INSDSeq_length>211</INSDSeq_length> <INSDSeq_length>211</INSDSeq_length>
<INSDSeq_moltype>AA</INSDSeq_moltype> <INSDSeq_moltype>AA</INSDSeq_moltype>
<INSDSeq_division>PAT</INSDSeq_division> <INSDSeq_division>PAT</INSDSeq_division>
<INSDSeq_feature-table> <INSDSeq_feature-table>
<INSDFeature> <INSDFeature>
<INSDFeature_key>source</INSDFeature_key> <INSDFeature_key>source</INSDFeature_key>
<INSDFeature_location>1..211</INSDFeature_location> <INSDFeature_location>1..211</INSDFeature_location>
<INSDFeature_quals> <INSDFeature_quals>
<INSDQualifier> <INSDQualifier>
<INSDQualifier_name>mol_type</INSDQualifier_name> <INSDQualifier_name>mol_type</INSDQualifier_name>
<INSDQualifier_value>protein</INSDQualifier_value> <INSDQualifier_value>protein</INSDQualifier_value>
</INSDQualifier> </INSDQualifier>
<INSDQualifier id="q2"> <INSDQualifier id="q2">
<INSDQualifier_name>organism</INSDQualifier_name> <INSDQualifier_name>organism</INSDQualifier_name>
<INSDQualifier_value>FMDV</INSDQualifier_value> <INSDQualifier_value>FMDV</INSDQualifier_value>
</INSDQualifier> </INSDQualifier>
</INSDFeature_quals> </INSDFeature_quals>
</INSDFeature> </INSDFeature>
</INSDSeq_feature-table> </INSDSeq_feature-table>
<INSDSeq_sequence>TTTTGESADPVTTTVENYGGETQTARRLHTDVGFVLDRFVRLTQPKATQ <INSDSeq_sequence>TTTTGESADPVTTTVENYGGETQTARRLHTDVGFVLDRFVRLTQPKATQ
TLDLMQIPPYTLVGALLRSATYYFSDLEVALVHTGPVTWVPNGAPKTALDCQTNPTAYQKQPITRLALPYTLDLMQIPPYTLVGALLRSATYYFSDLEVALVHTGPVTWVPNGAPKTALDCQTNPTAYQKQPITRLALPY
TAPHRVLATVYNGKTAYGAEAPRRGDLAAIAQRVSASLPTSFNYGAVKAENITELLIRMKRAETYCPRPLTAPHRVLATVYNGKTAYGAEAPRRGDLAAIAQRVSASLPTSFNYGAVKAENITELLIRMKRAETYCPRPL
LALDTTQDRRKQEIIAPEKQVL</INSDSeq_sequence>LALDTTQDRRKQEIIAPEKQVL</INSDSeq_sequence>
</INSDSeq> </INSDSeq>
</SequenceData> </SequenceData>
</ST26SequenceListing></ST26SequenceListing>
<---<---
Claims (5)
Publications (1)
| Publication Number | Publication Date |
|---|---|
| RU2812211C1 true RU2812211C1 (en) | 2024-01-25 |
Family
ID=
Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2011112945A2 (en) * | 2010-03-12 | 2011-09-15 | Merial Limited | Foot and mouth disease virus recombinant vaccines and uses thereof |
| RU2787714C1 (en) * | 2022-03-28 | 2023-01-11 | Федеральное государственное бюджетное учреждение "Федеральный центр охраны здоровья животных" (ФГБУ "ВНИИЗЖ") | Test system based on a liquid-phase blocking indirect sandwich-type variant of elisa for determining the titre of antibodies against the foot-and-mouth disease virus strain a n2269/arriah/2015, genotype a/asia/g-vii, in animal blood sera after immunisation |
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2011112945A2 (en) * | 2010-03-12 | 2011-09-15 | Merial Limited | Foot and mouth disease virus recombinant vaccines and uses thereof |
| RU2787714C1 (en) * | 2022-03-28 | 2023-01-11 | Федеральное государственное бюджетное учреждение "Федеральный центр охраны здоровья животных" (ФГБУ "ВНИИЗЖ") | Test system based on a liquid-phase blocking indirect sandwich-type variant of elisa for determining the titre of antibodies against the foot-and-mouth disease virus strain a n2269/arriah/2015, genotype a/asia/g-vii, in animal blood sera after immunisation |
| RU2798510C1 (en) * | 2022-08-22 | 2023-06-23 | Федеральное государственное бюджетное учреждение "Федеральный центр охраны здоровья животных" (ФГБУ "ВНИИЗЖ") | Test system for quantitative determination of the level of humoral immunity of animals against the antigen of foot-and-mouth disease virus an 2205/g-iv of a/africa/g-iv genotype using liquid-phase blocking indirect elisa "sandwich" |
Non-Patent Citations (1)
| Title |
|---|
| ДОРОНИН М. И и др., ОПРЕДЕЛЕНИЕ ТИТРА АНТИТЕЛ ПРОТИВ ВИРУСА ЯЩУРА ШТАММА А No2269/ВНИИЗЖ/2015 ГЕНОТИПА A/ASIA/G-VII С ПОМОЩЬЮ ЖИДКОФАЗНОГО БЛОКИРУЮЩЕГО НЕПРЯМОГО ВАРИАНТА ИФА, Актуальные вопросы ветеринарной биологии, 2022, n.3 (55), стр.75-83. * |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| Cubillos et al. | African swine fever virus serodiagnosis: a general review with a focus on the analyses of African serum samples | |
| CN103278627B (en) | A kind of multi-antigen ELISA kit detecting African swine fever virus antibody | |
| Bolwell et al. | Host cell selection of antigenic variants of foot-and-mouth disease virus | |
| CN105829892B (en) | The improved diagnostic test of CSFV antibody | |
| Dechamma et al. | Identification of T-helper and linear B epitope in the hypervariable region of nucleocapsid protein of PPRV and its use in the development of specific antibodies to detect viral antigen | |
| CN108473540B (en) | Mutant HEV polypeptides and their use for determining anti-HEV antibodies | |
| CN102731615A (en) | Detection reagent and detection method for PRRSV | |
| CN108918869B (en) | Application of fiber2 protein and recombinant protein thereof in detecting serum type 4 avian adenovirus antibody | |
| Zhang et al. | Development and evaluation of a VP3-ELISA for the detection of goose and Muscovy duck parvovirus antibodies | |
| CN104086657B (en) | Artificial antigen for joint-detection Epstein-Barr virus Rta protein antibodies and eb early antigen EA antibody and test kit | |
| Wang et al. | Development of an immunochromatographic strip for rapid detection of canine adenovirus | |
| Zhao et al. | Antigenic properties of avian hepatitis E virus capsid protein | |
| Hama et al. | An ancient coronavirus from individuals in France, circa 16th century | |
| Zhang et al. | Characterization of monoclonal antibodies against duck hepatitis type 1 virus VP1 protein | |
| RU2812211C1 (en) | Test system for determining titer of antibodies against structural proteins of asia-1 n 2356/14/2018 foot-and-mouth disease virus strain using liquid-phase blocking indirect "sandwich" version of elisa | |
| Liu et al. | Identification of three linear B cell epitopes using monoclonal antibodies against bovine enterovirus VP2 protein | |
| US20140024017A1 (en) | IDENTIFICATION OF A NOVEL HUMAN POLYOMAVIRUS (IPPyV) AND APPLICATIONS | |
| RU2804845C1 (en) | Test system for determining the level of antibodies against the antigen of foot-and-mouth disease virus genotype a/asia/sea-97 using a liquid-phase blocking indirect “sandwich” variant of elisa | |
| RU2818811C1 (en) | Test system for determining titre of antibodies against structural proteins of foot-and-mouth disease virus of "a/tanzania/2013" strain using liquid-phase enzyme immunoassay | |
| CN104710537A (en) | Coxsackie virus CA16 VP1 recombinant antigens, and monoclonal antibodies and application thereof | |
| RU2815531C1 (en) | Test system for assay of antibodies to structural proteins of foot-and-mouth disease virus genotype sat-2/vii using liquid-phase blocking indirect “sandwich” version of elisa | |
| RU2811996C1 (en) | Test system for determining titer of antibodies against 146s particles of foot-and-mouth disease virus genotype sat-2/iv using elisa liquid-phase | |
| RU2817382C1 (en) | Test system for quantitative detection of antibodies against 146s component of foot-and-mouth disease virus genotype o/ea-3 in animal blood serum based on liquid-phase enzyme immunoassay | |
| RU2798510C1 (en) | Test system for quantitative determination of the level of humoral immunity of animals against the antigen of foot-and-mouth disease virus an 2205/g-iv of a/africa/g-iv genotype using liquid-phase blocking indirect elisa "sandwich" | |
| RU2815540C1 (en) | Test system for determining titre of antibodies against structural proteins of foot and mouth disease virus of no. 2212/primorsky/2014 strain of o/sea/mya-98 genotype in animal blood sera based on liquid-phase blocking indirect “sandwich” version of elisa. |