NL7607257A - Televisie-ontvanger met een frequentiesynthese- -afstemschakeling. - Google Patents
Televisie-ontvanger met een frequentiesynthese- -afstemschakeling.Info
- Publication number
- NL7607257A NL7607257A NL7607257A NL7607257A NL7607257A NL 7607257 A NL7607257 A NL 7607257A NL 7607257 A NL7607257 A NL 7607257A NL 7607257 A NL7607257 A NL 7607257A NL 7607257 A NL7607257 A NL 7607257A
- Authority
- NL
- Netherlands
- Prior art keywords
- television receiver
- frequency synthesis
- synthesis tuning
- tuning
- frequency
- Prior art date
Links
Classifications
-
- H—ELECTRICITY
- H03—ELECTRONIC CIRCUITRY
- H03J—TUNING RESONANT CIRCUITS; SELECTING RESONANT CIRCUITS
- H03J1/00—Details of adjusting, driving, indicating, or mechanical control arrangements for resonant circuits in general
- H03J1/02—Indicating arrangements
-
- H—ELECTRICITY
- H03—ELECTRONIC CIRCUITRY
- H03J—TUNING RESONANT CIRCUITS; SELECTING RESONANT CIRCUITS
- H03J5/00—Discontinuous tuning; Selecting predetermined frequencies; Selecting frequency bands with or without continuous tuning in one or more of the bands, e.g. push-button tuning, turret tuner
- H03J5/02—Discontinuous tuning; Selecting predetermined frequencies; Selecting frequency bands with or without continuous tuning in one or more of the bands, e.g. push-button tuning, turret tuner with variable tuning element having a number of predetermined settings and adjustable to a desired one of these settings
- H03J5/0245—Discontinuous tuning using an electrical variable impedance element, e.g. a voltage variable reactive diode, in which no corresponding analogue value either exists or is preset, i.e. the tuning information is only available in a digital form
- H03J5/0272—Discontinuous tuning using an electrical variable impedance element, e.g. a voltage variable reactive diode, in which no corresponding analogue value either exists or is preset, i.e. the tuning information is only available in a digital form the digital values being used to preset a counter or a frequency divider in a phase locked loop, e.g. frequency synthesizer
Landscapes
- Engineering & Computer Science (AREA)
- Computer Hardware Design (AREA)
- Microelectronics & Electronic Packaging (AREA)
- Channel Selection Circuits, Automatic Tuning Circuits (AREA)
- Circuits Of Receivers In General (AREA)
Priority Applications (12)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
NL7607257A NL7607257A (nl) | 1976-07-01 | 1976-07-01 | Televisie-ontvanger met een frequentiesynthese- -afstemschakeling. |
DE19772727182 DE2727182A1 (de) | 1976-07-01 | 1977-06-16 | Fernsehempfaenger mit einer frequenzsyntheseabstimmschaltung |
DK287677A DK287677A (da) | 1976-07-01 | 1977-06-28 | Fjernsynsmodtager med et frekvenssynteseafstemningskredslob |
IT25145/77A IT1086155B (it) | 1976-07-01 | 1977-06-28 | Ricevitore per televisione presentante un circuito sintetizzatore di frequenza/sintonizzatore |
SE7707430A SE7707430L (sv) | 1976-07-01 | 1977-06-28 | Tv-mottagare innefattande en frekvenssyntetisatoravstemningskrets |
FI772000A FI772000A (de) | 1976-07-01 | 1977-06-28 | |
NO772280A NO772280L (no) | 1976-07-01 | 1977-06-28 | Fjernsynsmottager med en frekvenssyntetiserende avstemningskrets |
ES460220A ES460220A1 (es) | 1976-07-01 | 1977-06-29 | Perfeccionamientos introducidos en un receptor de televi- sion. |
AT462377A AT350128B (de) | 1976-07-01 | 1977-06-29 | Fersehempfaenger mit einer frequenzsyntheseab- stimmschaltung |
AU26640/77A AU2664077A (en) | 1976-07-01 | 1977-06-30 | Frequency-synthesizer-tuner |
FR7720246A FR2357105A1 (fr) | 1976-07-01 | 1977-07-01 | Recepteur de television comportant un circuit d'accord operant par synthese de frequence |
JP7895477A JPS535517A (en) | 1976-07-01 | 1977-07-01 | Television receiver |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
NL7607257A NL7607257A (nl) | 1976-07-01 | 1976-07-01 | Televisie-ontvanger met een frequentiesynthese- -afstemschakeling. |
Publications (1)
Publication Number | Publication Date |
---|---|
NL7607257A true NL7607257A (nl) | 1978-01-03 |
Family
ID=19826502
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
NL7607257A NL7607257A (nl) | 1976-07-01 | 1976-07-01 | Televisie-ontvanger met een frequentiesynthese- -afstemschakeling. |
Country Status (12)
Country | Link |
---|---|
JP (1) | JPS535517A (de) |
AT (1) | AT350128B (de) |
AU (1) | AU2664077A (de) |
DE (1) | DE2727182A1 (de) |
DK (1) | DK287677A (de) |
ES (1) | ES460220A1 (de) |
FI (1) | FI772000A (de) |
FR (1) | FR2357105A1 (de) |
IT (1) | IT1086155B (de) |
NL (1) | NL7607257A (de) |
NO (1) | NO772280L (de) |
SE (1) | SE7707430L (de) |
Families Citing this family (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
JPS58159579U (ja) * | 1983-03-01 | 1983-10-24 | 三洋電機株式会社 | 発光ダイオ−ド表示器用のシ−ト |
JPS62170982U (de) * | 1986-04-21 | 1987-10-29 |
Family Cites Families (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
SE322277B (de) * | 1968-03-07 | 1970-04-06 | Aga Ab | |
FR2119206A5 (de) * | 1970-12-23 | 1972-08-04 | Thomson Brandt | |
JPS555729B2 (de) * | 1971-11-29 | 1980-02-08 |
-
1976
- 1976-07-01 NL NL7607257A patent/NL7607257A/xx not_active Application Discontinuation
-
1977
- 1977-06-16 DE DE19772727182 patent/DE2727182A1/de not_active Withdrawn
- 1977-06-28 IT IT25145/77A patent/IT1086155B/it active
- 1977-06-28 NO NO772280A patent/NO772280L/no unknown
- 1977-06-28 DK DK287677A patent/DK287677A/da unknown
- 1977-06-28 FI FI772000A patent/FI772000A/fi not_active Application Discontinuation
- 1977-06-28 SE SE7707430A patent/SE7707430L/xx unknown
- 1977-06-29 ES ES460220A patent/ES460220A1/es not_active Expired
- 1977-06-29 AT AT462377A patent/AT350128B/de not_active IP Right Cessation
- 1977-06-30 AU AU26640/77A patent/AU2664077A/en active Pending
- 1977-07-01 JP JP7895477A patent/JPS535517A/ja active Pending
- 1977-07-01 FR FR7720246A patent/FR2357105A1/fr not_active Withdrawn
Also Published As
Publication number | Publication date |
---|---|
NO772280L (no) | 1978-01-03 |
DE2727182A1 (de) | 1978-01-12 |
JPS535517A (en) | 1978-01-19 |
SE7707430L (sv) | 1978-01-02 |
ATA462377A (de) | 1978-10-15 |
ES460220A1 (es) | 1978-04-01 |
IT1086155B (it) | 1985-05-28 |
AU2664077A (en) | 1979-01-04 |
DK287677A (da) | 1978-01-02 |
FR2357105A1 (fr) | 1978-01-27 |
FI772000A (de) | 1978-01-02 |
AT350128B (de) | 1979-05-10 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
NL7703657A (nl) | Afstemeenheid voor een televisie-ontvanger. | |
NL7710046A (nl) | Radio-ontvanger. | |
AU511982B2 (en) | Receiver tuning | |
NL169008C (nl) | Ontvanger bevattende een afstemschakeling met een zenderzoekinrichting. | |
NL7414564A (nl) | Radio- of televisieontvanger met een zender- zoekinrichting. | |
NL179435C (nl) | Ontvanger met een frequentiesynthese-schakeling. | |
NL7706484A (nl) | Televisie-ontvanger. | |
NL7706483A (nl) | Televisie-ontvanger. | |
NL7810803A (nl) | Afstemstelsel voor een televisieontvanger. | |
NL188065C (nl) | Afsteminrichting voor een televisie-ontvanger. | |
NL189105C (nl) | Afstemschakeling voor een televisie-ontvanger. | |
NL188196C (nl) | Radio-ontvanger. | |
NL7714368A (nl) | Afstemregeleenheid voor een radio-ontvanger. | |
AU517078B2 (en) | Dual pll receiver tuning | |
NL7703908A (nl) | Radio-ontvanger. | |
NL183428B (nl) | Televisieontvanger met een synchrone detectieschakeling en een frequentieafwijkings-detectieschakeling. | |
NL7607257A (nl) | Televisie-ontvanger met een frequentiesynthese- -afstemschakeling. | |
NL189021C (nl) | Televisie-afsteminrichting. | |
NL7712590A (nl) | Televisieontvanger. | |
NL7612700A (nl) | Antenne-afsteminrichting. | |
NL7712436A (nl) | Televisieontvanger. | |
AU2451377A (en) | Receiver tuning | |
IT1087136B (it) | Ricevitore radio o televisivo | |
AU2278577A (en) | Digital receiver tuning | |
NL7402624A (nl) | Ontvangerafstemschakeling. |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
BV | The patent application has lapsed |