NL7607257A - Televisie-ontvanger met een frequentiesynthese- -afstemschakeling. - Google Patents

Televisie-ontvanger met een frequentiesynthese- -afstemschakeling.

Info

Publication number
NL7607257A
NL7607257A NL7607257A NL7607257A NL7607257A NL 7607257 A NL7607257 A NL 7607257A NL 7607257 A NL7607257 A NL 7607257A NL 7607257 A NL7607257 A NL 7607257A NL 7607257 A NL7607257 A NL 7607257A
Authority
NL
Netherlands
Prior art keywords
television receiver
frequency synthesis
synthesis tuning
tuning
frequency
Prior art date
Application number
NL7607257A
Other languages
English (en)
Dutch (nl)
Original Assignee
Philips Nv
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Philips Nv filed Critical Philips Nv
Priority to NL7607257A priority Critical patent/NL7607257A/xx
Priority to DE19772727182 priority patent/DE2727182A1/de
Priority to FI772000A priority patent/FI772000A/fi
Priority to SE7707430A priority patent/SE7707430L/xx
Priority to NO772280A priority patent/NO772280L/no
Priority to IT25145/77A priority patent/IT1086155B/it
Priority to DK287677A priority patent/DK287677A/da
Priority to AT462377A priority patent/AT350128B/de
Priority to ES460220A priority patent/ES460220A1/es
Priority to AU26640/77A priority patent/AU2664077A/en
Priority to JP7895477A priority patent/JPS535517A/ja
Priority to FR7720246A priority patent/FR2357105A1/fr
Publication of NL7607257A publication Critical patent/NL7607257A/xx

Links

Classifications

    • H—ELECTRICITY
    • H03—ELECTRONIC CIRCUITRY
    • H03J—TUNING RESONANT CIRCUITS; SELECTING RESONANT CIRCUITS
    • H03J1/00—Details of adjusting, driving, indicating, or mechanical control arrangements for resonant circuits in general
    • H03J1/02—Indicating arrangements
    • H—ELECTRICITY
    • H03—ELECTRONIC CIRCUITRY
    • H03J—TUNING RESONANT CIRCUITS; SELECTING RESONANT CIRCUITS
    • H03J5/00—Discontinuous tuning; Selecting predetermined frequencies; Selecting frequency bands with or without continuous tuning in one or more of the bands, e.g. push-button tuning, turret tuner
    • H03J5/02—Discontinuous tuning; Selecting predetermined frequencies; Selecting frequency bands with or without continuous tuning in one or more of the bands, e.g. push-button tuning, turret tuner with variable tuning element having a number of predetermined settings and adjustable to a desired one of these settings
    • H03J5/0245—Discontinuous tuning using an electrical variable impedance element, e.g. a voltage variable reactive diode, in which no corresponding analogue value either exists or is preset, i.e. the tuning information is only available in a digital form
    • H03J5/0272—Discontinuous tuning using an electrical variable impedance element, e.g. a voltage variable reactive diode, in which no corresponding analogue value either exists or is preset, i.e. the tuning information is only available in a digital form the digital values being used to preset a counter or a frequency divider in a phase locked loop, e.g. frequency synthesizer

Landscapes

  • Engineering & Computer Science (AREA)
  • Computer Hardware Design (AREA)
  • Microelectronics & Electronic Packaging (AREA)
  • Channel Selection Circuits, Automatic Tuning Circuits (AREA)
  • Circuits Of Receivers In General (AREA)
NL7607257A 1976-07-01 1976-07-01 Televisie-ontvanger met een frequentiesynthese- -afstemschakeling. NL7607257A (nl)

Priority Applications (12)

Application Number Priority Date Filing Date Title
NL7607257A NL7607257A (nl) 1976-07-01 1976-07-01 Televisie-ontvanger met een frequentiesynthese- -afstemschakeling.
DE19772727182 DE2727182A1 (de) 1976-07-01 1977-06-16 Fernsehempfaenger mit einer frequenzsyntheseabstimmschaltung
FI772000A FI772000A (xx) 1976-07-01 1977-06-28
SE7707430A SE7707430L (sv) 1976-07-01 1977-06-28 Tv-mottagare innefattande en frekvenssyntetisatoravstemningskrets
NO772280A NO772280L (no) 1976-07-01 1977-06-28 Fjernsynsmottager med en frekvenssyntetiserende avstemningskrets
IT25145/77A IT1086155B (it) 1976-07-01 1977-06-28 Ricevitore per televisione presentante un circuito sintetizzatore di frequenza/sintonizzatore
DK287677A DK287677A (da) 1976-07-01 1977-06-28 Fjernsynsmodtager med et frekvenssynteseafstemningskredslob
AT462377A AT350128B (de) 1976-07-01 1977-06-29 Fersehempfaenger mit einer frequenzsyntheseab- stimmschaltung
ES460220A ES460220A1 (es) 1976-07-01 1977-06-29 Perfeccionamientos introducidos en un receptor de televi- sion.
AU26640/77A AU2664077A (en) 1976-07-01 1977-06-30 Frequency-synthesizer-tuner
JP7895477A JPS535517A (en) 1976-07-01 1977-07-01 Television receiver
FR7720246A FR2357105A1 (fr) 1976-07-01 1977-07-01 Recepteur de television comportant un circuit d'accord operant par synthese de frequence

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
NL7607257A NL7607257A (nl) 1976-07-01 1976-07-01 Televisie-ontvanger met een frequentiesynthese- -afstemschakeling.

Publications (1)

Publication Number Publication Date
NL7607257A true NL7607257A (nl) 1978-01-03

Family

ID=19826502

Family Applications (1)

Application Number Title Priority Date Filing Date
NL7607257A NL7607257A (nl) 1976-07-01 1976-07-01 Televisie-ontvanger met een frequentiesynthese- -afstemschakeling.

Country Status (12)

Country Link
JP (1) JPS535517A (xx)
AT (1) AT350128B (xx)
AU (1) AU2664077A (xx)
DE (1) DE2727182A1 (xx)
DK (1) DK287677A (xx)
ES (1) ES460220A1 (xx)
FI (1) FI772000A (xx)
FR (1) FR2357105A1 (xx)
IT (1) IT1086155B (xx)
NL (1) NL7607257A (xx)
NO (1) NO772280L (xx)
SE (1) SE7707430L (xx)

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JPS58159579U (ja) * 1983-03-01 1983-10-24 三洋電機株式会社 発光ダイオ−ド表示器用のシ−ト
JPS62170982U (xx) * 1986-04-21 1987-10-29

Family Cites Families (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
SE322277B (xx) * 1968-03-07 1970-04-06 Aga Ab
FR2119206A5 (xx) * 1970-12-23 1972-08-04 Thomson Brandt
JPS555729B2 (xx) * 1971-11-29 1980-02-08

Also Published As

Publication number Publication date
DE2727182A1 (de) 1978-01-12
JPS535517A (en) 1978-01-19
SE7707430L (sv) 1978-01-02
FI772000A (xx) 1978-01-02
ATA462377A (de) 1978-10-15
AT350128B (de) 1979-05-10
IT1086155B (it) 1985-05-28
AU2664077A (en) 1979-01-04
ES460220A1 (es) 1978-04-01
FR2357105A1 (fr) 1978-01-27
DK287677A (da) 1978-01-02
NO772280L (no) 1978-01-03

Similar Documents

Publication Publication Date Title
NL7703657A (nl) Afstemeenheid voor een televisie-ontvanger.
NL7710046A (nl) Radio-ontvanger.
AU511982B2 (en) Receiver tuning
NL169008C (nl) Ontvanger bevattende een afstemschakeling met een zenderzoekinrichting.
NL7414564A (nl) Radio- of televisieontvanger met een zender- zoekinrichting.
NL179435C (nl) Ontvanger met een frequentiesynthese-schakeling.
NL7706484A (nl) Televisie-ontvanger.
NL7706483A (nl) Televisie-ontvanger.
NL7810803A (nl) Afstemstelsel voor een televisieontvanger.
NL188065C (nl) Afsteminrichting voor een televisie-ontvanger.
NL189105C (nl) Afstemschakeling voor een televisie-ontvanger.
NL188196C (nl) Radio-ontvanger.
NL7714368A (nl) Afstemregeleenheid voor een radio-ontvanger.
AU517078B2 (en) Dual pll receiver tuning
NL7703908A (nl) Radio-ontvanger.
NL183428B (nl) Televisieontvanger met een synchrone detectieschakeling en een frequentieafwijkings-detectieschakeling.
NL7607257A (nl) Televisie-ontvanger met een frequentiesynthese- -afstemschakeling.
NL189021C (nl) Televisie-afsteminrichting.
NL7712590A (nl) Televisieontvanger.
NL7612700A (nl) Antenne-afsteminrichting.
NL7712436A (nl) Televisieontvanger.
AU512370B2 (en) Receiver tuning
IT1087136B (it) Ricevitore radio o televisivo
NL7402624A (nl) Ontvangerafstemschakeling.
JPS5319707A (en) Double band automatic tuning receiver

Legal Events

Date Code Title Description
BV The patent application has lapsed