RU2811996C1 - Test system for determining titer of antibodies against 146s particles of foot-and-mouth disease virus genotype sat-2/iv using elisa liquid-phase - Google Patents
Test system for determining titer of antibodies against 146s particles of foot-and-mouth disease virus genotype sat-2/iv using elisa liquid-phase Download PDFInfo
- Publication number
- RU2811996C1 RU2811996C1 RU2023120890A RU2023120890A RU2811996C1 RU 2811996 C1 RU2811996 C1 RU 2811996C1 RU 2023120890 A RU2023120890 A RU 2023120890A RU 2023120890 A RU2023120890 A RU 2023120890A RU 2811996 C1 RU2811996 C1 RU 2811996C1
- Authority
- RU
- Russia
- Prior art keywords
- sat
- foot
- mouth disease
- disease virus
- genotype
- Prior art date
Links
- 241000710198 Foot-and-mouth disease virus Species 0.000 title claims abstract description 154
- 239000002245 particle Substances 0.000 title claims abstract description 72
- 238000012360 testing method Methods 0.000 title claims abstract description 62
- 239000007791 liquid phase Substances 0.000 title claims abstract description 34
- 101100422538 Escherichia coli sat-2 gene Proteins 0.000 title description 3
- 101710173681 Sulfate adenylyltransferase subunit 2 2 Proteins 0.000 claims abstract description 194
- 238000002965 ELISA Methods 0.000 claims abstract description 54
- 239000000427 antigen Substances 0.000 claims abstract description 27
- 108091007433 antigens Proteins 0.000 claims abstract description 27
- 102000036639 antigens Human genes 0.000 claims abstract description 27
- 230000000694 effects Effects 0.000 claims abstract description 17
- 210000002966 serum Anatomy 0.000 claims description 42
- 238000010790 dilution Methods 0.000 claims description 26
- 239000012895 dilution Substances 0.000 claims description 26
- 239000000243 solution Substances 0.000 claims description 21
- 230000001235 sensitizing effect Effects 0.000 claims description 18
- 241000283973 Oryctolagus cuniculus Species 0.000 claims description 13
- 230000000903 blocking effect Effects 0.000 claims description 12
- 230000005764 inhibitory process Effects 0.000 claims description 11
- 108060003951 Immunoglobulin Proteins 0.000 claims description 10
- 239000007853 buffer solution Substances 0.000 claims description 10
- 102000018358 immunoglobulin Human genes 0.000 claims description 10
- 229940072221 immunoglobulins Drugs 0.000 claims description 10
- 241000283690 Bos taurus Species 0.000 claims description 9
- 241000700199 Cavia porcellus Species 0.000 claims description 9
- CDBYLPFSWZWCQE-UHFFFAOYSA-L Sodium Carbonate Chemical compound [Na+].[Na+].[O-]C([O-])=O CDBYLPFSWZWCQE-UHFFFAOYSA-L 0.000 claims description 8
- UIIMBOGNXHQVGW-UHFFFAOYSA-M Sodium bicarbonate Chemical compound [Na+].OC([O-])=O UIIMBOGNXHQVGW-UHFFFAOYSA-M 0.000 claims description 8
- 230000008033 biological extinction Effects 0.000 claims description 7
- 244000309466 calf Species 0.000 claims description 6
- 239000003593 chromogenic compound Substances 0.000 claims description 4
- 229910000030 sodium bicarbonate Inorganic materials 0.000 claims description 4
- 235000017557 sodium bicarbonate Nutrition 0.000 claims description 4
- 229910000029 sodium carbonate Inorganic materials 0.000 claims description 4
- 108010001336 Horseradish Peroxidase Proteins 0.000 claims description 3
- 239000012141 concentrate Substances 0.000 claims description 3
- ZTOJFFHGPLIVKC-UHFFFAOYSA-N 3-ethyl-2-[(3-ethyl-6-sulfo-1,3-benzothiazol-2-ylidene)hydrazinylidene]-1,3-benzothiazole-6-sulfonic acid Chemical compound S1C2=CC(S(O)(=O)=O)=CC=C2N(CC)C1=NN=C1SC2=CC(S(O)(=O)=O)=CC=C2N1CC ZTOJFFHGPLIVKC-UHFFFAOYSA-N 0.000 claims description 2
- 150000003839 salts Chemical class 0.000 claims description 2
- 238000011161 development Methods 0.000 abstract description 3
- 239000000126 substance Substances 0.000 abstract 1
- 241001465754 Metazoa Species 0.000 description 37
- 108090000623 proteins and genes Proteins 0.000 description 21
- 208000007212 Foot-and-Mouth Disease Diseases 0.000 description 20
- 210000004369 blood Anatomy 0.000 description 18
- 239000008280 blood Substances 0.000 description 18
- 239000000725 suspension Substances 0.000 description 18
- 238000006243 chemical reaction Methods 0.000 description 16
- 238000004458 analytical method Methods 0.000 description 15
- 235000018102 proteins Nutrition 0.000 description 15
- 102000004169 proteins and genes Human genes 0.000 description 15
- 241000700605 Viruses Species 0.000 description 14
- 230000000890 antigenic effect Effects 0.000 description 12
- 238000000034 method Methods 0.000 description 12
- 238000004519 manufacturing process Methods 0.000 description 11
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 10
- 210000004027 cell Anatomy 0.000 description 10
- 230000003053 immunization Effects 0.000 description 10
- 229960005486 vaccine Drugs 0.000 description 10
- 230000004727 humoral immunity Effects 0.000 description 8
- 238000002649 immunization Methods 0.000 description 8
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 7
- 230000002068 genetic effect Effects 0.000 description 7
- 230000035945 sensitivity Effects 0.000 description 7
- 210000002845 virion Anatomy 0.000 description 7
- 244000309730 Foot-and-mouth disease virus serotype SAT2 Species 0.000 description 6
- 230000015572 biosynthetic process Effects 0.000 description 6
- 239000011780 sodium chloride Substances 0.000 description 6
- 239000007788 liquid Substances 0.000 description 5
- 239000002773 nucleotide Substances 0.000 description 5
- 125000003729 nucleotide group Chemical group 0.000 description 5
- 238000002360 preparation method Methods 0.000 description 5
- 239000002356 single layer Substances 0.000 description 5
- 230000003612 virological effect Effects 0.000 description 5
- 241000700198 Cavia Species 0.000 description 4
- HEDRZPFGACZZDS-UHFFFAOYSA-N Chloroform Chemical compound ClC(Cl)Cl HEDRZPFGACZZDS-UHFFFAOYSA-N 0.000 description 4
- 241001492218 Foot-and-mouth disease virus - type SAT 2 Species 0.000 description 4
- 230000008901 benefit Effects 0.000 description 4
- 239000000203 mixture Substances 0.000 description 4
- 239000013641 positive control Substances 0.000 description 4
- 238000002255 vaccination Methods 0.000 description 4
- 108091028043 Nucleic acid sequence Proteins 0.000 description 3
- 241000709664 Picornaviridae Species 0.000 description 3
- 238000004113 cell culture Methods 0.000 description 3
- 238000010835 comparative analysis Methods 0.000 description 3
- 238000002405 diagnostic procedure Methods 0.000 description 3
- 238000001962 electrophoresis Methods 0.000 description 3
- 230000036541 health Effects 0.000 description 3
- 230000001900 immune effect Effects 0.000 description 3
- 230000002163 immunogen Effects 0.000 description 3
- 210000003292 kidney cell Anatomy 0.000 description 3
- 239000013642 negative control Substances 0.000 description 3
- 229920002401 polyacrylamide Polymers 0.000 description 3
- 229920001184 polypeptide Polymers 0.000 description 3
- 102000004196 processed proteins & peptides Human genes 0.000 description 3
- 108090000765 processed proteins & peptides Proteins 0.000 description 3
- 230000001012 protector Effects 0.000 description 3
- 238000011160 research Methods 0.000 description 3
- 238000004062 sedimentation Methods 0.000 description 3
- 239000007790 solid phase Substances 0.000 description 3
- 238000005406 washing Methods 0.000 description 3
- CSCPPACGZOOCGX-UHFFFAOYSA-N Acetone Chemical compound CC(C)=O CSCPPACGZOOCGX-UHFFFAOYSA-N 0.000 description 2
- 101710145634 Antigen 1 Proteins 0.000 description 2
- 241000710189 Aphthovirus Species 0.000 description 2
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 2
- 108010078903 CMP-N-acetylneuraminic acid-monosialoganglioside sialyltransferase Proteins 0.000 description 2
- CURLTUGMZLYLDI-UHFFFAOYSA-N Carbon dioxide Chemical compound O=C=O CURLTUGMZLYLDI-UHFFFAOYSA-N 0.000 description 2
- 108020004414 DNA Proteins 0.000 description 2
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 2
- 102100023920 Histone H1t Human genes 0.000 description 2
- 101000905044 Homo sapiens Histone H1t Proteins 0.000 description 2
- 108010052285 Membrane Proteins Proteins 0.000 description 2
- 229930006000 Sucrose Natural products 0.000 description 2
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 2
- 241000282887 Suidae Species 0.000 description 2
- 101710140501 Sulfate adenylyltransferase subunit 2 1 Proteins 0.000 description 2
- 102100030100 Sulfate anion transporter 1 Human genes 0.000 description 2
- 101710144481 Sulfate anion transporter 1 Proteins 0.000 description 2
- QAOWNCQODCNURD-UHFFFAOYSA-N Sulfuric acid Chemical compound OS(O)(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-N 0.000 description 2
- 102400000368 Surface protein Human genes 0.000 description 2
- 108020000999 Viral RNA Proteins 0.000 description 2
- 239000002671 adjuvant Substances 0.000 description 2
- 125000003275 alpha amino acid group Chemical group 0.000 description 2
- 238000003745 diagnosis Methods 0.000 description 2
- 238000007865 diluting Methods 0.000 description 2
- 231100000676 disease causative agent Toxicity 0.000 description 2
- 239000000839 emulsion Substances 0.000 description 2
- 239000012894 fetal calf serum Substances 0.000 description 2
- -1 freon Chemical compound 0.000 description 2
- 230000000521 hyperimmunizing effect Effects 0.000 description 2
- 229940027941 immunoglobulin g Drugs 0.000 description 2
- 208000015181 infectious disease Diseases 0.000 description 2
- 230000002458 infectious effect Effects 0.000 description 2
- 239000010410 layer Substances 0.000 description 2
- 238000012544 monitoring process Methods 0.000 description 2
- 230000035772 mutation Effects 0.000 description 2
- 108020004707 nucleic acids Proteins 0.000 description 2
- 102000039446 nucleic acids Human genes 0.000 description 2
- 150000007523 nucleic acids Chemical class 0.000 description 2
- 239000002243 precursor Substances 0.000 description 2
- 230000002265 prevention Effects 0.000 description 2
- 230000008569 process Effects 0.000 description 2
- 230000010076 replication Effects 0.000 description 2
- 239000013049 sediment Substances 0.000 description 2
- 238000012163 sequencing technique Methods 0.000 description 2
- 238000010186 staining Methods 0.000 description 2
- 239000005720 sucrose Substances 0.000 description 2
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 2
- 102000040650 (ribonucleotides)n+m Human genes 0.000 description 1
- LSDGFGPIFBOTJI-UHFFFAOYSA-N 2-(aziridin-1-yl)ethanamine Chemical compound NCCN1CC1 LSDGFGPIFBOTJI-UHFFFAOYSA-N 0.000 description 1
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 1
- 102100031974 CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 101000703754 Homo sapiens CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 Proteins 0.000 description 1
- 108090001030 Lipoproteins Proteins 0.000 description 1
- 102000004895 Lipoproteins Human genes 0.000 description 1
- 241000699673 Mesocricetus auratus Species 0.000 description 1
- 108060004795 Methyltransferase Proteins 0.000 description 1
- 241000699670 Mus sp. Species 0.000 description 1
- 239000008118 PEG 6000 Substances 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 241001144416 Picornavirales Species 0.000 description 1
- 229920002584 Polyethylene Glycol 6000 Polymers 0.000 description 1
- 229920001213 Polysorbate 20 Polymers 0.000 description 1
- 241001493546 Suina Species 0.000 description 1
- 108010067390 Viral Proteins Proteins 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 239000000443 aerosol Substances 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 244000037640 animal pathogen Species 0.000 description 1
- 239000012223 aqueous fraction Substances 0.000 description 1
- 238000003556 assay Methods 0.000 description 1
- 230000037429 base substitution Effects 0.000 description 1
- 239000003124 biologic agent Substances 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 239000000872 buffer Substances 0.000 description 1
- 238000004364 calculation method Methods 0.000 description 1
- 239000001569 carbon dioxide Substances 0.000 description 1
- 229910002092 carbon dioxide Inorganic materials 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 239000007795 chemical reaction product Substances 0.000 description 1
- 208000030499 combat disease Diseases 0.000 description 1
- 230000002860 competitive effect Effects 0.000 description 1
- 230000000295 complement effect Effects 0.000 description 1
- 239000002131 composite material Substances 0.000 description 1
- 239000000562 conjugate Substances 0.000 description 1
- 239000008367 deionised water Substances 0.000 description 1
- 229910021641 deionized water Inorganic materials 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 239000003599 detergent Substances 0.000 description 1
- 230000004069 differentiation Effects 0.000 description 1
- 239000013024 dilution buffer Substances 0.000 description 1
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 1
- 201000010099 disease Diseases 0.000 description 1
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 1
- BTWUORFYKAZQHW-UHFFFAOYSA-L disodium;2-hydroxy-3-[4-[4-[(2-hydroxy-3-sulfonatopropyl)amino]-3-methylphenyl]-2-methylanilino]propane-1-sulfonate Chemical compound [Na+].[Na+].C1=C(NCC(O)CS([O-])(=O)=O)C(C)=CC(C=2C=C(C)C(NCC(O)CS([O-])(=O)=O)=CC=2)=C1 BTWUORFYKAZQHW-UHFFFAOYSA-L 0.000 description 1
- 230000003067 hemagglutinative effect Effects 0.000 description 1
- 229940031551 inactivated vaccine Drugs 0.000 description 1
- 230000002779 inactivation Effects 0.000 description 1
- 230000003993 interaction Effects 0.000 description 1
- 238000005304 joining Methods 0.000 description 1
- 210000003734 kidney Anatomy 0.000 description 1
- 238000009533 lab test Methods 0.000 description 1
- 238000012417 linear regression Methods 0.000 description 1
- 244000144972 livestock Species 0.000 description 1
- 210000003141 lower extremity Anatomy 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- WSFSSNUMVMOOMR-NJFSPNSNSA-N methanone Chemical compound O=[14CH2] WSFSSNUMVMOOMR-NJFSPNSNSA-N 0.000 description 1
- 244000005700 microbiome Species 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 230000000877 morphologic effect Effects 0.000 description 1
- 210000003205 muscle Anatomy 0.000 description 1
- 230000003287 optical effect Effects 0.000 description 1
- 239000003960 organic solvent Substances 0.000 description 1
- 230000001717 pathogenic effect Effects 0.000 description 1
- 230000007918 pathogenicity Effects 0.000 description 1
- 239000012071 phase Substances 0.000 description 1
- 239000008055 phosphate buffer solution Substances 0.000 description 1
- 239000002953 phosphate buffered saline Substances 0.000 description 1
- 230000000704 physical effect Effects 0.000 description 1
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 1
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 1
- 239000002244 precipitate Substances 0.000 description 1
- 230000003449 preventive effect Effects 0.000 description 1
- 235000004252 protein component Nutrition 0.000 description 1
- 239000012474 protein marker Substances 0.000 description 1
- 230000035484 reaction time Effects 0.000 description 1
- 230000000601 reactogenic effect Effects 0.000 description 1
- 238000005215 recombination Methods 0.000 description 1
- 230000006798 recombination Effects 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 238000004370 retrospective diagnosis Methods 0.000 description 1
- 238000003757 reverse transcription PCR Methods 0.000 description 1
- 238000012216 screening Methods 0.000 description 1
- 241000894007 species Species 0.000 description 1
- 230000007480 spreading Effects 0.000 description 1
- 238000003892 spreading Methods 0.000 description 1
- 238000010561 standard procedure Methods 0.000 description 1
- 239000012089 stop solution Substances 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- 239000006228 supernatant Substances 0.000 description 1
- 230000009897 systematic effect Effects 0.000 description 1
- 238000004448 titration Methods 0.000 description 1
- 230000007704 transition Effects 0.000 description 1
- 238000005199 ultracentrifugation Methods 0.000 description 1
- 238000009281 ultraviolet germicidal irradiation Methods 0.000 description 1
- 230000001018 virulence Effects 0.000 description 1
- 239000011534 wash buffer Substances 0.000 description 1
- 238000005303 weighing Methods 0.000 description 1
- 239000012224 working solution Substances 0.000 description 1
Abstract
Description
Изобретение относится к области ветеринарной вирусологии и биотехнологии, в частности, созданию тест-системы для определения титра антител против 146S частиц вируса ящура генотипа SAT-2/IV с помощью жидкофазного ИФА.The invention relates to the field of veterinary virology and biotechnology, in particular, to the creation of a test system for determining the titer of antibodies against 146S particles of foot-and-mouth disease virus genotype SAT-2/IV using liquid-phase ELISA.
По-прежнему ящур распространен в мире и причиняет значительный экономический ущерб. Возбудителем данного заболевания является РНК(+)-содержащий вирус порядка Picornavirales семейства Picornaviridae рода Aphthovirus с длиной нуклеиновой кислоты около 8500 н.о. [1, 2]. При репродукции вируса ящура в биологических системах формируются 146S компонент (полные частицы, основной иммуногенный компонент), состоящий из одной молекулы вирусной РНК и 60 копий полипептида, каждая из которых представлена комплексом белков VP1-VP2-VP3-VP4 [1].Foot and mouth disease is still widespread throughout the world and causes significant economic damage. The causative agent of this disease is an RNA(+)-containing virus of the order Picornavirales of the family Picornaviridae of the genus Aphthovirus with a nucleic acid length of about 8500 nt. [12]. During the reproduction of foot-and-mouth disease virus in biological systems, a 146S component (complete particles, the main immunogenic component) is formed, consisting of one molecule of viral RNA and 60 copies of a polypeptide, each of which is represented by a protein complex VP 1 -VP 2 -VP 3 -VP 4 [1] .
Существует 7 серотипов ящура: О, А, С, Азия-1, SAT-1, SAT-2 и SAT-3. Каждый серотип генетически разделен на различные топотипы, генетические линии и сублинии. Различия между ними определяют при анализе нуклеотидной последовательности 1D-гена (белок VP1), который характеризуется высокой геномной и антигенной вариабельностью [2]. В пределах семи серотипов были описаны более 60 генетических линий и сублиний. Антитела против одного серотипа не обеспечивают иммунную защиту против другого серотипа и даже многих других генетических линий [3, 4].There are 7 serotypes of foot and mouth disease: O, A, C, Asia-1, SAT-1, SAT-2 and SAT-3. Each serotype is genetically divided into different topotypes, genetic lineages and sublineages. The differences between them are determined by analyzing the nucleotide sequence of the 1D gene (VP 1 protein), which is characterized by high genomic and antigenic variability [2]. Within seven serotypes, more than 60 genetic lineages and sublineages have been described. Antibodies against one serotype do not provide immune protection against another serotype or even many other genetic lineages [3, 4].
В геноме вируса ящура в процессе репродукции и смены хозяина возникают мутации, что приводит к появлению новых генотипов [5, 6]. Одна или несколько аминокислотных замен на поверхности вирусных частиц могут привести к изменению распознавания и использования рецепторов. В результате один и тот же вирус будет приобретать способность проникать в клетки с использованием альтернативных рецепторов [7].Mutations occur in the foot-and-mouth disease virus genome during the process of reproduction and change of host, which leads to the emergence of new genotypes [5, 6]. One or more amino acid substitutions on the surface of viral particles can lead to changes in receptor recognition and use. As a result, the same virus will acquire the ability to penetrate cells using alternative receptors [7].
Наиболее вариабельным считается поверхностный протеин VP1 вируса ящура. Его самыми вариабельными областями являются участки 40-60, 130-160 и 190-213 а.о. Участок поверхностного белка VP1 в регионе 130-160 а.о. отличается высокой вариабельностью, поскольку участвует в процессе связывания с рецепторами клетки-хозяина [5, 7]. Изменчивость данного региона дает возможность вирусу ящура взаимодействовать с рецепторами клеток разных типов и облегчает переход от одного вида хозяина к другому [8, 9, 10].The surface protein VP 1 of the foot and mouth disease virus is considered the most variable. Its most variable regions are regions 40-60, 130-160 and 190-213 aa. Section of the surface protein VP 1 in the region 130-160 a.a. is highly variable because it is involved in the process of binding to host cell receptors [5, 7]. The variability of this region allows the foot-and-mouth disease virus to interact with receptors of different types of cells and facilitates the transition from one host species to another [8, 9, 10].
Для вируса ящура серотипа SAT-2 характерна генетическая изменчивость, а именно он включает в себя следующие 14 топотипов (I-XIV), внутри которых нет разделения на генетические группы. Такое высокое генетическое и антигенное разнообразие приводит к проблемам в специфической профилактике ящура при применении культуральных инактивированных противоящурных вакцин, а также затрудняет штаммоспецифическую диагностику выделенных изолятов вируса ящура и проведение ретроспективного анализа. В результате возникает необходимость создания новых средств диагностики в отношении вируса ящура серотипа SAT-2.The foot-and-mouth disease virus serotype SAT-2 is characterized by genetic variability, namely, it includes the following 14 topotypes (I-XIV), within which there is no division into genetic groups. Such high genetic and antigenic diversity leads to problems in the specific prevention of foot-and-mouth disease when using culture-inactivated foot-and-mouth disease vaccines, and also complicates the strain-specific diagnosis of isolated foot-and-mouth disease virus isolates and retrospective analysis. As a result, there is a need to create new diagnostic tools for foot-and-mouth disease virus serotype SAT-2.
Вспышки ящура серотипа SAT-2 регистрируются на территории Африканского континента. Преимущественно эпизоотическая ситуация связана с генотипами SAT-2/IV/Alx-12 и SAT-2/IV/Lib-12, которые распространены в странах Северной Африки, в частности, в Египте, где вспышки отмечали в период с 2012 по 2022 гг.и Либии (2012 г.). На территории Западной Африки, в частности в Камеруне (2014 г. ), Нигерии (2019-2021 гг.), также преимущественно распространены изоляты вируса ящура генотипов SAT-2/IV/Alx-12 и SAT-2/IV/Lib-12. Соответственно, в указанных странах проводились мероприятия по ликвидации и борьбе с ящуром указанных генотипов.Outbreaks of foot-and-mouth disease serotype SAT-2 are recorded on the African continent. The predominantly epizootic situation is associated with the SAT-2/IV/Alx-12 and SAT-2/IV/Lib-12 genotypes, which are common in North African countries, in particular in Egypt, where outbreaks were noted between 2012 and 2022. and Libya (2012). In West Africa, in particular in Cameroon (2014), Nigeria (2019-2021), foot-and-mouth disease virus isolates of genotypes SAT-2/IV/Alx-12 and SAT-2/IV/Lib-12 are also predominantly distributed . Accordingly, in these countries, measures were taken to eliminate and control foot-and-mouth disease of the indicated genotypes.
При этом постепенно с 2012 г. в странах Африканского континента и преимущественно на Востоке материка (Бурунди, Кения, Танзания и другие страны) стали появляться изоляты вируса ящура нового топотипа IV. Так, в Кении уже в 2012 и 2013 гг. выделили представителей генотипа SAT-2/IV, далее в Танзании в 2013 г. была сильная вспышка, вызванная вирусом данного варианта. В 2017 г. сложная эпизоотическая ситуация по ящуру генотипа SAT-2/IV отмечали в Кении, в 2020 г. - в Уганде, в 2022 г. - в Бурунди. Прогнозы экспертов неутешительны в отношении распространения данного варианта вируса ящура. Следует отметить, что имеются риски заноса изолятов данного серотипа на территорию Российской Федерации и других стран.At the same time, gradually since 2012, isolates of the foot-and-mouth disease virus of a new topotype IV began to appear in the countries of the African continent and mainly in the East of the continent (Burundi, Kenya, Tanzania and other countries). Thus, in Kenya already in 2012 and 2013. representatives of the SAT-2/IV genotype were isolated, then in Tanzania in 2013 there was a strong outbreak caused by a virus of this variant. In 2017, a difficult epizootic situation with foot and mouth disease of the SAT-2/IV genotype was noted in Kenya, in 2020 - in Uganda, in 2022 - in Burundi. Experts' forecasts are disappointing regarding the spread of this variant of the foot-and-mouth disease virus. It should be noted that there are risks of introducing isolates of this serotype into the territory of the Russian Federation and other countries.
Степень изменчивости внутри одного топотипа IV высокая, поэтому возникает острая необходимость в изучении свойств появляющихся штаммов вируса ящура и изготовления на его основе вакцинных препаратов и диагностических тест-систем [11, 12, 13].The degree of variability within one topotype IV is high, so there is an urgent need to study the properties of emerging strains of foot-and-mouth disease virus and to manufacture vaccine preparations and diagnostic test systems based on it [11, 12, 13].
В настоящее время известны производственные штаммы вируса ящура типа SAT-2, которые используются при производстве средств специфической профилактики ящура и при ретроспективной диагностике:Currently, production strains of foot-and-mouth disease virus type SAT-2 are known, which are used in the production of means for the specific prevention of foot-and-mouth disease and in retrospective diagnosis:
- штамм («SAT-2/ZIM/14/2002») (генотип SAT-2/I),- strain (“SAT-2/ZIM/14/2002”) (genotype SAT-2/I),
- штамм («SAT-2/ZIM/5/81») (генотип SAT-2/II),- strain (“SAT-2/ZIM/5/81”) (genotype SAT-2/II),
- штамм («SAT-2/BOT/P3/98») (генотип SAT-2/III),- strain (“SAT-2/BOT/P3/98”) (genotype SAT-2/III),
- штамм («SAT-2/ETH/1/90») (генотип SAT-2/IV),- strain (“SAT-2/ETH/1/90”) (genotype SAT-2/IV),
- штамм («SAT-2/GHA/2/90») (генотип SAT-2/V),- strain (“SAT-2/GHA/2/90”) (genotype SAT-2/V),
- штамм («SAT-2/GAM/8/79») (генотип SAT-2/VI),- strain (“SAT-2/GAM/8/79”) (genotype SAT-2/VI),
- штамм («SAT-2/SAU/6/2000») (генотип SAT-2/VII),- strain (“SAT-2/SAU/6/2000”) (genotype SAT-2/VII),
- штамм («SAT-2/RWO/1/00») (генотип SAT-2/VIII),- strain (“SAT-2/RWO/1/00”) (genotype SAT-2/VIII),
- штамм («SAT-2/KEN/2/84») (генотип SAT-2/IX),- strain (“SAT-2/KEN/2/84”) (genotype SAT-2/IX),
- штамм («SAT-2/UGA/19/98») (генотип SAT-2/X),- strain (“SAT-2/UGA/19/98”) (genotype SAT-2/X),
- штамм («SAT-2/ANG/4/74») (генотип SAT-2/XI),- strain (“SAT-2/ANG/4/74”) (genotype SAT-2/XI),
- штамм («SAT-2/UGA/51/75») (генотип SAT-2/XII),- strain (“SAT-2/UGA/51/75”) (genotype SAT-2/XII),
- штамм («SAT-2/ETH/2/2007») (генотип SAT-2/XIII),- strain (“SAT-2/ETH/2/2007”) (genotype SAT-2/XIII),
- штамм («SAT-2/ETH/2/9») (генотип SAT-2/XIV).- strain (“SAT-2/ETH/2/9”) (genotype SAT-2/XIV).
Изолят «SAT-2/KEN/19/2017» вируса ящура был выделен от крупного рогатого скота на территории населенного пункта Rongai в регионе Nakuru Республики Кения в 2017 г. и поступил в ФГБУ «ВНИИЗЖ» для проведения научных исследований в 2022 г.Isolate “SAT-2/KEN/19/2017” of foot-and-mouth disease virus was isolated from cattle in the village of Rongai in the Nakuru region of the Republic of Kenya in 2017 and entered the Federal State Budgetary Institution “ARRIAH” for scientific research in 2022.
По результатам сравнительного анализа нуклеотидных последовательностей выделенный изолят принадлежит к топотипу IV серотипа SAT-2 вируса ящура, который значительно отличается от производственных штаммов вируса ящура типа SAT-2, в том числе штамма «SAT-2/ETH/l/90» (генотип SAT-2/IV).According to the results of a comparative analysis of nucleotide sequences, the isolated isolate belongs to topotype IV of serotype SAT-2 foot-and-mouth disease virus, which differs significantly from the production strains of foot-and-mouth disease virus type SAT-2, including the strain “SAT-2/ETH/l/90” (genotype SAT -2/IV).
В ФГБУ «ВНИИЗЖ» данный изолят был адаптирован к различным чувствительным клеточным линиям, в том числе, к монослойной и суспензионной перевиваемой клеточной линии почки новорожденного сирийского хомячка BHK-21/SUSP/ARRIAH и получен штамм «SAT-2/Кения/19/2017» (генотип SAT-2/IV). Данный штамм был депонирован Всероссийской государственной коллекции экзотических типов вирусов ящура и других патогенов животных (ГКШМ) ФГБУ «ВНИИЗЖ» под регистрационным номером: №452 - деп / 23-2 - ГКШМ ФГБУ «ВНИИЗЖ». Филогенетическая принадлежность штамма «SAT-2/Кения/19/2017» вируса ящура представлена на фиг. 3.At the Federal State Budgetary Institution "ARRIAH" this isolate was adapted to various sensitive cell lines, including the monolayer and suspension continuous cell line of the newborn Syrian hamster kidney BHK-21/SUSP/ARRIAH and the strain "SAT-2/Kenya/19/2017" was obtained "(genotype SAT-2/IV). This strain was deposited with the All-Russian State Collection of Exotic Types of Foot and Mouth Disease Viruses and other Animal Pathogens (FMD) of the FGBU "ARRIAH" under registration number: No. 452 - dep / 23-2 - GKSHM FGBU "ARRIAH". The phylogenetic affiliation of the foot and mouth disease virus strain “SAT-2/Kenya/19/2017” is presented in Fig. 3.
Филогенетическое дерево выведено с использованием программы MEGA и алгоритма Neighbor-Joining. Процент повторяющихся ветвей, в которых связанные таксоны сгруппированы вместе в тесте начальной загрузки (1000 повторов), показан рядом с ветвями. Эволюционные расстояния были рассчитаны с использованием метода Maximum Composite Likelihood и выражены в единицах количества замен оснований на сайт. Этот анализ включал 16 нуклеотидных последовательностей. Все позиции, содержащие пробелы и отсутствующие данные, были удалены (вариант полного удаления). В окончательном наборе данных было всего 642 позиции. Эволюционный анализ проводился в MEGA 7.The phylogenetic tree was inferred using the MEGA program and the Neighbor-Joining algorithm. The percentage of replicate branches in which related taxa cluster together in the bootstrap test (1000 replicates) is shown next to the branches. Evolutionary distances were calculated using the Maximum Composite Likelihood method and expressed in units of the number of base substitutions per site. This analysis included 16 nucleotide sequences. All items containing spaces and missing data were removed (complete deletion option). There were a total of 642 items in the final data set. Evolutionary analysis was carried out in MEGA 7.
Учитывая интенсивные торговые связи между Российской Федерацией и странами Африки и Ближнего Востока, вероятность риска заноса ящура на территорию нашей страны является очень высокой. Иммунизация является эффективным инструментом борьбы с болезнью. В связи с распространения в мире генотипа SAT-2/IV вируса ящура и необходимостью защиты животных от него в ФГБУ «ВНИИЗЖ» разработали вакцину, в состав которой входит антиген вируса ящура данного генотипа. В результате возникла необходимость создания диагностической тест-системы для определения титра антител против 146S частиц вируса ящура генотипа SAT-2/IV с помощью жидкофазного ИФА.Considering the intensive trade relations between the Russian Federation and the countries of Africa and the Middle East, the likelihood of the risk of introducing foot-and-mouth disease into the territory of our country is very high. Immunization is an effective tool to combat disease. In connection with the spread of the SAT-2/IV genotype of the foot-and-mouth disease virus in the world and the need to protect animals from it, the Federal State Budgetary Institution "ARRIAH" has developed a vaccine that includes the antigen of the foot-and-mouth disease virus of this genotype. As a result, the need arose to create a diagnostic test system for determining the titer of antibodies against 146S particles of foot-and-mouth disease virus genotype SAT-2/IV using liquid-phase ELISA.
Защита от ящура после вакцинации определяется уровнем специфических антител в сыворотке крови животных [14-19]. Уровень гуморального иммунитета вакцинированного поголовья определяется путем выявления антител, специфичных к 146S частицам вируса ящура. В соответствии с рекомендациями МЭБ (OIE) [2], для определения иммунного статуса животных применяют реакцию микронейтрализации (РМН) и иммуноферментный анализ (ИФА). РМН считается чувствительной и специфичной, однако проведение анализа имеет ряд следующих ограничений: 1) большая продолжительность времени постановки реакции (не менее 72 часов), 2) высокая себестоимость процедуры, связанная с применением чувствительной клеточной линии, СО2-инкубатора, 3) использование неинактивированного вируса ящура, который является биологическим агентом II группы опасности и предполагает проведение работ только в лабораториях уровня BSL-3.Protection against foot and mouth disease after vaccination is determined by the level of specific antibodies in the blood serum of animals [14-19]. The level of humoral immunity of vaccinated livestock is determined by detecting antibodies specific to 146S particles of the foot and mouth disease virus. In accordance with the recommendations of the OIE (OIE) [2], the microneutralization reaction (MN) and enzyme-linked immunosorbent assay (ELISA) are used to determine the immune status of animals. RMN is considered sensitive and specific, however, the analysis has a number of the following limitations: 1) the long duration of reaction time (at least 72 hours), 2) the high cost of the procedure associated with the use of a sensitive cell line, CO 2 incubator, 3) the use of non-inactivated foot and mouth disease virus, which is a biological agent of hazard group II and requires work to be carried out only in BSL-3 level laboratories.
В свою очередь, ИФА обладает многими преимуществами, включая экспрессность, высокую специфичность и чувствительность, пригодность для крупномасштабного скрининга полевых образцов и отсутствие требований к специальным лабораторным условиям, например, культуре клеток или среде углекислого газа, а также не предполагает проведение работ с микроорганизмами повышенного уровня опасности [20]. Исходя из этого, ИФА целесообразно применять для исследования уровня гуморального иммунитета у вакцинированных животных.In turn, ELISA has many advantages, including rapidity, high specificity and sensitivity, suitability for large-scale screening of field samples and no requirement for special laboratory conditions, for example, cell culture or carbon dioxide environment, and does not involve working with high-level microorganisms dangers [20]. Based on this, it is advisable to use ELISA to study the level of humoral immunity in vaccinated animals.
В зависимости от фазы, в которой находятся иммунные комплексы различают твердофазный и жидкофазные варианты ИФА. Особое внимание уделяют жидкофазному блокирующему непрямому «сэндвич»-варианту ИФА, который характеризуется рядом преимуществ: 1) данный анализ максимально приближен к классической РМН, поскольку формирование иммунного комплекса происходит в жидкой фазе как в наиболее естественных условиях; 2) эпитопы на поверхности вириона наиболее доступны в пространстве для специфичных антител, что позволяет повысить чувствительность и специфичность реакции.Depending on the phase in which the immune complexes are located, solid-phase and liquid-phase ELISA variants are distinguished. Particular attention is paid to the liquid-phase blocking indirect “sandwich” version of ELISA, which is characterized by a number of advantages: 1) this analysis is as close as possible to the classical RMN, since the formation of the immune complex occurs in the liquid phase as in the most natural conditions; 2) epitopes on the surface of the virion are most accessible in space for specific antibodies, which allows increasing the sensitivity and specificity of the reaction.
На мировом рынке в настоящее время имеются европейские наборы для детекции антител против вируса ящура типа SAT-2 - IZSLER (Италия) и PrioCHECK (Нидерланды).Currently on the world market there are European kits for detecting antibodies against foot-and-mouth disease virus type SAT-2 - IZSLER (Italy) and PrioCHECK (Netherlands).
Тест-система в наборе IZSLER предназначена для детекции противоящурных антител с помощью твердофазного прямого «сэндвич»-варианта ИФА [21]. Достоинством данного набора является применение моноклональных антител, однако они были получены ранее 2017 года (период, когда появился производственный штамм «SAT-2/Кения/19/2017») и не могут с высокой достоверностью и точностью детектировать специфические антитела в сыворотках крови животных. Специфичность и чувствительность указанной тест-системы для выявления антител против вируса ящура генотипа SAT-2/IV ниже 25%, что подтверждают данные РМН в чувствительной перевиваемой монослойной клеточной линии почки свиньи IB-RS-2. Таким образом, применяемая тест-система не позволяет получать достоверных результатов именно в отношении изолятов и штаммов вируса ящура генотипа SAT-2/IV.The test system in the IZSLER kit is designed for the detection of anti-foot-and-mouth disease antibodies using a solid-phase direct “sandwich” ELISA version [21]. The advantage of this kit is the use of monoclonal antibodies, however, they were obtained earlier than 2017 (the period when the production strain “SAT-2/Kenya/19/2017” appeared) and cannot detect specific antibodies in animal blood sera with high reliability and accuracy. The specificity and sensitivity of this test system for detecting antibodies against foot-and-mouth disease virus genotype SAT-2/IV is below 25%, which is confirmed by RMN data in the sensitive continuous monolayer pig kidney cell line IB-RS-2. Thus, the test system used does not allow obtaining reliable results specifically for isolates and strains of foot-and-mouth disease virus genotype SAT-2/IV.
Наиболее близким прототипом для разработанной нами тест-системы является тест-система PrioCHECK (Prionics Lelystad B.V., Netherlands) для выявления антител к вирусу ящура типа SAT-2 [22].The closest prototype for the test system we developed is the PrioCHECK test system (Prionics Lelystad B.V., Netherlands) for detecting antibodies to the foot-and-mouth disease virus type SAT-2 [22].
Комплектующие для соответствующего набора представлены ниже:The components for the corresponding kit are presented below:
Компонент 1 - Планшеты иммунологические.Component 1 - Immunological tablets.
Компонент 2 - Конъюгат (30х). Разбавленный конъюгат не стабилен, готовят непосредственно перед применением. Компонент 3 - Буфер для разведения (5х). Компонент 4 - Неиммунная сыворотка крови лошади.Component 2 - Conjugate (30x). The diluted conjugate is not stable; prepare immediately before use. Component 3 - Dilution Buffer (5x). Component 4 - Non-immune horse blood serum.
Компонент 5 - Деминерализованная вода.Component 5 - Demineralized water.
Компонент 6 - Промывочный буфер (200х).Component 6 - Wash buffer (200x).
Компонент 7 - Референтная сыворотка 1 (позитивная) (жидкая).Component 7 - Reference serum 1 (positive) (liquid).
Компонент 8 - Референтная сыворотка 2 (менее позитивная) (жидкая).Component 8 - Reference serum 2 (less positive) (liquid).
Компонент 9 - Референтная сыворотка 3 (еще менее позитивная) (жидкая).Component 9 - Reference serum 3 (even less positive) (liquid).
Компонент 10 - Референтная сыворотка 4 (отрицательный контроль) (жидкая).Component 10 - Reference serum 4 (negative control) (liquid).
Компонент 11 - Субстрат хромогена (ТМВ).Component 11 - Chromogen substrate (TMB).
Компонент 12 - Стоп-раствор (1 N раствор серной кислоты). Данные отражены в инструкции производителя.Component 12 - Stop solution (1 N sulfuric acid solution). The data is reflected in the manufacturer's instructions.
Данная тест-система включает в себя конъюгат, который представляет собой меченые моноклональные антитела против вируса ящура серотипа SAT-2, исходя из этого является типоспецифичной, но без более узкой дифференциации. Прототипная тест-система разработана была еще в конце 90-гг XX в. В ней применяются антитела против антигенов вируса ящура различных генотипов серотипа SAT-2. Изоляты и штаммы генотипа SAT-2/IV имеют существенные отличия от других линий серотипа SAT-2. Исходя из выше отраженного, прототипная тест-система не является высокочувствительной и специфичной по отношению к вирусу ящура генотипа SAT-2/IV. Данная тест-система выявляет антитела к данному генотипу не более, чем на 28%. Исходя из этого, требуется разработать чувствительную, специфичную тест-систему для определения титра антител против 146S частиц вируса ящура генотипа SAT-2/IV с помощью жидкофазного ИФА.This test system includes a conjugate, which is a labeled monoclonal antibody against foot-and-mouth disease virus serotype SAT-2, and therefore is type-specific, but without a narrower differentiation. The prototype test system was developed back in the late 90s of the 20th century. It uses antibodies against foot-and-mouth disease virus antigens of various genotypes of the SAT-2 serotype. Isolates and strains of the SAT-2/IV genotype have significant differences from other lineages of the SAT-2 serotype. Based on the above, the prototype test system is not highly sensitive and specific to the foot and mouth disease virus genotype SAT-2/IV. This test system detects antibodies to a given genotype by no more than 28%. Based on this, it is necessary to develop a sensitive, specific test system for determining the titer of antibodies against 146S particles of foot-and-mouth disease virus genotype SAT-2/IV using liquid-phase ELISA.
Прототипная тест-система основана на твердофазном конкурентном «сэндвич»-варианте ИФА, однако эта форма удалена от РМН относительно возможностей улавливания антигенных сайтов по сравнению с жидкофазным вариантом ИФА.The prototype test system is based on a solid-phase competitive “sandwich” version of the ELISA, but this form is removed from the RMN in terms of the ability to capture antigenic sites compared to the liquid-phase version of the ELISA.
Учитывая указанные ограничения в применении имеющихся тест-систем, в том числе наиболее близкого прототипа, для точного определения титра антител против вируса ящура генотипа SAT-2/IV, актуальной является разработка тест-системы для определения титра антител против 146S частиц вируса ящура генотипа SAT-2/IV с помощью жидкофазного ИФА с учетом выше приведенных недостатков.Considering these limitations in the use of existing test systems, including the closest prototype, for accurately determining the titer of antibodies against foot-and-mouth disease virus genotype SAT-2/IV, it is relevant to develop a test system for determining the titer of antibodies against 146S particles of foot-and-mouth disease virus genotype SAT- 2/IV using liquid-phase ELISA, taking into account the above disadvantages.
На сегодняшний день с помощью жидкофазного блокирующего «сэндвич»-варианта ИФА с особенностями проведения реакции и определенным составом компонентов реакции разработаны «Тест-система на основе жидкофазного блокирующего непрямого «сэндвич»-варианта ИФА для определения титра антител против вируса ящура штамма А №2269/ВНИИЗЖ/2015 генотипа A/ASIA/G-VII в сыворотках крови животных после иммунизации», «Тест-система на основе жидкофазного блокирующего непрямого «сэндвич»-варианта ИФА для определения титра антител против вируса ящура штамма О №2047/Саудовская Аравия/2008 генотипа О/МЕ-SA/PanAsia2 в сыворотках крови животных после иммунизации» и «Способ быстрого количественного определения уровня гуморального иммунитета животных к штамму О №2311/Забайкальский/2016 генотипа O/ME-SA/Ind-2001 вируса ящура после вакцинации с помощью жидкофазного «сэндвич»-варианта ИФА» [23-25].Today, using a liquid-phase blocking “sandwich” version of the ELISA with the characteristics of the reaction and a certain composition of the reaction components, a “Test system based on a liquid-phase blocking indirect “sandwich” version of the ELISA has been developed to determine the titer of antibodies against the foot-and-mouth disease virus strain A No. 2269/ ARRIAH/2015 genotype A/ASIA/G-VII in animal blood sera after immunization”, “Test system based on liquid-phase blocking indirect “sandwich” ELISA variant for determining antibody titer against foot-and-mouth disease virus strain O No. 2047/Saudi Arabia/2008 genotype O/ME-SA/PanAsia2 in animal blood sera after immunization" and "Method for rapid quantitative determination of the level of humoral immunity of animals to strain O No. 2311/Zabaikalsky/2016 genotype O/ME-SA/Ind-2001 of foot-and-mouth disease virus after vaccination with liquid-phase “sandwich” version of ELISA” [23-25].
В настоящее время ветеринарная служба Российской Федерации не располагает современной отечественной тест-системой ИФА, которая позволила бы с высокой достоверностью определять титр антител против 146S частиц вируса ящура генотипа SAT-2/IV в сыворотках крови животных.Currently, the veterinary service of the Russian Federation does not have a modern domestic ELISA test system that would allow high reliability to determine the titer of antibodies against 146S particles of foot-and-mouth disease virus genotype SAT-2/IV in animal blood sera.
Целью изобретения является создание тест-системы для определения титра антител против 146S частиц вируса ящура генотипа SAT-2/IV с помощью жидкофазного ИФА.The purpose of the invention is to create a test system for determining the titer of antibodies against 146S particles of foot-and-mouth disease virus genotype SAT-2/IV using liquid-phase ELISA.
Поставленная цель достигается тем, что предлагаемая тест-система содержит следующие иммуноспецифические компоненты с высокой степенью активности:This goal is achieved by the fact that the proposed test system contains the following immunospecific components with a high degree of activity:
1) культуральный инактивированный лиофилизированный 146S компонент вируса ящура штамма «SAT-2/Кения/19/2017» генотипа SAT-2/IV;1) cultural inactivated lyophilized 146S component of the foot and mouth disease virus strain “SAT-2/Kenya/19/2017” genotype SAT-2/IV;
2) сенсибилизирующие антитела - иммуноглобулины G кролика против 146S частиц вируса ящура штамма «SAT-2/Кения/19/2017» генотипа SAT-2/IV;2) sensitizing antibodies - rabbit immunoglobulins G against 146S particles of foot and mouth disease virus strain “SAT-2/Kenya/19/2017” genotype SAT-2/IV;
3) детекторные антитела - иммуноглобулины G морской свинки против 146S частиц вируса ящура штамма «SAT-2/Кения/19/2017» генотипа SAT-2/IV;3) detector antibodies - guinea pig immunoglobulins G against 146S particles of foot and mouth disease virus strain “SAT-2/Kenya/19/2017” genotype SAT-2/IV;
4) контроль 1 (сильноположительный контроль) - положительная сыворотка крови телят к 146S частицам вируса ящура штамма «SAT-2/Кения/19/2017» генотипа SAT-2/IV с процентом ингибиции 80-100%;4) control 1 (strongly positive control) - positive calf blood serum to 146S particles of foot and mouth disease virus strain “SAT-2/Kenya/19/2017” genotype SAT-2/IV with an inhibition percentage of 80-100%;
5) контроль 2 (положительный контроль) - положительная сыворотка крови телят к 146S частицам вируса ящура штамма «SAT-2/Кения/19/2017» генотипа SAT-2/IV с процентом ингибиции от 50,0% до 79,9%;5) control 2 (positive control) - positive calf blood serum to 146S particles of foot and mouth disease virus strain “SAT-2/Kenya/19/2017” genotype SAT-2/IV with a percentage of inhibition from 50.0% to 79.9%;
6) контроль 3 (отрицательный контроль) - сыворотка крови телят, не содержащая антитела к антигену вируса ящура;6) control 3 (negative control) - calf blood serum that does not contain antibodies to the foot-and-mouth disease virus antigen;
7) блокирующая сыворотка крови;7) blocking blood serum;
8) антивидовой конъюгат - иммуноглобулины кролика против Ig G морской свинки, конъюгированные с ферментом (пероксидаза хрена).8) anti-species conjugate - rabbit immunoglobulins against guinea pig Ig G, conjugated with the enzyme (horseradish peroxidase).
Предлагаемая тест-система содержит неспецифические компоненты: буферный раствор на основе карбоната и гидрокарбоната натрия (рН 9,5-9,7), 20-кратный концентрат буферного раствора, хромогенный субстрат - диаммониевая соль 2,2'-азино-бис(3-этилбензотиазолин-6-сульфоната), «стоп»-раствор - 0,5%-ный раствор SDS.The proposed test system contains nonspecific components: a buffer solution based on sodium carbonate and sodium bicarbonate (pH 9.5-9.7), a 20-fold concentrate of the buffer solution, a chromogenic substrate - diammonium salt 2,2'-azino-bis(3- ethylbenzothiazoline-6-sulfonate), “stop” solution - 0.5% SDS solution.
Цель достигается благодаря тому, что метод жидкофазного блокирующего непрямого «сэндвич»-варианта ИФА наиболее приближен к классической реакции микронейтрализации в культуре клеток IB-RS-2, поскольку все антигенные сайты 146S частиц вируса ящура штамма «SAT-2/Кения/19/2017» генотипа SAT-2/IV находятся в свободном состоянии в жидкой фазе, открыты для связывания со специфическими сенсибилизирующими и детекторными антителами. Реакция основана на взаимодействии иммуноглобулинов G исследуемой сыворотки крови животного и 146S частиц вируса ящура генотипа SAT-2/IV в жидкой фазе с образованием иммунных комплексов. Проводится сенсибилизация лунок плоскодонного планшета антителами кролика против вируса ящура того же генотипа. Сенсибилизированные лунки обрабатывают с помощью блокирующей сыворотки крови, добавляют полученные иммунные комплексы из круглодонного планшета, инкубируют, вносят восстановленную из лиофильного высушенного состояния суспензию детекторных антител. Образовавшийся сложный иммунный комплекс выявляют с помощью антител против иммуноглобулинов G морской свинки, конъюгированных с пероксидазой хрена и хромогенного субстрата.The goal is achieved due to the fact that the liquid-phase blocking indirect “sandwich” ELISA method is closest to the classical microneutralization reaction in IB-RS-2 cell culture, since all antigenic sites of the 146S particles of the foot-and-mouth disease virus strain “SAT-2/Kenya/19/2017” » genotype SAT-2/IV are in a free state in the liquid phase, open to binding to specific sensitizing and detector antibodies. The reaction is based on the interaction of immunoglobulins G of the animal blood serum under study and 146S particles of foot-and-mouth disease virus genotype SAT-2/IV in the liquid phase with the formation of immune complexes. The wells of a flat-bottomed plate are sensitized with rabbit antibodies against foot-and-mouth disease virus of the same genotype. Sensitized wells are treated with blocking blood serum, the resulting immune complexes from a round-bottom plate are added, incubated, and a suspension of detector antibodies restored from a lyophilized dried state is added. The resulting complex immune complex is detected using antibodies against guinea pig immunoglobulin G conjugated to horseradish peroxidase and a chromogenic substrate.
Технический результат от изобретения заключается в разработке чувствительной и специфичной против 146S частиц вируса ящура генотипа SAT-2/IV тест-системы, предназначенной для определения титра антител против указанного антигена методом жидкофазного ИФА на основе применения 146S частиц вируса ящура штамма «SAT-2/Кения/19/2017» генотипа SAT-2/IV и при получении иммуноспецифических компонентов реакции.The technical result of the invention consists in the development of a test system that is sensitive and specific against 146S particles of foot-and-mouth disease virus genotype SAT-2/IV, designed to determine the titer of antibodies against the specified antigen using liquid-phase ELISA based on the use of 146S particles of foot-and-mouth disease virus strain "SAT-2/Kenya" /19/2017" genotype SAT-2/IV and upon receipt of immunospecific reaction components.
В отличии от прототипа в разработанной тест-системе применяется культуральный концентрированный в 600 раз инактивированный 146S компонент вируса ящура штамма «SAT-2/Кения/19/2017» генотипа SAT-2/IV, который представлен в виде лиофильно высушенной суспензии. Данный факт дает возможность определять титр антител против вируса ящура указанного генотипа с высокими показателями чувствительности (более 99%) и специфичности (100%), что на 72% выше по сравнению с наиболее близким прототипом. Кроме того, лиофилизированный компонент с протектором (2,4% хлорида натрия) остается стабильным не менее 4 лет по сравнению с антигеном в нативном состоянии, что является преимуществом в использовании данной тест-системы. Активность полученного 146S компонента вируса ящура генотипа SAT-2/IV составляет 1:5000.Unlike the prototype, the developed test system uses a culturally concentrated 600-fold inactivated 146S component of the foot-and-mouth disease virus strain “SAT-2/Kenya/19/2017” genotype SAT-2/IV, which is presented in the form of a freeze-dried suspension. This fact makes it possible to determine the titer of antibodies against the foot-and-mouth disease virus of the specified genotype with high rates of sensitivity (more than 99%) and specificity (100%), which is 72% higher compared to the closest prototype. In addition, the lyophilized component with a protector (2.4% sodium chloride) remains stable for at least 4 years compared to the antigen in its native state, which is an advantage in using this test system. The activity of the obtained 146S component of the foot and mouth disease virus genotype SAT-2/IV is 1:5000.
В отличии от прототипа применяются сенсибилизирующие и детекторные антитела лабораторных животных, соответственно, высокоспецифичные по отношению к 146S частицам вируса ящура генотипа SAT-2/IV. Указанные в тест-системе ИФА иммуноглобулины G кролика и морской свинки против генотипа SAT-2/IV вируса ящура представлены в виде лиофильного компонента с протектором (2,4% хлорида натрия), что позволяет иммуноглобулинам G находится в стабильном состоянии не менее 4 лет и с активностью не менее 1:10000 и 1:5000, соответственно.Unlike the prototype, sensitizing and detecting antibodies of laboratory animals are used, respectively, highly specific to 146S particles of foot-and-mouth disease virus genotype SAT-2/IV. The rabbit and guinea pig immunoglobulins G indicated in the ELISA test system against the genotype SAT-2/IV of the foot-and-mouth disease virus are presented in the form of a lyophilic component with a protector (2.4% sodium chloride), which allows immunoglobulins G to remain in a stable state for at least 4 years and with an activity of at least 1:10000 and 1:5000, respectively.
В отличии от прототипа сыворотки крови КРС, сильноположительный и положительный контроли получены против высокоочищенного концентрированного инактивированного 146S компонента вируса ящура генотипа SAT-2/IV, что позволяет достичь высокой специфичности и чувствительности при контроле работы тест-системы. Указанные компоненты представлены в виде лиофильно высушенных суспензий, что позволяет хранить их не менее 4 лет с сохранением высокой активности в ИФА. Для контроля 1 активность составляет не менее 1:6000, для контроля 2 - не менее 1:6000.Unlike the prototype cattle blood serum, strongly positive and positive controls were obtained against the highly purified concentrated inactivated 146S component of the foot and mouth disease virus genotype SAT-2/IV, which makes it possible to achieve high specificity and sensitivity when monitoring the operation of the test system. These components are presented in the form of freeze-dried suspensions, which allows them to be stored for at least 4 years while maintaining high activity in ELISA. For control 1, the activity is at least 1:6000, for control 2 - at least 1:6000.
В отличии от прототипа для блокирования открытых сайтов связывания применяется очищенная фетальная сыворотка телят, белковые составляющие которой обеспечивают полное закрытие пустых участков на дне иммунологического планшета. Данный компонент также представлен в лиофильном виде с протектором (2,4% хлорида натрия), что позволяет хранить его в данном состоянии не менее 4 лет.Unlike the prototype, purified fetal calf serum is used to block open binding sites, the protein components of which ensure complete closure of empty areas at the bottom of the immunological tablet. This component is also presented in lyophilic form with a protector (2.4% sodium chloride), which allows it to be stored in this state for at least 4 years.
В отличии от прототипного варианта представленная тест-система предусматривает контроль антигена и конъюгата, что дает возможность учитывать фоновые значения и, тем самым, получать достоверные данные по значениям экстинкции и титру антител против 146S частиц вируса ящура генотипа SAT-2/IV.Unlike the prototype version, the presented test system provides for control of the antigen and conjugate, which makes it possible to take into account background values and thereby obtain reliable data on extinction values and antibody titer against 146S particles of foot-and-mouth disease virus genotype SAT-2/IV.
В отличии от прототипа в предложенной тест-системе применяются антитела кроличьи к иммуноглобулину G морской свинки H&L (HRP), что позволяет повышать специфичность анализа и получать более достоверные результаты определения титра антител против 146S частиц вируса ящура генотипа SAT-2/IV в сыворотках крови животных. Активность конъюгата составляет 1:4000.Unlike the prototype, the proposed test system uses rabbit antibodies to guinea pig immunoglobulin G H&L (HRP), which makes it possible to increase the specificity of the analysis and obtain more reliable results for determining the titer of antibodies against 146S particles of foot-and-mouth disease virus genotype SAT-2/IV in animal blood sera . The activity of the conjugate is 1:4000.
Разработанная тест-система основана на специфическом блокировании 146S частиц вируса ящура генотипа SAT-2/IV антителами, содержащимися в исследуемой пробе сыворотки в жидкой фазе. Смесь «исследуемая сыворотка/антиген» переносят в лунки планшета, предварительно иммобилизованного сенсибилизирующими антителами кролика против штамма «SAT-2/Кения/19/2017» генотипа SAT-2/IV. Наличие антител к 146S частицам вируса ящура данного генотипа в исследуемой пробе будет выражаться в формировании иммунного комплекса и уменьшении количества свободного антигена, который связывается сенсибилизирующими антителами. Фиксированный в лунках антиген взаимодействует с детекторными антителами морской свинки, которые выявляются в реакции с иммунопероксидазным конъюгатом против иммуноглобулинов G морской свинки и последующим окрашиванием с помощью хромогенного субстрата. Интенсивность окрашивания обратно пропорциональна количественному значению выявленного титра антител животного. Интенсивность цветной реакции учитывают с помощью спектрофотометра.The developed test system is based on the specific blocking of 146S particles of foot-and-mouth disease virus genotype SAT-2/IV by antibodies contained in the test serum sample in the liquid phase. The “test serum/antigen” mixture is transferred into the wells of a plate previously immobilized with sensitizing rabbit antibodies against the strain “SAT-2/Kenya/19/2017” genotype SAT-2/IV. The presence of antibodies to 146S particles of foot-and-mouth disease virus of a given genotype in the test sample will be expressed in the formation of an immune complex and a decrease in the amount of free antigen that is bound by sensitizing antibodies. The antigen fixed in the wells interacts with guinea pig detector antibodies, which are detected in a reaction with an immunoperoxidase conjugate against guinea pig immunoglobulins G and subsequent staining with a chromogenic substrate. The intensity of staining is inversely proportional to the quantitative value of the detected antibody titer of the animal. The intensity of the color reaction is taken into account using a spectrophotometer.
Сущность изобретения отражена на графических изображениях:The essence of the invention is reflected in graphic images:
Фиг. 1 - Седиментационный профиль 146S частиц вируса ящура штамма «SAT-2/Кения/19/2017» генотипа SAT-2/IV.Fig. 1 - Sedimentation profile of 146S particles of foot and mouth disease virus strain “SAT-2/Kenya/19/2017” genotype SAT-2/IV.
Фиг. 2 - Электрофореграмма для 146S частиц вируса ящура штамма «SAT-2/Кения/19/2017» генотипа SAT-2/IV в 12% полиакриламидном геле. Примечание: М - маркер белковый, 2-6 - номера фракций, которые соответствуют седиментационному профилю 146S частиц.Fig. 2 - Electropherogram for 146S particles of foot and mouth disease virus strain “SAT-2/Kenya/19/2017” genotype SAT-2/IV in 12% polyacrylamide gel. Note: M is a protein marker, 2-6 are fraction numbers that correspond to the sedimentation profile of 146S particles.
Фиг. 3 - Филогенетическая принадлежность штамма «SAT-2/Кения/19/2017» вируса ящура генотипу SAT-2/IV.Fig. 3 - Phylogenetic affiliation of the foot and mouth disease virus strain “SAT-2/Kenya/19/2017” to the genotype SAT-2/IV.
Сущность изобретения пояснена в перечне последовательностей, в котором:The essence of the invention is explained in the list of sequences, in which:
SEQ ID NO: 1 представляет последовательность нуклеотидов гена, кодирующего белок VP1 штамма «SAT-2/Кения/19/2017» генотипа SAT-2/IV вируса ящура;SEQ ID NO: 1 represents the nucleotide sequence of the gene encoding the VP 1 protein of the strain “SAT-2/Kenya/19/2017” genotype SAT-2/IV foot-and-mouth disease virus;
SEQ ID NO: 2 представляет последовательность аминокислот белка VP1 штамма «SAT-2/Кения/19/2017» генотипа SAT-2/IV вируса ящура.SEQ ID NO: 2 represents the amino acid sequence of the VP 1 protein of the strain “SAT-2/Kenya/19/2017” genotype SAT-2/IV of the foot-and-mouth disease virus.
На подготовительном этапе исследования лиофилизированные иммуноспецифические компоненты тест-системы (антиген вируса ящура штамма «SAT-2/Кения/19/2017» генотипа SAT-2/IV, иммунопероксидазный конъюгат, положительные и отрицательный контроли, сенсибилизирующие и детекторные антитела) восстанавливают до необходимого объема деионизированной водой.At the preparatory stage of the study, lyophilized immunospecific components of the test system (antigen of the foot-and-mouth disease virus strain “SAT-2/Kenya/19/2017” genotype SAT-2/IV, immunoperoxidase conjugate, positive and negative controls, sensitizing and detector antibodies) are restored to the required volume deionized water.
Проводят приготовление рабочих растворов.Working solutions are prepared.
Раствор №1 (солевой буферный раствор карбоната и гидрокарбоната натрия). Готовят по стандартной методике 50 мл раствора с водородным показателем 9,5-9,7.Solution No. 1 (saline buffer solution of sodium carbonate and sodium bicarbonate). Prepare 50 ml of a solution with a pH value of 9.5-9.7 using standard methods.
Раствор №2 (Wash-раствор). Готовят 2 л стандартного буферного раствора TBS с добавлением 0,1% Tween-20 с водородным показателем 7,5-7,7. Рабочий Wash-раствор готовят разведением концентрата в 20 раз.Solution No. 2 (Wash solution). Prepare 2 liters of standard TBS buffer solution with the addition of 0.1% Tween-20 with a pH value of 7.5-7.7. The working wash solution is prepared by diluting the concentrate 20 times.
Раствор №3 (буфер для восстановления антител и конъюгата). Рабочий буферный раствор для разведения антител и иммунопероксидазного конъюгата готовится непосредственно перед использованием из рабочего Wash-раствора с добавлением 10% фетальной сыворотки телят.Solution No. 3 (buffer for the recovery of antibodies and conjugate). A working buffer solution for diluting antibodies and immunoperoxidase conjugate is prepared immediately before use from a working Wash solution with the addition of 10% fetal calf serum.
Этапы проведения жидкофазного блокирующего непрямого «сэндвич»-варианта ИФА для количественного определения уровня гуморального иммунитета против антигена вируса ящура штамма SAT-2/Кения/19/2017 генотипа SAT-2/IV представлены ниже.The stages of conducting a liquid-phase blocking indirect “sandwich” ELISA for quantitative determination of the level of humoral immunity against the antigen of the foot-and-mouth disease virus strain SAT-2/Kenya/19/2017 genotype SAT-2/IV are presented below.
1. Иммобилизация сенсибилизирующих антител против 146S частиц вируса ящура. Восстановленную суспензию сенсибилизирующих антител против 146S частиц вируса ящура штамма «SAT-2/Кения/19/2017» генотипа SAT-2/IV готовят в разведении 1:10000 в солевом буферном растворе карбоната и гидрокарбоната натрия (раствор №1). Во все лунки иммунологического 96-луночного планшета вносят по 100 мкл суспензии данных антител, накрывают крышкой и инкубируют в течение 18 ч при температуре (2-4)°С.1. Immobilization of sensitizing antibodies against 146S particles of foot and mouth disease virus. A reconstituted suspension of sensitizing antibodies against 146S particles of foot-and-mouth disease virus strain “SAT-2/Kenya/19/2017” genotype SAT-2/IV is prepared at a dilution of 1:10,000 in a saline buffer solution of sodium carbonate and sodium bicarbonate (solution No. 1). 100 μl of a suspension of these antibodies is added to all wells of an immunological 96-well plate, covered with a lid and incubated for 18 hours at a temperature of (2-4)°C.
2. Промывание лунок планшета осуществляют с использованием Wash-раствора 2 раза.2. The wells of the plate are washed using Wash solution 2 times.
3. Образование иммунного комплекса в жидкой фазе. Готовят следующие разведения сывороток крови животных: 4,0; 5,0; 5,5; 6,0; 6,5; 7,0; 7,5; 8,0; 8,5;9,0; 10,0; 11,0; 12,0; 13,0 log2 SN50 (1:16-1:8192) в растворе №2. Для этого во все лунки планшета за исключением лунок H1-6, которые оставляют для контроля антигена (КА) и контроля конъюгата (КК), вносят по 0,047 см3 (47 мкл) буферного раствора и 0,003 см3 (3 мкл) пробы. В лунки H1-6 вносят по 0,05 см3 (50 мкл) буферного раствора. Испытуемые и контрольные пробы располагают на планшете согласно таблице 1. Положительной сыворотка считается при уровне гуморального иммунитета ≥5,0 log2SN50 (≥1:32).3. Formation of an immune complex in the liquid phase. The following dilutions of animal blood serum are prepared: 4.0; 5.0; 5.5; 6.0; 6.5; 7.0; 7.5; 8.0; 8.5;9.0; 10.0; 11.0; 12.0; 13.0 log 2 SN 50 (1:16-1:8192) in solution No. 2. To do this, 0.047 cm 3 (47 μl) of a buffer solution and 0.003 cm 3 (3 μl) of a sample are added to all wells of the plate with the exception of wells H1-6, which are left for antigen control (CA) and conjugate control (CC). Add 0.05 cm 3 (50 μl) of buffer solution to wells H1-6. Test and control samples are placed on the plate according to Table 1. The serum is considered positive when the level of humoral immunity is ≥5.0 log 2 SN 50 (≥1:32).
В качестве контроля 1 используют сильноположительную сыворотку крови КРС/свиней против вируса ящура штамма «SAT-2/Кения/19/2017» генотипа SAT-2/IV - процент ингибиции (PI) 80-100%, контроля 2 - положительную сыворотку крови КРС/свиней против вируса ящура штамма «SAT-2/Кения/19/2017» генотипа SAT-2/IV - PI=50,0-79,9%, контроля 3 - нормальную сыворотку КРС/свиней - процент ингибиции <50%.As control 1, strongly positive cattle/pig blood serum is used against the foot and mouth disease virus strain “SAT-2/Kenya/19/2017” genotype SAT-2/IV - percentage of inhibition (PI) 80-100%, control 2 - positive cattle blood serum /pigs against foot and mouth disease virus strain “SAT-2/Kenya/19/2017” genotype SAT-2/IV - PI=50.0-79.9%, control 3 - normal bovine/pig serum - percentage of inhibition <50%.
Во все лунки планшета добавляют по 0,05 см3 рабочего разведения антигена в растворе №2 в соответствии с разведением 1:3000. После перемешивания содержимого лунок планшета проводят в течение 1 часа при температуре (2-4)°С.Add 0.05 cm 3 of a working dilution of the antigen in solution No. 2 to all wells of the plate in accordance with a dilution of 1:3000. After mixing the contents of the wells, the plate is carried out for 1 hour at a temperature of (2-4)°C.
4. Улавливание антигена. В промытые сенсибилизированные лунки планшета вносят по 0,05 см3 смеси контрольных и испытуемых проб и 146S частиц, планшет закрывают крышкой и инкубируют в течение 60±2 мин при температуре (37±1)°С.4. Antigen capture. 0.05 cm 3 of a mixture of control and test samples and 146S particles is added to the washed sensitized wells of the plate, the plate is closed with a lid and incubated for 60±2 minutes at a temperature of (37±1)°C.
5. Промывание лунок планшета. Проводят, как представлено выше (п. 2). Процедуру повторяют 3 раза.5. Washing the wells of the plate. Carry out as described above (item 2). The procedure is repeated 3 times.
6. Внесение детекторных антител. Во все лунки планшета, за исключением лунок с КК (контроль конъюгата), куда добавляют по 0,05 см3 раствора №3, вносят по 0,05 см3 рабочего разведения детекторных антител (1:4000) в растворе №3. Планшет накрывают крышкой и инкубируют в течение 60±2 мин при температуре (37±1)°С.6. Addition of detector antibodies. In all wells of the plate, with the exception of wells with QC (conjugate control), where 0.05 cm 3 of solution No. 3 is added, 0.05 cm 3 of the working dilution of detector antibodies (1:4000) in solution No. 3 is added. The plate is covered with a lid and incubated for 60±2 minutes at a temperature of (37±1)°C.
7. Промывание лунок планшета. Проводят, как представлено выше (п. 2). Процедуру повторяют 3 раза.7. Washing the wells of the plate. Carry out as described above (item 2). The procedure is repeated 3 times.
8. Внесение конъюгата. Во все лунки планшета вносят по 0,05 см3 рабочего разведения конъюгата (1:4000) в растворе №3. Планшет накрывают крышкой и инкубируют в течение 60±2 мин при температуре (37±1)°С.8. Addition of the conjugate. Add 0.05 cm 3 of the working dilution of the conjugate (1:4000) in solution No. 3 to all wells of the plate. The plate is covered with a lid and incubated for 60±2 minutes at a temperature of (37±1)°C.
9. Промывание лунок планшета. Проводят, как представлено выше (п. 2). Процедуру повторяют 4 раза.9. Washing the wells of the plate. Carry out as described above (item 2). The procedure is repeated 4 times.
10. Проявление цветной реакции. Во все лунки планшета вносят по 0,05 см3 диаммониевой соли 2,2'-азино-бис(3-этилбензотиазолин-6-сульфоната), закрывают крышкой и выдерживают 15 минут при температуре (20±2)°С.10. Manifestation of color reaction. Add 0.05 cm 3 of diammonium salt of 2,2'-azino-bis(3-ethylbenzothiazoline-6-sulfonate) to all wells of the plate, close with a lid and incubate for 15 minutes at a temperature of (20±2)°C.
11. Торможение реакции. Реакцию останавливают добавлением в каждую лунку планшета 0,05 см3 0,5%-ного раствора SDS.11. Inhibition of the reaction. The reaction is stopped by adding 0.05 cm 3 of a 0.5% SDS solution to each well of the plate.
12. Определение значения экстинкции и титра антител против 146S частиц вируса ящура генотипа SAT-2/IV по данным ИФА. Сразу после остановки реакции измеряют значение декадного коэффициента экстинкции (ε) продуктов реакции в каждой лунке при длине волны 405 нм, используя спектрофотометр для микропланшетов с вертикальным лучом света. Значения г переводят в значение процента ингибиции (PI, %) по формуле:12. Determination of the extinction value and titer of antibodies against 146S particles of foot-and-mouth disease virus genotype SAT-2/IV according to ELISA data. Immediately after stopping the reaction, measure the decadal extinction coefficient (ε) of the reaction products in each well at a wavelength of 405 nm using a microplate spectrophotometer with a vertical light beam. The r values are converted to the percentage of inhibition (PI, %) using the formula:
PI (%)=(1-(εсыворотки-εКК)(εКА-εКК))×100,PI (%)=(1-(ε serum -ε CK )(ε KA -ε CK ))×100,
где, εcыворотки - среднее значение декадного коэффициента экстинкции смеси сыворотки с инактивированным 146S компонентом вируса ящура генотипа SAT-2/IV;where, ε serum is the average value of the ten-day extinction coefficient of a mixture of serum with the inactivated 146S component of the foot-and-mouth disease virus genotype SAT-2/IV;
εКА - среднее значение декадного коэффициента экстинкции контроля антигена;ε KA - average value of the ten-day extinction coefficient of antigen control;
εКК - среднее значение декадного коэффициента экстинкции контроля конъюгата.ε CC is the average value of the ten-day extinction coefficient of the conjugate control.
Достоверность проводимого анализа с помощью предложенной тест-системы определяется при удовлетворении следующим критериям:The reliability of the analysis performed using the proposed test system is determined if the following criteria are met:
- разница между значениями εКА и εКК не менее 0,45 оптических единиц (о.е.);- the difference between the values of ε KA and ε CC is at least 0.45 optical units (p.u.);
- контроль 1 имеет значение PI>80%;- control 1 has a value of PI>80%;
- контроль 2 имеет значение PI в пределах 50,0-79,9%;- control 2 has a PI value in the range of 50.0-79.9%;
- контроль 3 имеет значение PI<50%.- control 3 has a value of PI<50%.
Сыворотки крови, для которых значение PI≥50%, считают положительными, содержащими антитела к 146S частицам вируса ящура генотипа SAT-2/IV. Значение PI<50% в сыворотке крови обследуемых животных является отрицательным. Исходя из полученных данных берут последнее разведение сыворотки, для которого процент ингибиции составляет ≥50%. Данное разведение считают титром антител против 146S частиц вируса ящура генотипа SAT-2/IV и выражают в log2SN50.Blood sera for which the PI value≥50% are considered positive, containing antibodies to 146S particles of foot-and-mouth disease virus genotype SAT-2/IV. A PI value <50% in the blood serum of the examined animals is negative. Based on the data obtained, take the last serum dilution for which the percentage of inhibition is ≥50%. This dilution is considered the antibody titer against 146S particles of foot-and-mouth disease virus genotype SAT-2/IV and is expressed in log 2 SN 50 .
В результате проведенных исследований были оттитрованы оригинальные компоненты реакции. Активность детекторных антител в ИФА составила 1:5000, сенсибилизирующих антител - 1:10000, антивидового конъюгата - 1:4000; 146S частиц вируса ящура штамма «SAT-2/Кения/19/2017» генотипа SAT-2/IV - 1:5000, контроля 1-1:6000, контроля 2 - 1:6000. С использованием разработанной тест-системы проведено исследование образцов сывороток крови животных с определением титра антител против 146S частиц вируса ящура генотипа SAT-2/IV и проведен сравнительный анализ с результатами РМН в чувствительной перевиваемой монослойной клеточной линии почки свиньи (IB-RS-2) [2].As a result of the studies, the original components of the reaction were titrated. The activity of detector antibodies in ELISA was 1:5000, sensitizing antibodies - 1:10000, anti-species conjugate - 1:4000; 146S particles of foot and mouth disease virus strain “SAT-2/Kenya/19/2017” genotype SAT-2/IV - 1:5000, control 1-1:6000, control 2 - 1:6000. Using the developed test system, a study of animal blood serum samples was carried out to determine the titer of antibodies against 146S particles of foot-and-mouth disease virus genotype SAT-2/IV and a comparative analysis was carried out with the results of RMN in a sensitive continuous monolayer pig kidney cell line (IB-RS-2) [ 2].
Разработанная тест-система дает возможность тестировать одновременно в формате одного 96-луночного планшета 6 проб сывороток в следующих разведениях, выраженных в двоичном логарифме: 4,0; 5,0; 5,5; 6,0; 6,5; 7,0; 7,5; 8,0; 8,5; 9,0; 10,0; 11,0; 12,0; 13,0 log2SN50 (1:16-1:8192).The developed test system makes it possible to test simultaneously in the format of one 96-well plate 6 serum samples in the following dilutions, expressed in binary logarithm: 4.0; 5.0; 5.5; 6.0; 6.5; 7.0; 7.5; 8.0; 8.5; 9.0; 10.0; 11.0; 12.0; 13.0 log 2 SN 50 (1:16-1:8192).
Контроль суспензий 146S частиц вируса ящура штамма «SAT-2/Кения/19/2017» генотипа SAT-2/IV на специфичность.Monitoring of suspensions of 146S particles of foot and mouth disease virus strain “SAT-2/Kenya/19/2017” genotype SAT-2/IV for specificity.
Специфичность суспензий 146S частиц вируса ящура штамма «SAT-2/Кения/19/2017» генотипа SAT-2/IV определена с помощью ОТ-ПЦР с последующим секвенированием 1D-гена, соответствующего белку VP1, в котором наиболее часто возникают мутации. По результатам исследования нуклеотидной последовательности указанного гена была выявлена принадлежность штамма «SAT-2/Кения/19/2017» к генотипу SAT-2/IV. Расчет проводился в соответствии с Байесовской теорией вероятности. Специфичность подтверждена также в реакции связывания комплемента со штаммоспецифической сывороткой. Концентрация общего вирусного белка в исследуемом антигене вируса ящура штамма «SAT-2/Кения/19/2017» составила 2,25 мкг/мл, концентрация 146S компонента - 1,49 мкг/мл (66%). Данное содержание полных вирусных частиц (146S компонент) достаточно для проведения дальнейших работ по концентрированию и получению готового лиофильно высушенного антигена для изготовления тест-системы.The specificity of suspensions of 146S particles of foot-and-mouth disease virus strain “SAT-2/Kenya/19/2017” genotype SAT-2/IV was determined using RT-PCR followed by sequencing of the 1D gene corresponding to the VP 1 protein, in which mutations most often occur. Based on the results of a study of the nucleotide sequence of this gene, it was revealed that the strain “SAT-2/Kenya/19/2017” belongs to the genotype SAT-2/IV. The calculation was carried out in accordance with Bayesian probability theory. Specificity was also confirmed in the complement fixation reaction with strain-specific serum. The concentration of the total viral protein in the studied antigen of the foot-and-mouth disease virus strain “SAT-2/Kenya/19/2017” was 2.25 μg/ml, the concentration of the 146S component was 1.49 μg/ml (66%). This content of complete viral particles (146S component) is sufficient for further work on concentrating and obtaining a ready-made freeze-dried antigen for the manufacture of a test system.
Штамм «SAT-2/Кения/19/2017» вируса ящура серотипа SAT-2 относится к семейству Picornaviridae, роду Aphthovirus, виду Foot-and-Mouth Disease virus и обладает морфологическими признаками, характерными для возбудителя ящура: форма вириона иксаэдрическая, размер 24-25 нм. Вирион состоит из молекулы одноцепочечной молекулы РНК с позитивным смыслом, заключенной в белковую оболочку. Она состоит из 32 капсомеров, расположенных в кубической симметрии.Strain “SAT-2/Kenya/19/2017” of foot-and-mouth disease virus serotype SAT-2 belongs to the family Picornaviridae, genus Aphthovirus, species Foot-and-Mouth Disease virus and has morphological features characteristic of the causative agent of foot-and-mouth disease: the shape of the virion is ixahedral, size 24 -25 nm. A virion consists of a single-stranded, positive-sense RNA molecule enclosed in a protein shell. It consists of 32 capsomeres arranged in cubic symmetry.
Антигенные свойстваAntigenic properties
По антигенным свойствам штамм «SAT-2/Кения/19/2017» вируса ящура относится к серотипу SAT-2. Вирус стабильно нейтрализуется гомологичной антисывороткой и не проявляет гемагглютинирующей активности. У переболевших животных в сыворотке крови образуются типоспецифические антитела, выявляемые в иммуноферментном анализе (ИФА) и реакции микронейтрализации (РМН).According to antigenic properties, the strain “SAT-2/Kenya/19/2017” of the foot-and-mouth disease virus belongs to the SAT-2 serotype. The virus is stably neutralized by homologous antiserum and does not exhibit hemagglutinating activity. In recovered animals, type-specific antibodies are formed in the blood serum, which are detected in enzyme-linked immunosorbent assay (ELISA) and microneutralization reaction (RMN).
Методом нуклеотидного секвенирования была определена первичная структура ID-гена, кодирующего белок VP1, штамма «SAT-2/Кения/19/2017» вируса ящура. Сравнительный анализ нуклеотидных последовательностей показал, что штамм «SAT-2/Кения/19/2017» вируса ящура принадлежит к генотипу SAT-1/IV (Фиг. 1).Using the nucleotide sequencing method, the primary structure of the ID gene encoding the VP 1 protein of the foot-and-mouth disease virus strain “SAT-2/Kenya/19/2017” was determined. Comparative analysis of nucleotide sequences showed that the strain “SAT-2/Kenya/19/2017” of the foot-and-mouth disease virus belongs to the SAT-1/IV genotype (Fig. 1).
Антигенное родство (r1) штамма «SAT-2/Кения/19/2017» вируса ящура изучено в РМН в перекрестном исследовании штамма со специфическими сыворотками, полученными на производственные штаммы вируса ящура.The antigenic affinity (r 1 ) of the foot-and-mouth disease virus strain “SAT-2/Kenya/19/2017” was studied at the Russian Medical Research Institute in a cross-study of the strain with specific sera obtained for production strains of the foot-and-mouth disease virus.
Титр референтных сывороток крови КРС, полученных путем иммунизации животных моновалентными вакцинами из производственных штаммов вируса ящура серотипа SAT-2, против 102 ТЦД50 гомологичного и гетерологичного вируса определяли в РМН при перекрестном титровании, рассчитывая значения с использованием уравнения линейной регрессии, и выражали в lg. Значение r1 определяли, как антилогарифм разности lg титров сыворотки против гетерологичного и гомологичного вируса [7, 8, 9].The titer of reference cattle blood sera obtained by immunizing animals with monovalent vaccines from industrial strains of foot-and-mouth disease virus serotype SAT-2 against 10 2 TCD 50 of homologous and heterologous virus was determined in the RMN with cross-titration, calculating values using a linear regression equation, and expressed in lg . The r 1 value was determined as the antilogarithm of the difference in serum lg titers against heterologous and homologous viruses [7, 8, 9].
Значение r1 в РМН интерпретировали следующим образом:The value of r 1 in the RMN was interpreted as follows:
при ≥0,3 - исследуемый и производственный штаммы вируса ящура являются близкородственными;at ≥0.3 - the studied and production strains of foot-and-mouth disease virus are closely related;
при <0,3 - исследуемый образец штамма вируса ящура отличается от производственного штамма.at <0.3 - the studied sample of the foot-and-mouth disease virus strain differs from the production strain.
Показатели антигенного родства при изучении штамма «SAT-2/Кения/19/2017» составили r1 от 0,02 до 0,25, а именно для штамма «SAT-2/ZIM/14/2002» (генотип SAT-2/I) - 0,23, для «SAT-2/ZIM/5/81» (генотип SAT-2/II) - 0,21, для «SAT-2/BOT/P3/98» (генотип SAT-2/III) - 0,22, для «SAT-2/ЕТН/1/90» (генотип SAT-2/IV) - 0,25, для «SAT-2/GHA/2/90» (генотип SAT-2/V) - 0,19, для «SAT-2/GAM/8/79» (генотип SAT-2/VI) - 0,15, для «SAT-2/SAU/6/2000» (генотип SAT-2/VII) - 0,10, для «SAT-2/RWO/1/00» (генотип SAT-2/VIII) - 0,14, для «SAT-2/KEN/2/84» (генотип SAT-2/IX) - 0,09, для «SAT-2/UGA/19/98» (генотип SAT-2/X) - 0,06, для «SAT-2/ANG/4/74» (генотип SAT-2/XI) - 0,18, для «SAT-2/UGA/51/75» (генотип SAT-2/XII) - 0,02, для «SAT-2/ЕТН/2/2007» (генотип SAT-2/XIII) - 0,13, для «SAT-2/ETH/2/9»1 (генотип SAT-2/XIV)-0,12.Indicators of antigenic relatedness when studying the strain “SAT-2/Kenya/19/2017” amounted to r 1 from 0.02 to 0.25, namely for the strain “SAT-2/ZIM/14/2002” (genotype SAT-2/ I) - 0.23, for “SAT-2/ZIM/5/81” (genotype SAT-2/II) - 0.21, for “SAT-2/BOT/P3/98” (genotype SAT-2/ III) - 0.22, for "SAT-2/ETH/1/90" (genotype SAT-2/IV) - 0.25, for "SAT-2/GHA/2/90" (genotype SAT-2/ V) - 0.19, for “SAT-2/GAM/8/79” (genotype SAT-2/VI) - 0.15, for “SAT-2/SAU/6/2000” (genotype SAT-2/ VII) - 0.10, for "SAT-2/RWO/1/00" (genotype SAT-2/VIII) - 0.14, for "SAT-2/KEN/2/84" (genotype SAT-2/ IX) - 0.09, for “SAT-2/UGA/19/98” (genotype SAT-2/X) - 0.06, for “SAT-2/ANG/4/74” (genotype SAT-2/ XI) - 0.18, for “SAT-2/UGA/51/75” (genotype SAT-2/XII) - 0.02, for “SAT-2/ETH/2/2007” (genotype SAT-2/ XIII) - 0.13, for “SAT-2/ETH/2/9”1 (genotype SAT-2/XIV) -0.12.
Полученные данные свидетельствуют об отсутствии антигенного родства с производственными штаммами вируса ящура серотипа SAT-2. Гено- и хемотаксономическая характеристикиThe data obtained indicate the absence of antigenic relationship with production strains of foot-and-mouth disease virus serotype SAT-2. Geno- and chemotaxonomic characteristics
Штамм «SAT-2/Кения/19/2017» вируса ящура является РНК(+) - содержащим вирусом с молекулярной массой 8,08×106 Д. Нуклеиновая кислота представлена одноцепочной линейной молекулой молекулярной массой 2,8×106 Д. Вирион имеет белковую оболочку, состоящую из четырех основных белков VP1, VP2, VP3 и VP4. Липопротеидная оболочка отсутствует.Strain “SAT-2/Kenya/19/2017” of foot-and-mouth disease virus is an RNA(+)-containing virus with a molecular weight of 8.08×10 6 D. Nucleic acid is represented by a single-chain linear molecule with a molecular weight of 2.8×10 6 D. Virion has a protein shell consisting of four main proteins VP 1 , VP 2 , VP 3 and VP 4 . The lipoprotein membrane is absent.
Основным антигенным белком является VP1. В вирионе содержится приблизительно 31,5% РНК и 68,5% белка. Вирусная РНК является инфекционной и участвует в образовании белков-предшественников в инфицированных клетках. Предшественники, в свою очередь, расщепляются с образованием более стабильных структурных и неструктурных полипептидов вируса. Из 8 неструктурных полипептидов, накапливающихся в инфицированных клетках, выделяют РНК-зависимую РНК-полимеразу (3D-ген), участвующую в репликации РНК для сборки вирионов.The main antigenic protein is VP 1 . The virion contains approximately 31.5% RNA and 68.5% protein. Viral RNA is infectious and is involved in the formation of precursor proteins in infected cells. The precursors, in turn, are cleaved to form more stable structural and nonstructural polypeptides of the virus. From 8 non-structural polypeptides that accumulate in infected cells, an RNA-dependent RNA polymerase (3D gene) is isolated, which is involved in RNA replication for the assembly of virions.
Физические свойстваPhysical properties
Масса вириона составляет 8,4×10-18 г. Плавучая плотность 1,44 г/см3. Устойчивость к внешним факторамThe mass of the virion is 8.4 × 10 -18 g. The buoyant density is 1.44 g/cm 3 . Resistance to external factors
Штамм «SAT-2/Кения/19/2017» вируса ящура устойчив к детергентам и органическим растворителям, таким как эфир, хлороформ, фреон, ацетон. Наиболее стабилен при рН 7,4-7,6. Сдвиги рН как в кислую, так и в щелочную сторону ведут к инактивации вируса. Чувствителен к формальдегиду, УФ-облучению, γ-облучению, высоким температурам (выше 38,3°С).Strain “SAT-2/Kenya/19/2017” of foot and mouth disease virus is resistant to detergents and organic solvents such as ether, chloroform, freon, acetone. Most stable at pH 7.4-7.6. Shifts in pH both to the acidic and alkaline sides lead to inactivation of the virus. Sensitive to formaldehyde, UV irradiation, γ-irradiation, high temperatures (above 38.3°C).
Дополнительные признаки и свойства инактивированной суспензии 146S частиц вируса ящура генотипа SAT-2/IVAdditional characteristics and properties of an inactivated suspension of 146S particles of foot-and-mouth disease virus genotype SAT-2/IV
Иммуногенная активность - иммуногенен в составе инактивированной вакцины.Immunogenic activity - immunogenic as part of an inactivated vaccine.
Антигенная активность - введение инактивированного вируса ящура штамма «SAT-2/Кения/19/2017» морским свинкам, кроликам, свиньям, овцам, КРС индуцирует образование вирусоспецифических антител.Antigenic activity - the introduction of inactivated foot-and-mouth disease virus strain “SAT-2/Kenya/19/2017” to guinea pigs, rabbits, pigs, sheep, and cattle induces the formation of virus-specific antibodies.
Реактогенность - реактогенными свойствами не обладает.Reactogenicity - does not have reactogenic properties.
Патогенность - инактивированный вируса ящура указанного штамма не патогенен для парнокопытных животных, новорожденных мышат, морских свинок.Pathogenicity - inactivated foot and mouth disease virus of the specified strain is not pathogenic for artiodactyl animals, newborn mice, guinea pigs.
Вирулентность - инактивированный вируса ящура указанного штамма не вирулентен для естественно-восприимчивых животных при контактном, аэрозольном и парентеральном заражении.Virulence - inactivated foot and mouth disease virus of the specified strain is not virulent for naturally susceptible animals during contact, aerosol and parenteral infection.
Стабильность неинактивированного вируса ящура - сохраняет исходные биологические свойства при культивировании в чувствительных биологических системах в течение 5 пассажей (срок наблюдения).Stability of non-inactivated foot-and-mouth disease virus - retains its original biological properties when cultivated in sensitive biological systems for 5 passages (observation period).
Сущность изобретения пояснена примерами его использования, которые не ограничивают объем изобретения.The essence of the invention is illustrated by examples of its use, which do not limit the scope of the invention.
Пример 1. Получение суспензии 146S частиц вируса ящура генотипа SAT-2/IV.Example 1. Preparation of a suspension of 146S particles of foot and mouth disease virus genotype SAT-2/IV.
Для получения суспензии 146S частиц вируса ящура штамма «SAT-2/Кения/19/2017» генотипа SAT-2/IV для изготовления тест-системы проводили суспензионное культивирование вируса в клеточной линии ВНК-21/SUSP/ARRIAH в течение 13-14 ч с получением вирусной суспензии с титром инфекционной активности не ниже 6,5 lg ТЦД50/см3. Полученную вирусную суспензию инактивировали с помощью аминоэтилэтиленимина и осветляли полигексаметиленгуанидином.To obtain a suspension of 146S particles of foot and mouth disease virus strain “SAT-2/Kenya/19/2017” genotype SAT-2/IV for the production of a test system, suspension cultivation of the virus was carried out in the cell line BNK-21/SUSP/ARRIAH for 13-14 hours to obtain a viral suspension with a titer of infectious activity of at least 6.5 lg TCD 50 /cm 3 . The resulting viral suspension was inactivated with aminoethylethylenimine and clarified with polyhexamethylene guanidine.
Инактивированную культуральную суспензию, содержащую антиген вирус ящура, осветляли в течение 30 мин. при 6000 об/мин и 2-4°С. Надосадочную жидкость отбирали и добавляли в нее ПЭГ-6000 до конечной концентрации 8,5% и хлорид натри (сухой) до конечной концентрации 0,85%, интенсивно перемешивали и выдерживали при температуре 4±2°С в течение 24 часов. Вирусную суспензию осаждали при 6000 об/мин в течение 60 мин., осадок растворяли в 1/15 М фосфатном буферном растворе, концентрируя в 600 раз (1/600 от первоначального объема).The inactivated cultural suspension containing the foot-and-mouth disease virus antigen was clarified for 30 minutes. at 6000 rpm and 2-4°C. The supernatant liquid was collected and PEG-6000 was added to it to a final concentration of 8.5% and sodium chloride (dry) to a final concentration of 0.85%, mixed vigorously and kept at a temperature of 4±2°C for 24 hours. The viral suspension was precipitated at 6000 rpm for 60 minutes, the sediment was dissolved in 1/15 M phosphate buffer solution, concentrating 600 times (1/600 of the original volume).
К полученному преципитату добавляли 50% хлороформа, интенсивно перемешивали и фракционировали с помощью центрифуги в течение 30 мин. при 3000 об/мин. Отбирали верхнюю водную фракцию, содержащую антиген вируса ящура штамма «SAT-2/Кения/19/2017». Отбирали 100 мкл образца для последующего электрофоретического анализа в 12% полиакриламидном геле в денатурирующих условиях.50% chloroform was added to the resulting precipitate, mixed vigorously and fractionated using a centrifuge for 30 min. at 3000 rpm. The upper aqueous fraction containing the antigen of the foot-and-mouth disease virus strain “SAT-2/Kenya/19/2017” was selected. 100 μl of sample was taken for subsequent electrophoretic analysis in a 12% polyacrylamide gel under denaturing conditions.
На следующем этапе проводили получение 146S частиц вируса ящура штамма «SAT-2/Кения/19/2017», необходимого для иммунизации животных и получения антигена как одного из важнейших специфических компонентов ИФА.At the next stage, 146S particles of the foot and mouth disease virus strain “SAT-2/Kenya/19/2017” were obtained, necessary for immunizing animals and obtaining the antigen as one of the most important specific components of the ELISA.
Для выделения полных частиц с коэффициентом седиментации 146S готовили линейный градиент сахарозы с концентрациями 40 и 30%. Опалесцирующий слой, содержащий 146S компонент, располагается приблизительно в 40-30%-м слое сахарозы, которые отбирали и переосаждали с помощью ультрацентрифугирования в течение 4 часов при скорости 25000 об/мин. и температуре 4±2°С и ресуспендировали осадок в 1/15 М фосфатно-солевом буферном растворе.To isolate complete particles with a sedimentation coefficient of 146S, a linear gradient of sucrose was prepared with concentrations of 40 and 30%. The opalescent layer containing the 146S component is located in approximately 40-30% sucrose layer, which was collected and reprecipitated by ultracentrifugation for 4 hours at 25,000 rpm. and a temperature of 4±2°C and resuspended the sediment in 1/15 M phosphate-buffered saline solution.
Результаты спектрометрического исследования полученных фракций 146S частиц вируса ящура штамма «SAT-2/Кения/19/2017» генотипа SAT-2/IV в виде антигенного профиля представлены на фиг.1. Проведен электрофорез 146S частиц в 12% полиакриламидном геле в денатурирующих условиях (фиг.2), который подтвердил, что для исследований подходят по степени чистоты фракции №№2-6.The results of a spectrometric study of the obtained fractions of 146S particles of foot and mouth disease virus strain “SAT-2/Kenya/19/2017” genotype SAT-2/IV in the form of an antigenic profile are presented in Fig.1. Electrophoresis of 146S particles was carried out in a 12% polyacrylamide gel under denaturing conditions (Fig. 2), which confirmed that fractions No. 2-6 are suitable for research in terms of purity.
Пример 2. Получение гипериммунной сыворотки крови кроликов (сенсибилизирующие антитела) против 146S частиц вируса ящура генотипа SAT-2/IV.Example 2. Preparation of hyperimmune rabbit blood serum (sensitizing antibodies) against 146S particles of foot and mouth disease virus genotype SAT-2/IV.
Для получения специфических сывороток крови против 146S частиц вируса ящура генотипа SAT-2/IV использовали клинически здоровых кроликов средней упитанности массой 2,5-3,0 кг.To obtain specific blood sera against 146S particles of foot and mouth disease virus genotype SAT-2/IV, clinically healthy rabbits of average fatness weighing 2.5-3.0 kg were used.
Для гипериммунизации животных применяли инактивированную суспензию 146S частиц вируса ящура генотипа SAT-2/IV, полученную как описано в примере 1, из которой готовили эмульсию с использованием масляного адъюванта Montanide ISA-61 VG (в соотношении адъювант/антиген=60/40 по массе). Полученную вакцину вводили в мышцу задних конечностей кролика на 0, 14 и 28 дни в объеме 0,5 см3. Через 7 дней после последней иммунизации у кроликов отбирали кровь, содержащую сенсибилизирующие антитела, которую лиофильно высушивали и хранили при температуре (2-4)°С.For hyperimmunization of animals, an inactivated suspension of 146S particles of foot-and-mouth disease virus genotype SAT-2/IV was used, obtained as described in example 1, from which an emulsion was prepared using the oil adjuvant Montanide ISA-61 VG (adjuvant/antigen ratio = 60/40 by weight) . The resulting vaccine was injected into the muscle of the hind limbs of a rabbit on days 0, 14 and 28 in a volume of 0.5 cm 3 . 7 days after the last immunization, blood containing sensitizing antibodies was collected from rabbits, which was freeze-dried and stored at a temperature of (2-4)°C.
Пример 3. Получение гипериммунной сыворотки крови морских свинок (детекторные антитела) против 146S частиц вируса ящура генотипа SAT-2/IV.Example 3. Preparation of hyperimmune blood serum of guinea pigs (detector antibodies) against 146S particles of foot and mouth disease virus genotype SAT-2/IV.
Для гипериммунизации морских свинок использовали эмульсию из 146S частиц вируса ящура генотипа, полученного как описано в примере 1. Приготовление вакцины и схема иммунизации такая, как в примере 2.For hyperimmunization of guinea pigs, an emulsion of 146S particles of the foot-and-mouth disease virus genotype was used, obtained as described in example 1. The preparation of the vaccine and the immunization scheme were the same as in example 2.
Пример 4. Определение активности в ИФА суспензии 146S частиц вируса ящура генотипа, сенсибилизирующих и детекторных антител к нему.Example 4. Determination of the activity in ELISA of a suspension of 146S particles of foot-and-mouth disease virus genotype, sensitizing and detector antibodies to it.
Полученные образцы сывороток крови животных проверяли на активность и специфичность в жидкофазном варианте ИФА. Проведен подбор оптимальных рабочих разведений указанных компонентов для получения достоверных результатов в ИФА. Полученные данные анализа представлены в таблицах 2, 3, 4.The obtained animal blood serum samples were tested for activity and specificity in the liquid-phase version of ELISA. The selection of optimal working dilutions of these components was carried out to obtain reliable results in ELISA. The obtained analysis data are presented in tables 2, 3, 4.
Для анализа исследовали следующие разведения сенсибилизирующих антител: 1:8000, 1:9000, 1:10000, 1:11000. Разведения остальных компонентов были постоянны: для антигена - 1:5000, для детекторных антител - 1:5000, конъюгата - 1:4000. В качестве контрольных сывороток для анализа применяли сыворотки, специфичные к определенным штаммам вируса ящура с активностью 8,0 log2SN50. Их таблицы 2 следует, что при разведении сенсибилизирующих антител 1:10000 достигалось получение достоверного результата (1:256 или 8,0 log2SN50). При меньших разведений антител наблюдали высокие фоновые значения, что не позволяло получить корректный результат. При большем разведении отмечали снижение детектируемых значений уровня гуморального иммунитета в сыворотках крови животных. При исследовании неспецифических и отрицательных сывороток получали отрицательные результаты, что свидетельствовало о высокой специфичности разработанной тест-системы.For analysis, the following dilutions of sensitizing antibodies were studied: 1:8000, 1:9000, 1:10000, 1:11000. The dilutions of the remaining components were constant: for antigen - 1:5000, for detector antibodies - 1:5000, conjugate - 1:4000. Sera specific to certain strains of foot-and-mouth disease virus with an activity of 8.0 log 2 SN 50 were used as control sera for analysis. Their table 2 shows that with a dilution of sensitizing antibodies of 1:10000, a reliable result was achieved (1:256 or 8.0 log 2 SN 50 ). At lower dilutions of antibodies, high background values were observed, which did not allow obtaining a correct result. At higher dilutions, a decrease in the detectable values of the level of humoral immunity in the blood serum of animals was noted. When studying nonspecific and negative sera, negative results were obtained, which indicated the high specificity of the developed test system.
Для анализа исследовали следующие разведения детекторных антител: 1:3000, 1:4000, 1:5000, 1:6000. Разведения остальных компонентов были постоянны: для антигена - 1:5000, для сенсибилизирующих антител - 1:10000, конъюгата - 1:4000. В качестве контрольных сывороток для анализа применяли сыворотки, специфичные к определенным штаммам вируса ящура с активностью 8,0 log2SN50. Их таблицы 3 следует, что при разведении детекторных антител 1:5000 достигалось получение достоверного результата (1:256 или 8,0 log2SN50). При меньших разведений антител наблюдали высокие фоновые значения, что не позволяло получить корректный результат. При большем разведении наблюдали снижение детектируемого значения титра антител в сыворотках крови животных. При исследовании неспецифических и отрицательных сывороток отмечали отрицательные результаты, что свидетельствовало о высокой специфичности разработанной тест-системы.The following dilutions of detector antibodies were used for analysis: 1:3000, 1:4000, 1:5000, 1:6000. The dilutions of the remaining components were constant: for antigen - 1:5000, for sensitizing antibodies - 1:10000, conjugate - 1:4000. Sera specific to certain strains of foot-and-mouth disease virus with an activity of 8.0 log 2 SN 50 were used as control sera for analysis. Their table 3 shows that with a dilution of detector antibodies of 1:5000, a reliable result was achieved (1:256 or 8.0 log 2 SN 50 ). At lower dilutions of antibodies, high background values were observed, which did not allow obtaining a correct result. At higher dilutions, a decrease in the detectable value of antibody titer in animal blood sera was observed. When examining nonspecific and negative sera, negative results were noted, which indicated the high specificity of the developed test system.
Для анализа исследовали следующие разведения 146S частиц: 1:3000, 1:4000, 1:5000, 1:6000. Разведения остальных компонентов были постоянны: для детекторных антител - 1:5000, для сенсибилизирующих антител - 1:10000, конъюгата - 1:4000. В качестве контрольных сывороток для анализа применяли сыворотки, специфичные к определенным штаммам вируса ящура с активностью 8,0 log2SN50. Их таблицы 4 следует, что при разведении антигена 1:5000 достигалось получение достоверного результата (1:256 или 8,0 log2SN50). При меньших разведениях наблюдали высокие фоновые значения, что не позволяло получить корректный результат. При большем разведении наблюдали снижение детектируемого значения титра антител в сыворотках крови животных.The following dilutions of 146S particles were studied for analysis: 1:3000, 1:4000, 1:5000, 1:6000. The dilutions of the remaining components were constant: for detector antibodies - 1:5000, for sensitizing antibodies - 1:10000, conjugate - 1:4000. Sera specific to certain strains of foot-and-mouth disease virus with an activity of 8.0 log 2 SN 50 were used as control sera for analysis. Their table 4 shows that when the antigen was diluted 1:5000, a reliable result was achieved (1:256 or 8.0 log 2 SN 50 ). At lower dilutions, high background values were observed, which did not allow obtaining a correct result. At higher dilutions, a decrease in the detectable value of antibody titer in animal blood sera was observed.
При исследовании неспецифических и отрицательных сывороток отмечали отрицательные результаты, что свидетельствовало о высокой специфичности разработанной тест-системы.When examining nonspecific and negative sera, negative results were noted, which indicated the high specificity of the developed test system.
Таким образом, в ходе лабораторных испытаний определено, что рабочие разведения 146S частиц вируса ящура генотипа SAT-2/IV, сенсибилизирующих и детекторных антител составили 1:5000, 1:10000, 1:5000, соответственно.Thus, during laboratory tests it was determined that the working dilutions of 146S particles of foot-and-mouth disease virus genotype SAT-2/IV, sensitizing and detector antibodies were 1:5000, 1:10000, 1:5000, respectively.
Пример 5. Применение тест-системы жидкофазного варианта ИФА для определения титра антител против 146S частиц вируса ящура генотипа SAT-2/IV (предлагаемое изобретение).Example 5. Use of a liquid-phase ELISA test system to determine the titer of antibodies against 146S particles of foot-and-mouth disease virus genotype SAT-2/IV (the proposed invention).
Исследовали 12 сывороток крови животных, полученных после иммунизации инактивированными сорбированными моновалентными вакцинами против ящура, содержащими 146S частицы вируса ящура генотипа SAT-2/IV. Определены значения титра антител против 146S частиц с применением разработанной тест-системы ИФА, а также данные сыворотки были исследованы в РМН в чувствительной перевиваемой монослойной клеточной линии IB-RS-2, рекомендованной МЭБ (OIE) [2]. Полученные результаты отражены в таблице 5, из которой следует, что степень корреляции результатов разработанной тест-системы ИФА (предлагаемое изобретение) и классического метода РМН высокая (приближено к 100%).We studied 12 animal blood sera obtained after immunization with inactivated sorbed monovalent vaccines against foot-and-mouth disease containing 146S particles of foot-and-mouth disease virus genotype SAT-2/IV. The antibody titer values against 146S particles were determined using the developed ELISA test system, and the serum data were examined at the RMN in the sensitive continuous monolayer cell line IB-RS-2, recommended by the OIE (OIE) [2]. The results obtained are reflected in Table 5, from which it follows that the degree of correlation between the results of the developed ELISA test system (the proposed invention) and the classical RMN method is high (close to 100%).
Пример 6. Определение диагностических показателей разработанной тест-системы для определения титра антител против 146S частиц вируса ящура генотипа SAT-2/IV с помощью жидкофазного ИФА (предлагаемое изобретение).Example 6. Determination of diagnostic parameters of the developed test system for determining the titer of antibodies against 146S particles of foot-and-mouth disease virus genotype SAT-2/IV using liquid-phase ELISA (the proposed invention).
Для исследования представленной тест-системы для определения титра антител против 146S частиц вируса ящура генотипа SAT-2/IV с помощью жидкофазного ИФА исследовали стандартные диагностические показатели. Для определения чувствительности предложенной тест-системы анализировали 410 сывороток крови животных, которые являлись заведомо положительными по данным РМН в чувствительной перевиваемой монослойной клеточной линии почки свиньи IB-RS-2. Титр антител для данных сывороток крови находился в диапазоне 5,5-13,0 log2SN50. Постановку ИФА проводили, как отражено выше. Разработанной тест-системой (предлагаемое изобретение) определили, что из 410 образцов сывороток крови 407 определены в качестве положительных, а 3 - в качестве отрицательных (титр антител по данным ИФА составил 1:16). Для исследования специфичности метода тестировали 205 отрицательных сывороток крови животных. В результате исследования с помощью ИФА (предлагаемое изобретение) определили, что из 205 отрицательных проб - 205 определены в качестве отрицательных. Определили, что в 95%-ном доверительном интервале диагностическая чувствительность (DSe) составила 97,89-99,85%, диагностическая специфичность (DSp) - 98,22-100,0%, k-критерий - 0,989; прогностичность отрицательного результата (NPV) - 95,84-99,70%, общая точность (DAc) - 98,59-99,90% (таблица 6).To study the presented test system for determining the titer of antibodies against 146S particles of foot-and-mouth disease virus genotype SAT-2/IV, standard diagnostic indicators were examined using liquid-phase ELISA. To determine the sensitivity of the proposed test system, 410 animal blood sera were analyzed, which were obviously positive according to RMN data in the sensitive continuous monolayer pig kidney cell line IB-RS-2. The antibody titer for these blood sera was in the range of 5.5-13.0 log 2 SN 50 . ELISA was performed as described above. The developed test system (the proposed invention) determined that out of 410 blood serum samples, 407 were identified as positive, and 3 as negative (antibody titer according to ELISA data was 1:16). To study the specificity of the method, 205 negative animal blood sera were tested. As a result of the study using ELISA (the proposed invention), it was determined that out of 205 negative samples, 205 were identified as negative. It was determined that in the 95% confidence interval, diagnostic sensitivity (DSe) was 97.89-99.85%, diagnostic specificity (DSp) - 98.22-100.0%, k-criterion - 0.989; negative predictive value (NPV) - 95.84-99.70%, overall accuracy (DAc) - 98.59-99.90% (Table 6).
Таким образом предлагаемая «Тест-система для определения титра антител против 146S частиц вируса ящура генотипа SAT-2/IV с помощью жидкофазного ИФА» является специфичной и чувствительной, позволяющей в течение 4 часов провести анализ сывороток крови животных с определением титра антител против 146S частиц вируса ящура генотипа SAT-2/IV. Данный генотип является актуальным и быстро распространяющимся на территории Африканского континента. Разработанная тест-система направлена на подтверждение высокой эффективности производимых в РФ противоящурных инактивированных вакцин, содержащих антиген данного генотипа, и, тем самым, на защиту территории России и граничащих с ней на юге стран от распространения вируса ящура генотипа SAT-2/IV.Thus, the proposed “Test system for determining the titer of antibodies against 146S particles of foot-and-mouth disease virus genotype SAT-2/IV using liquid-phase ELISA” is specific and sensitive, allowing analysis of animal blood sera within 4 hours to determine the titer of antibodies against 146S virus particles foot and mouth disease genotype SAT-2/IV. This genotype is relevant and rapidly spreading throughout the African continent. The developed test system is aimed at confirming the high efficiency of inactivated foot-and-mouth disease vaccines produced in the Russian Federation containing the antigen of this genotype, and, thereby, protecting the territory of Russia and the countries bordering it in the south from the spread of foot-and-mouth disease virus genotype SAT-2/IV.
Источники информации, принятые во внимание при составлении описания изобретения к заявке на выдачу патента РФ на изобретение «Тест-система для определения титра антител против 146S частиц вируса ящура генотипа SAT-2/IV с помощью жидкофазного ИФА»:Sources of information taken into account when compiling a description of the invention for the application for a RF patent for the invention “Test system for determining the titer of antibodies against 146S particles of foot-and-mouth disease virus genotype SAT-2/IV using liquid-phase ELISA”:
1. Diagnostic assays developed for the control of foot-and-mouth disease in India / Sharma G.K., Mahajan S., Matura R. [et al.] // World J Virology. - 2015. - V. 4(3). - P. 295-302.1. Diagnostic assays developed for the control of foot-and-mouth disease in India / Sharma G.K., Mahajan S., Matura R. [et al.] // World J Virology. - 2015. - V. 4(3). - P. 295-302.
2. OIE. Manual of diagnostic tests and vaccines for terrestrial animals. - Paris, 2018. - Chapter 2.1.8.2. OIE. Manual of diagnostic tests and vaccines for terrestrial animals. - Paris, 2018. - Chapter 2.1.8.
3. Гуленкин, B.M. Экономическая эффективность проведения профилактической вакцинации животных против ящура на территории Российской Федерации / В.М. Гуленкин // Труды Федерального центра охраны здоровья животных. - Владимир, 2012. - Т. 10. - С. 31-41.3. Gulenkin, B.M. Economic efficiency of preventive vaccination of animals against foot and mouth disease on the territory of the Russian Federation / V.M. Gulenkin // Proceedings of the Federal Center for Animal Health. - Vladimir, 2012. - T. 10. - P. 31-41.
4. Brooksby, J.В. 1982. Portraits of viruses: foot-and-mouth disease virus. Intervirology 18:1-23.4. Brooksby, J.W. 1982. Portraits of viruses: foot-and-mouth disease virus. Intervirology 18:1–23.
5. Rueckert, R.R., and E. Wimmer. 1984. Systematic nomenclature of picornavirus proteins. J. Virol. 50:957-959,5. Rueckert, R. R., and E. Wimmer. 1984. Systematic nomenclature of picornavirus proteins. J. Virol. 50:957-959,
6. Grubman, M. J. 1980. The 5' end of foot-and-mouth disease virion RNA contains a protein covalently linked to the nucleotide pUp.Arch. Virol. 63:311-315.6. Grubman, M. J. 1980. The 5' end of foot-and-mouth disease virion RNA contains a protein covalently linked to the nucleotide pUp.Arch. Virol. 63:311-315.
7. Domingo, E., C. Escarmis, E. Baranowski, С.M. Ruiz-Jarabo, E. Carrillo, J.I. Nunez, and F. Sobrino. 2003. Evolution of foot-and-mouth disease virus. Virus Res. 91:47-63.7. Domingo, E., C. Escarmis, E. Baranowski, S.M. Ruiz-Jarabo, E. Carrillo, J.I. Nunez, and F. Sobrino. 2003. Evolution of foot-and-mouth disease virus. Virus Res. 91:47-63.
8. Sobrino, F., M. Davila, J. Ortin, and E. Domingo. 1983. Multiple genetic variants arise in the course of replication of foot-and-mouth disease virus in cell culture. Virology 128:310-318.8. Sobrino, F., M. Davila, J. Ortin, and E. Domingo. 1983. Multiple genetic variants arise in the course of replication of foot-and-mouth disease virus in cell culture. Virology 128:310–318.
9. Динамика развития противоящурного гуморального иммунитета у крупного рогатого скота, иммунизированного трехвалентной сорбированной вакциной типов А, О, Азия-1 / Д.В. Михалишин, Т.Н. Лезова // Труды Федерального центра охраны здоровья животных. - Владимир, 2007. - Т. 5. - С. 75-82.9. Dynamics of development of anti-foot-and-mouth disease humoral immunity in cattle immunized with trivalent sorbed vaccine types A, O, Asia-1 / D.V. Mikhalishin, T.N. Lezova // Proceedings of the Federal Center for Animal Health. - Vladimir, 2007. - T. 5. - P. 75-82.
10. Wong C.L., Yong C.Y., Ong Н.K., Но K.L., Tan W.S. Advances in the Diagnosis of Foot-and-Mouth Disease // Front Vet Sci. - 2020 Aug 21. - V.7. - P. 477.10. Wong C.L., Yong C.Y., Ong N.K., But K.L., Tan W.S. Advances in the Diagnosis of Foot-and-Mouth Disease // Front Vet Sci. - 2020 Aug 21. - V.7. - P. 477.
11. Curry S., Abu-Ghazaleh R., Blakemore W., Fry E., Jackson Т., King A., Lea S., Logan D., Newman J., Stuart D. Crystallization and preliminary X-ray analysis of three serotypes of foot-and-mouth disease virus // J. Mol Biol. - 1992. - V. 228(4). - P. 1263-1268.11. Curry S., Abu-Ghazaleh R., Blakemore W., Fry E., Jackson T., King A., Lea S., Logan D., Newman J., Stuart D. Crystallization and preliminary X-ray analysis of three serotypes of foot-and-mouth disease virus // J. Mol Biol. - 1992. - V. 228(4). - P. 1263-1268.
12. King, A.M., D. McCahon, K. Saunders, J.W. Newman, and W.R. Slade. 1985. Multiple sites of recombination within the RNA genome of foot-and-mouth disease virus. Virus Res. 3:373-384.12. King, A.M., D. McCahon, K. Saunders, J.W. Newman, and W.R. Slade. 1985. Multiple sites of recombination within the RNA genome of foot-and-mouth disease virus. Virus Res. 3:373-384.
13. Tosh, C., D. Hemadri, and A. Sanyal. 2002. Evidence of recombination in the capsid-coding region of type A foot-and-mouth disease virus. J. Gen. Virol. 83:2455-2460.13. Tosh, C., D. Hemadri, and A. Sanyal. 2002. Evidence of recombination in the capsid-coding region of type A foot-and-mouth disease virus. J.Gen. Virol. 83:2455-2460.
14. Fry E.E., Stuart D.I., Rowlands D.J. The structure of foot-and-mouth disease virus // Curr Top Microbiol Immunol - 2005. - V. 288. - P. 71-101/14. Fry E.E., Stuart D.I., Rowlands D.J. The structure of foot-and-mouth disease virus // Curr Top Microbiol Immunol - 2005. - V. 288. - P. 71-101/
15. Palmenberg A.C. Proteolytic processing of picornaviral polyprotein // Annu Rev Microbiol. - 1990. - V. 44. - P. 603-623.15. Palmenberg A.C. Proteolytic processing of picornaviral polyprotein // Annu Rev Microbiol. - 1990. - V. 44. - P. 603-623.
16. Curry S., Fry E., Blakemore W., Abu-Ghazaleh R., Jackson Т., King A., Lea S., Newman J., Stuart D. Dissecting the roles of VP0 cleavage and RNA packaging in picornavirus capsid stabilization: the structure of empty capsids of foot-and-mouth disease virus // J. Virol. - 1997. - V. 71(12). - P. 9743-9752.16. Curry S., Fry E., Blakemore W., Abu-Ghazaleh R., Jackson T., King A., Lea S., Newman J., Stuart D. Dissecting the roles of VP 0 cleavage and RNA packaging in picornavirus capsid stabilization: the structure of empty capsids of foot-and-mouth disease virus // J. Virol. - 1997. - V. 71(12). - P. 9743-9752.
17. Anon N. Global Strategy for control of foot-and-mouth disease. - In, Bangkok, Thailand, - 2012. - P. 27-29.17. Anon N. Global Strategy for control of foot-and-mouth disease. - In, Bangkok, Thailand, - 2012. - P. 27-29.
18. Saitou N. and Nei M. (1987). The neighbor-joining method: A new method for reconstructing phylogenetic trees. Molecular Biology and Evolution 4:406-425.18. Saitou N. and Nei M. (1987). The neighbor-joining method: A new method for reconstructing phylogenetic trees. Molecular Biology and Evolution 4:406–425.
19. Felsenstein J. (1985). Confidence limits on phylogenies: An approach using the bootstrap.Evolution 39:783-791.19. Felsenstein J. (1985). Confidence limits on phylogenies: An approach using the bootstrap. Evolution 39:783-791.
20. Tamura K., Nei M., and Kumar S. (2004). Prospects for inferring very large phylogenies by using the neighbor-joining method. Proceedings of the National Academy of Sciences (USA) 101:11030-11035.20. Tamura K., Nei M., and Kumar S. (2004). Prospects for inferring very large phylogenies by using the neighbor-joining method. Proceedings of the National Academy of Sciences (USA) 101:11030–11035.
21. IZSLER ELISA. URL: https://www.fao.org/fileadmin/user_uploaod/eufmd/docs/Open_Session2012/Appendices/75_New_Elisa_for_diagnosis_Brocchi_.pdf (Дата обращения: 05.04.2023).21. IZSLER ELISA. URL: https://www.fao.org/fileadmin/user_uploaod/eufmd/docs/Open_Session2012/Appendices/75_New_Elisa_for_diagnosis_Brocchi_.pdf (Date of access: 04/05/2023).
22. Наборы для определения антител к антигену вируса ящура (FMDV) PrioCHECK. URL: vetprofilab.ru/f/rus_priochek_fmdv.pdf (Дата обращения: 24.03.2023).22. Kits for determining antibodies to the antigen of foot-and-mouth disease virus (FMDV) PrioCHECK. URL: vetprofilab.ru/f/rus_priochek_fmdv.pdf (Date of access: 03/24/2023).
23. Патент РФ №2787714, 11.01.2023. Тест-система на основе жидкофазного блокирующего непрямого «сэндвич»-варианта ИФА для определения титра антител против вируса ящура штамма А №2269/ВНИИЗЖ/2015 генотипа A/ASIA/G-VII в сыворотках крови животных после иммунизации // Заявка №2022108324.23. RF Patent No. 2787714, 01/11/2023. Test system based on a liquid-phase blocking indirect “sandwich” version of ELISA for determining the titer of antibodies against foot-and-mouth disease virus strain A No. 2269/ARNIAH/2015 genotype A/ASIA/G-VII in animal blood sera after immunization // Application No. 2022108324.
24. Патент РФ №2791614, 13.03.2023. Тест-система на основе жидкофазного блокирующего непрямого «сэндвич»-варианта ИФА для определения титра антител против вируса ящура штамма О №2047/Саудовская Аравия/2008 генотипа O/ME-SA/PanAsia2 в сыворотках крови животных после иммунизации // Заявка №2022119118.24. RF Patent No. 2791614, 03/13/2023. Test system based on a liquid-phase blocking indirect “sandwich” version of ELISA for determining the titer of antibodies against foot-and-mouth disease virus strain O No. 2047/Saudi Arabia/2008 genotype O/ME-SA/PanAsia2 in animal blood sera after immunization // Application No. 2022119118.
25. Патент РФ №2796393, 23.05.2023. Способ быстрого количественного определения уровня гуморального иммунитета животных к штамму О №2311/Забайкальский/2016 генотипа O/ME-SA/Ind-2001 вируса ящура после вакцинации с помощью жидкофазного «сэндвич»-варианта ИФА // Заявка №2022113420.25. RF Patent No. 2796393, 05/23/2023. Method for rapid quantitative determination of the level of humoral immunity of animals to strain O No. 2311/Zabaikalsky/2016 genotype O/ME-SA/Ind-2001 of foot and mouth disease virus after vaccination using a liquid-phase “sandwich” version of ELISA // Application No. 2022113420.
--->--->
<?xml version="1.0" encoding="UTF-8"?><?xml version="1.0" encoding="UTF-8"?>
<!DOCTYPE ST26SequenceListing PUBLIC "-//WIPO//DTD Sequence Listing <!DOCTYPE ST26SequenceListing PUBLIC "-//WIPO//DTD Sequence Listing
1.3//EN" "ST26SequenceListing_V1_3.dtd">1.3//EN" "ST26SequenceListing_V1_3.dtd">
<ST26SequenceListing dtdVersion="V1_3" fileName="ELISA FMDV SAT-2 <ST26SequenceListing dtdVersion="V1_3" fileName="ELISA FMDV SAT-2
IV.xmp.xml" softwareName="WIPO Sequence" softwareVersion="2.1.2" IV.xmp.xml" softwareName="WIPO Sequence" softwareVersion="2.1.2"
productionDate="2023-06-19">productionDate="2023-06-19">
<ApplicationIdentification> <ApplicationIdentification>
<IPOfficeCode>RU</IPOfficeCode> <IPOfficeCode>RU</IPOfficeCode>
<ApplicationNumberText>0</ApplicationNumberText> <ApplicationNumberText>0</ApplicationNumberText>
<FilingDate>2023-06-19</FilingDate> <FilingDate>2023-06-19</FilingDate>
</ApplicationIdentification> </ApplicationIdentification>
<ApplicantFileReference>515</ApplicantFileReference> <ApplicantFileReference>515</ApplicantFileReference>
<EarliestPriorityApplicationIdentification> <EarliestPriorityApplicationIdentification>
<IPOfficeCode>RU</IPOfficeCode> <IPOfficeCode>RU</IPOfficeCode>
<ApplicationNumberText>0</ApplicationNumberText> <ApplicationNumberText>0</ApplicationNumberText>
<FilingDate>2023-06-19</FilingDate> <FilingDate>2023-06-19</FilingDate>
</EarliestPriorityApplicationIdentification> </EarliestPriorityApplicationIdentification>
<ApplicantName languageCode="ru">ФГБУ "Федеральный центр охраны <ApplicantName languageCode="ru">FSBI "Federal Security Center"
здоровья животных" (ФГБУ "ВНИИЗЖ")</ApplicantName>animal health" (FSBI "ARRIAH")</ApplicantName>
<ApplicantNameLatin>FGBI "ARRIAH"</ApplicantNameLatin> <ApplicantNameLatin>FGBI "ARRIAH"</ApplicantNameLatin>
<InventorName languageCode="ru">Доронин Максим <InventorName languageCode="ru">Doronin Maxim
Игоревич</InventorName>Igorevich</InventorName>
<InventorNameLatin>Doronin Maksim Igorevich </InventorNameLatin> <InventorNameLatin>Doronin Maksim Igorevich </InventorNameLatin>
<InventionTitle languageCode="ru">Тест-система для определения титра <InventionTitle languageCode="en">Test system for titer determination
антител против 146S частиц вируса ящура генотипа SAT-2/IV с помощью antibodies against 146S particles of foot and mouth disease virus genotype SAT-2/IV using
жидкофазного ИФА</InventionTitle>liquid-phase ELISA</InventionTitle>
<SequenceTotalQuantity>2</SequenceTotalQuantity> <SequenceTotalQuantity>2</SequenceTotalQuantity>
<SequenceData sequenceIDNumber="1"> <SequenceData sequenceIDNumber="1">
<INSDSeq> <INSDSeq>
<INSDSeq_length>642</INSDSeq_length> <INSDSeq_length>642</INSDSeq_length>
<INSDSeq_moltype>DNA</INSDSeq_moltype> <INSDSeq_moltype>DNA</INSDSeq_moltype>
<INSDSeq_division>PAT</INSDSeq_division> <INSDSeq_division>PAT</INSDSeq_division>
<INSDSeq_feature-table> <INSDSeq_feature-table>
<INSDFeature> <INSDFeature>
<INSDFeature_key>source</INSDFeature_key> <INSDFeature_key>source</INSDFeature_key>
<INSDFeature_location>1..642</INSDFeature_location> <INSDFeature_location>1..642</INSDFeature_location>
<INSDFeature_quals> <INSDFeature_quals>
<INSDQualifier> <INSDQualifier>
<INSDQualifier_name>mol_type</INSDQualifier_name> <INSDQualifier_name>mol_type</INSDQualifier_name>
<INSDQualifier_value>genomic DNA</INSDQualifier_value> <INSDQualifier_value>genomic DNA</INSDQualifier_value>
</INSDQualifier> </INSDQualifier>
<INSDQualifier id="q1"> <INSDQualifier id="q1">
<INSDQualifier_name>organism</INSDQualifier_name> <INSDQualifier_name>organism</INSDQualifier_name>
<INSDQualifier_value>FMDV</INSDQualifier_value> <INSDQualifier_value>FMDV</INSDQualifier_value>
</INSDQualifier> </INSDQualifier>
</INSDFeature_quals> </INSDFeature_quals>
</INSDFeature> </INSDFeature>
</INSDSeq_feature-table> </INSDSeq_feature-table>
<INSDSeq_sequence>accactagtgctggagagggagcagacgtcgtcacgactgacccctcaa <INSDSeq_sequence>accactagtgctggagagggagcagacgtcgtcacgactgacccctcaa
cacacggtgggagtgtagtggagaagagacggatgcacacagacgttgcattcgtgctggacaggttcaccacacggtgggagtgtagtggagaagagacggatgcacacagacgttgcattcgtgctggacaggttcac
tcacgtacacaccaacaaaaccacatttaacgtggacctactggacaccaaacaacaaaccttagtgggttcacgtacacaccaacaaaaccacatttaacgtggacctactggacaccaaacaacaaaccttagtgggt
gctcttctcagagcgtcaacctactacttctgtgacttggagattgcctgtgtgggcaaccacaaacgcggctcttctcagagcgtcaacctactacttctgtgacttggagatgcctgtgtgggcaaccacaaacgcg
tctactggcagcccaacggcgcgccacgtacgacgcaactgggagacaaccccatggtgttcgcccacaatctactggcagcccaacggcgcgccacgtacgacgcaactgggagacaaccccatggtgttcgcccacaa
cagcgtcactaggtttgccataccttacaccgcaccgcaccggttgcttgcaaccgtgtacaacggcgagcagcgtcactaggtttgccataccttacaccgcaccgcaccggttgcttgcaaccgtgtacaacggcgag
tgtaagtacacagaacgagttcccgcaatccgcggtgaccgtgctgtgttggcagccaagtacgccaacttgtaagtacacagaacgagttcccgcaatccgcggtgaccgtgctgtgttggcagccaagtacgccaact
ccagacacacgcttccatccacgttcaactttggacacgtgaccgccgacgagccagtcgacgtttactaccagacacacgcttccatccacgttcaactttggacacgtgaccgccgacgagccagtcgacgtttacta
caggatgaagcgggcagagttgtattgtccaaggccactcctcccggcttaccaacacaacgaccgggaccaggatgaagcgggcagagttgtattgtccaaggccactcctcccggcttaccaacacaacgaccgggac
aggttcgacgcacccattggcgtcgagaaacaa</INSDSeq_sequence>aggttcgacgcacccattggcgtcgagaaacaa</INSDSeq_sequence>
</INSDSeq> </INSDSeq>
</SequenceData> </SequenceData>
<SequenceData sequenceIDNumber="2"> <SequenceData sequenceIDNumber="2">
<INSDSeq> <INSDSeq>
<INSDSeq_length>214</INSDSeq_length> <INSDSeq_length>214</INSDSeq_length>
<INSDSeq_moltype>AA</INSDSeq_moltype> <INSDSeq_moltype>AA</INSDSeq_moltype>
<INSDSeq_division>PAT</INSDSeq_division> <INSDSeq_division>PAT</INSDSeq_division>
<INSDSeq_feature-table> <INSDSeq_feature-table>
<INSDFeature> <INSDFeature>
<INSDFeature_key>source</INSDFeature_key> <INSDFeature_key>source</INSDFeature_key>
<INSDFeature_location>1..214</INSDFeature_location> <INSDFeature_location>1..214</INSDFeature_location>
<INSDFeature_quals> <INSDFeature_quals>
<INSDQualifier> <INSDQualifier>
<INSDQualifier_name>mol_type</INSDQualifier_name> <INSDQualifier_name>mol_type</INSDQualifier_name>
<INSDQualifier_value>protein</INSDQualifier_value> <INSDQualifier_value>protein</INSDQualifier_value>
</INSDQualifier> </INSDQualifier>
<INSDQualifier id="q2"> <INSDQualifier id="q2">
<INSDQualifier_name>organism</INSDQualifier_name> <INSDQualifier_name>organism</INSDQualifier_name>
<INSDQualifier_value>FMDV</INSDQualifier_value> <INSDQualifier_value>FMDV</INSDQualifier_value>
</INSDQualifier> </INSDQualifier>
</INSDFeature_quals> </INSDFeature_quals>
</INSDFeature> </INSDFeature>
</INSDSeq_feature-table> </INSDSeq_feature-table>
<INSDSeq_sequence>TTSAGEGADVVTTDPSTHGGSVVEKRRMHTDVAFVLDRFTHVHTNKTTF <INSDSeq_sequence>TTSAGEGADVVTTDPSTHGGSVVEKRRMHTDVAFVLDRFTHVHTNKTTF
NVDLLDTKQQTLVGALLRASTYYFCDLEIACVGNHKRVYWQPNGAPRTTQLGDNPMVFAHNSVTRFAIPYNVDLDLDTKQQTLVGALLRASTYYFCDLEIACVGNHKRVYWQPNGAPRTTQLGDNPMVFAHNSVTRFAIPY
TAPHRLLATVYNGECKYTERVPAIRGDRAVLAAKYANSRHTLPSTFNFGHVTADEPVDVYYRMKRAELYCTAPHRLLATVYNGECKYTERVPAIRGDRAVLAAKYANSRHTLPSTFNFGHVTADEPVDVYYRMKRAELYC
PRPLLPAYQHNDRDRFDAPIGVEKQ</INSDSeq_sequence>PRPLLPAYQHNDRDRFDAPIGVEKQ</INSDSeq_sequence>
</INSDSeq> </INSDSeq>
</SequenceData> </SequenceData>
</ST26SequenceListing></ST26SequenceListing>
<---<---
Claims (4)
Publications (1)
| Publication Number | Publication Date |
|---|---|
| RU2811996C1 true RU2811996C1 (en) | 2024-01-22 |
Family
ID=
Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN105807052B (en) * | 2016-05-13 | 2017-12-15 | 郑州中道生物技术有限公司 | O-shaped FMDV antibody direct competive ELISA detection kit |
| RU2791614C1 (en) * | 2022-07-12 | 2023-03-13 | Федеральное государственное бюджетное учреждение "Федеральный центр охраны здоровья животных" (ФГБУ "ВНИИЗЖ") | Test system based on liquid phase blocking indirect "sandwich" elisa for determination of antibody titer against fmdv strain o n2047/saudi arabia/2008 genotype o/me-sa/panasia2 in animal blood sera |
Patent Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN105807052B (en) * | 2016-05-13 | 2017-12-15 | 郑州中道生物技术有限公司 | O-shaped FMDV antibody direct competive ELISA detection kit |
| RU2791614C1 (en) * | 2022-07-12 | 2023-03-13 | Федеральное государственное бюджетное учреждение "Федеральный центр охраны здоровья животных" (ФГБУ "ВНИИЗЖ") | Test system based on liquid phase blocking indirect "sandwich" elisa for determination of antibody titer against fmdv strain o n2047/saudi arabia/2008 genotype o/me-sa/panasia2 in animal blood sera |
Non-Patent Citations (1)
| Title |
|---|
| Maree FF, Blignaut B, de Beer TA, Rieder E. Analysis of SAT type foot-and-mouth disease virus capsid proteins and the identification of putative amino acid residues affecting virus stability. PLoS One. 2013 May 22; 8(5): e61612. doi: 10.1371/journal.pone.0061612. PMID: 23717387; PMCID: PMC3661562. * |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| Bolwell et al. | Host cell selection of antigenic variants of foot-and-mouth disease virus | |
| CN102731615A (en) | Detection reagent and detection method for PRRSV | |
| Yang et al. | Generation of monoclonal antibodies against foot‐and‐mouth disease virus SAT 2 and the development of a lateral flow strip test for virus detection | |
| Fowler et al. | Chimeric foot-and-mouth disease viruses: evaluation of their efficacy as potential marker vaccines in cattle | |
| CN105348386B (en) | The monoclonal antibody cocktail and detection kit of the O-shaped virus of resistant to foot and mouth disease | |
| CN105296434B (en) | The monoclonal antibody and application of hybridoma cell strain and its O-shaped virus of the resistant to foot and mouth disease of secretion | |
| CN105296435B (en) | The monoclonal antibody specific and application of hybridoma cell strain and its O-shaped (O/GX/09-7) virus of the resistant to foot and mouth disease of secretion | |
| RU2811996C1 (en) | Test system for determining titer of antibodies against 146s particles of foot-and-mouth disease virus genotype sat-2/iv using elisa liquid-phase | |
| Saiz et al. | Antigenic comparison of different foot-and-mouth disease vims types using monoclonal antibodies defining multiple neutralizing epitopes on FMDV A5 subtypes | |
| Srivastava et al. | Antigenicity of Japanese encephalitis virus envelope glycoprotein V 3 (E) and its cyanogen bromide cleaved fragments examined by monoclonal antibodies and Western blotting | |
| RU2815531C1 (en) | Test system for assay of antibodies to structural proteins of foot-and-mouth disease virus genotype sat-2/vii using liquid-phase blocking indirect “sandwich” version of elisa | |
| RU2821044C1 (en) | Test system for detecting antibodies to structural proteins of foot-and-mouth disease virus strain "sat-1/kenya/2017" using liquid-phase blocking indirect "sandwich" version of elisa | |
| RU2804845C1 (en) | Test system for determining the level of antibodies against the antigen of foot-and-mouth disease virus genotype a/asia/sea-97 using a liquid-phase blocking indirect “sandwich” variant of elisa | |
| RU2818811C1 (en) | Test system for determining titre of antibodies against structural proteins of foot-and-mouth disease virus of "a/tanzania/2013" strain using liquid-phase enzyme immunoassay | |
| RU2825453C1 (en) | Test system for detecting antibodies to structural proteins of strain "sat-2/eritrea/1998" of foot-and-mouth disease virus in liquid-phase enzyme immunoassay | |
| RU2812211C1 (en) | Test system for determining titer of antibodies against structural proteins of asia-1 n 2356/14/2018 foot-and-mouth disease virus strain using liquid-phase blocking indirect "sandwich" version of elisa | |
| RU2798510C1 (en) | Test system for quantitative determination of the level of humoral immunity of animals against the antigen of foot-and-mouth disease virus an 2205/g-iv of a/africa/g-iv genotype using liquid-phase blocking indirect elisa "sandwich" | |
| RU2815540C1 (en) | Test system for determining titre of antibodies against structural proteins of foot and mouth disease virus of no. 2212/primorsky/2014 strain of o/sea/mya-98 genotype in animal blood sera based on liquid-phase blocking indirect “sandwich” version of elisa. | |
| RU2817382C1 (en) | Test system for quantitative detection of antibodies against 146s component of foot-and-mouth disease virus genotype o/ea-3 in animal blood serum based on liquid-phase enzyme immunoassay | |
| RU2812210C1 (en) | Test system based on liquid-phase blocking indirect “sandwich” elisa variant for determining titer of antibodies against foot-and-mouth disease virus strain “o-n2356/pakistan/2018” of genotype o/me-sa/panasia2 ant-10 in animal blood serum | |
| RU2821894C1 (en) | Test system for determining titre of antibodies against complete viral particles of fmd virus "o/kenya/2017" strain using liquid-phase "sandwich" version of elisa | |
| RU2791614C1 (en) | Test system based on liquid phase blocking indirect "sandwich" elisa for determination of antibody titer against fmdv strain o n2047/saudi arabia/2008 genotype o/me-sa/panasia2 in animal blood sera | |
| AU649473B2 (en) | Enterovirus peptides | |
| RU2826730C1 (en) | Strain "sat-2/north african/2012" of aphtae epizooticae foot-and-mouth disease virus of genotype sat-2/vii/ghb-12 for production of biopreparations for diagnosis and specific prevention of foot-and-mouth disease | |
| RU2817257C1 (en) | Sat-2/xiv/2023 strain of foot and mouth disease virus aphtae epizooticae of sat-2/xiv genotype for production of biopreparations for diagnosis and specific prevention of foot-and-mouth disease |