KR20240101987A - 클라우딘-18.2에 특이적으로 결합하는 단클론항체 및 이의 용도 - Google Patents
클라우딘-18.2에 특이적으로 결합하는 단클론항체 및 이의 용도 Download PDFInfo
- Publication number
- KR20240101987A KR20240101987A KR1020220182621A KR20220182621A KR20240101987A KR 20240101987 A KR20240101987 A KR 20240101987A KR 1020220182621 A KR1020220182621 A KR 1020220182621A KR 20220182621 A KR20220182621 A KR 20220182621A KR 20240101987 A KR20240101987 A KR 20240101987A
- Authority
- KR
- South Korea
- Prior art keywords
- antigen
- seq
- antibody
- monoclonal antibody
- claudin
- Prior art date
Links
- 206010028980 Neoplasm Diseases 0.000 claims abstract description 45
- 201000011510 cancer Diseases 0.000 claims abstract description 42
- 108010019670 Chimeric Antigen Receptors Proteins 0.000 claims abstract description 21
- 108050009324 Claudin-18 Proteins 0.000 claims abstract description 12
- 102000002038 Claudin-18 Human genes 0.000 claims abstract description 11
- 239000000611 antibody drug conjugate Substances 0.000 claims abstract description 10
- 229940049595 antibody-drug conjugate Drugs 0.000 claims abstract description 10
- 108091007433 antigens Proteins 0.000 claims description 101
- 102000036639 antigens Human genes 0.000 claims description 101
- 239000000427 antigen Substances 0.000 claims description 100
- 239000012634 fragment Substances 0.000 claims description 61
- 239000000203 mixture Substances 0.000 claims description 30
- 238000000034 method Methods 0.000 claims description 29
- 239000008194 pharmaceutical composition Substances 0.000 claims description 18
- 108010047041 Complementarity Determining Regions Proteins 0.000 claims description 17
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 claims description 15
- 239000003814 drug Substances 0.000 claims description 15
- 108091033319 polynucleotide Proteins 0.000 claims description 14
- 102000040430 polynucleotide Human genes 0.000 claims description 14
- 239000002157 polynucleotide Substances 0.000 claims description 14
- 229940079593 drug Drugs 0.000 claims description 12
- 239000013604 expression vector Substances 0.000 claims description 12
- 239000002246 antineoplastic agent Substances 0.000 claims description 10
- 230000004068 intracellular signaling Effects 0.000 claims description 9
- 239000004480 active ingredient Substances 0.000 claims description 8
- 239000001963 growth medium Substances 0.000 claims description 7
- 241000282412 Homo Species 0.000 claims description 6
- 230000006044 T cell activation Effects 0.000 claims description 6
- 238000012258 culturing Methods 0.000 claims description 5
- 206010027406 Mesothelioma Diseases 0.000 claims description 4
- 208000005718 Stomach Neoplasms Diseases 0.000 claims description 4
- 206010017758 gastric cancer Diseases 0.000 claims description 4
- 201000011549 stomach cancer Diseases 0.000 claims description 4
- 206010006187 Breast cancer Diseases 0.000 claims description 3
- 208000026310 Breast neoplasm Diseases 0.000 claims description 3
- 229940076838 Immune checkpoint inhibitor Drugs 0.000 claims description 3
- 102000037984 Inhibitory immune checkpoint proteins Human genes 0.000 claims description 3
- 108091008026 Inhibitory immune checkpoint proteins Proteins 0.000 claims description 3
- 208000008839 Kidney Neoplasms Diseases 0.000 claims description 3
- 206010061902 Pancreatic neoplasm Diseases 0.000 claims description 3
- 206010038389 Renal cancer Diseases 0.000 claims description 3
- 201000009036 biliary tract cancer Diseases 0.000 claims description 3
- 208000020790 biliary tract neoplasm Diseases 0.000 claims description 3
- 239000012829 chemotherapy agent Substances 0.000 claims description 3
- 239000012274 immune-checkpoint protein inhibitor Substances 0.000 claims description 3
- 201000010982 kidney cancer Diseases 0.000 claims description 3
- 201000007270 liver cancer Diseases 0.000 claims description 3
- 208000014018 liver neoplasm Diseases 0.000 claims description 3
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 claims description 3
- 201000002528 pancreatic cancer Diseases 0.000 claims description 3
- 208000008443 pancreatic carcinoma Diseases 0.000 claims description 3
- 206010009944 Colon cancer Diseases 0.000 claims description 2
- 208000000461 Esophageal Neoplasms Diseases 0.000 claims description 2
- 206010058467 Lung neoplasm malignant Diseases 0.000 claims description 2
- 206010030155 Oesophageal carcinoma Diseases 0.000 claims description 2
- 206010033128 Ovarian cancer Diseases 0.000 claims description 2
- 206010061535 Ovarian neoplasm Diseases 0.000 claims description 2
- 208000029742 colonic neoplasm Diseases 0.000 claims description 2
- 201000004101 esophageal cancer Diseases 0.000 claims description 2
- 201000010536 head and neck cancer Diseases 0.000 claims description 2
- 208000014829 head and neck neoplasm Diseases 0.000 claims description 2
- 201000005202 lung cancer Diseases 0.000 claims description 2
- 208000020816 lung neoplasm Diseases 0.000 claims description 2
- 125000003275 alpha amino acid group Chemical group 0.000 claims 9
- 238000011282 treatment Methods 0.000 abstract description 12
- 238000011161 development Methods 0.000 abstract description 2
- 210000004027 cell Anatomy 0.000 description 110
- 108090000623 proteins and genes Proteins 0.000 description 22
- 239000013598 vector Substances 0.000 description 22
- 150000001413 amino acids Chemical class 0.000 description 20
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 19
- 239000002953 phosphate buffered saline Substances 0.000 description 19
- 102000004169 proteins and genes Human genes 0.000 description 16
- 230000014509 gene expression Effects 0.000 description 15
- 235000018102 proteins Nutrition 0.000 description 14
- 238000004458 analytical method Methods 0.000 description 10
- 230000003834 intracellular effect Effects 0.000 description 10
- 238000012360 testing method Methods 0.000 description 10
- 102000004190 Enzymes Human genes 0.000 description 9
- 108090000790 Enzymes Proteins 0.000 description 9
- 239000002202 Polyethylene glycol Substances 0.000 description 9
- 229940088598 enzyme Drugs 0.000 description 9
- 239000012091 fetal bovine serum Substances 0.000 description 9
- 238000000684 flow cytometry Methods 0.000 description 9
- 229920001223 polyethylene glycol Polymers 0.000 description 9
- 239000000243 solution Substances 0.000 description 9
- 239000000126 substance Substances 0.000 description 9
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 description 8
- 230000000694 effects Effects 0.000 description 8
- 230000006870 function Effects 0.000 description 8
- -1 etc. Substances 0.000 description 7
- 230000006320 pegylation Effects 0.000 description 7
- 238000002965 ELISA Methods 0.000 description 6
- 108010029485 Protein Isoforms Proteins 0.000 description 6
- 102000001708 Protein Isoforms Human genes 0.000 description 6
- 238000009472 formulation Methods 0.000 description 6
- 230000013595 glycosylation Effects 0.000 description 6
- 238000006206 glycosylation reaction Methods 0.000 description 6
- 238000004519 manufacturing process Methods 0.000 description 6
- 210000001519 tissue Anatomy 0.000 description 6
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 5
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 5
- 108010084592 Saporins Proteins 0.000 description 5
- 238000003556 assay Methods 0.000 description 5
- 239000012472 biological sample Substances 0.000 description 5
- 230000001413 cellular effect Effects 0.000 description 5
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 5
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 5
- 239000000523 sample Substances 0.000 description 5
- 238000005406 washing Methods 0.000 description 5
- 102100040835 Claudin-18 Human genes 0.000 description 4
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 4
- 101000749329 Homo sapiens Claudin-18 Proteins 0.000 description 4
- 101000851370 Homo sapiens Tumor necrosis factor receptor superfamily member 9 Proteins 0.000 description 4
- 102100022153 Tumor necrosis factor receptor superfamily member 4 Human genes 0.000 description 4
- 102100036856 Tumor necrosis factor receptor superfamily member 9 Human genes 0.000 description 4
- 235000001014 amino acid Nutrition 0.000 description 4
- 229940024606 amino acid Drugs 0.000 description 4
- 238000006243 chemical reaction Methods 0.000 description 4
- 239000003153 chemical reaction reagent Substances 0.000 description 4
- 150000001875 compounds Chemical class 0.000 description 4
- 231100000433 cytotoxic Toxicity 0.000 description 4
- 230000001472 cytotoxic effect Effects 0.000 description 4
- 201000010099 disease Diseases 0.000 description 4
- 239000003937 drug carrier Substances 0.000 description 4
- 210000001163 endosome Anatomy 0.000 description 4
- 210000003527 eukaryotic cell Anatomy 0.000 description 4
- 238000002347 injection Methods 0.000 description 4
- 239000007924 injection Substances 0.000 description 4
- 238000002372 labelling Methods 0.000 description 4
- 108090000765 processed proteins & peptides Proteins 0.000 description 4
- 108700012359 toxins Proteins 0.000 description 4
- 102100023990 60S ribosomal protein L17 Human genes 0.000 description 3
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 3
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 3
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 3
- 102100032937 CD40 ligand Human genes 0.000 description 3
- 102000002029 Claudin Human genes 0.000 description 3
- 108050009302 Claudin Proteins 0.000 description 3
- 108091026890 Coding region Proteins 0.000 description 3
- 108020004705 Codon Proteins 0.000 description 3
- 102000008130 Cyclic AMP-Dependent Protein Kinases Human genes 0.000 description 3
- 108010049894 Cyclic AMP-Dependent Protein Kinases Proteins 0.000 description 3
- 241000588724 Escherichia coli Species 0.000 description 3
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 3
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- 101000914514 Homo sapiens T-cell-specific surface glycoprotein CD28 Proteins 0.000 description 3
- 101000666896 Homo sapiens V-type immunoglobulin domain-containing suppressor of T-cell activation Proteins 0.000 description 3
- 241000725303 Human immunodeficiency virus Species 0.000 description 3
- 102100029193 Low affinity immunoglobulin gamma Fc region receptor III-A Human genes 0.000 description 3
- 241001465754 Metazoa Species 0.000 description 3
- NWIBSHFKIJFRCO-WUDYKRTCSA-N Mytomycin Chemical compound C1N2C(C(C(C)=C(N)C3=O)=O)=C3[C@@H](COC(N)=O)[C@@]2(OC)[C@@H]2[C@H]1N2 NWIBSHFKIJFRCO-WUDYKRTCSA-N 0.000 description 3
- 229920001213 Polysorbate 20 Polymers 0.000 description 3
- 101710089372 Programmed cell death protein 1 Proteins 0.000 description 3
- 238000011529 RT qPCR Methods 0.000 description 3
- 108091081024 Start codon Proteins 0.000 description 3
- 102100027213 T-cell-specific surface glycoprotein CD28 Human genes 0.000 description 3
- 102100038282 V-type immunoglobulin domain-containing suppressor of T-cell activation Human genes 0.000 description 3
- 229940041181 antineoplastic drug Drugs 0.000 description 3
- 230000015572 biosynthetic process Effects 0.000 description 3
- 210000004369 blood Anatomy 0.000 description 3
- 239000008280 blood Substances 0.000 description 3
- 230000003833 cell viability Effects 0.000 description 3
- 239000003795 chemical substances by application Substances 0.000 description 3
- 230000000139 costimulatory effect Effects 0.000 description 3
- 230000003013 cytotoxicity Effects 0.000 description 3
- 231100000135 cytotoxicity Toxicity 0.000 description 3
- 229960004679 doxorubicin Drugs 0.000 description 3
- 238000005516 engineering process Methods 0.000 description 3
- 210000000981 epithelium Anatomy 0.000 description 3
- IJJVMEJXYNJXOJ-UHFFFAOYSA-N fluquinconazole Chemical compound C=1C=C(Cl)C=C(Cl)C=1N1C(=O)C2=CC(F)=CC=C2N=C1N1C=NC=N1 IJJVMEJXYNJXOJ-UHFFFAOYSA-N 0.000 description 3
- 238000003018 immunoassay Methods 0.000 description 3
- 230000001965 increasing effect Effects 0.000 description 3
- 239000003112 inhibitor Substances 0.000 description 3
- 210000003712 lysosome Anatomy 0.000 description 3
- 230000001868 lysosomic effect Effects 0.000 description 3
- 239000002609 medium Substances 0.000 description 3
- 238000002844 melting Methods 0.000 description 3
- 230000008018 melting Effects 0.000 description 3
- 230000004048 modification Effects 0.000 description 3
- 238000012986 modification Methods 0.000 description 3
- 102000039446 nucleic acids Human genes 0.000 description 3
- 108020004707 nucleic acids Proteins 0.000 description 3
- 150000007523 nucleic acids Chemical class 0.000 description 3
- 230000002018 overexpression Effects 0.000 description 3
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 3
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 3
- 238000001556 precipitation Methods 0.000 description 3
- 230000008569 process Effects 0.000 description 3
- 102000004196 processed proteins & peptides Human genes 0.000 description 3
- 239000000829 suppository Substances 0.000 description 3
- 230000004083 survival effect Effects 0.000 description 3
- 239000000725 suspension Substances 0.000 description 3
- 239000003826 tablet Substances 0.000 description 3
- 229940124597 therapeutic agent Drugs 0.000 description 3
- 239000003053 toxin Substances 0.000 description 3
- 231100000765 toxin Toxicity 0.000 description 3
- 230000009466 transformation Effects 0.000 description 3
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 2
- OZFAFGSSMRRTDW-UHFFFAOYSA-N (2,4-dichlorophenyl) benzenesulfonate Chemical compound ClC1=CC(Cl)=CC=C1OS(=O)(=O)C1=CC=CC=C1 OZFAFGSSMRRTDW-UHFFFAOYSA-N 0.000 description 2
- GEYOCULIXLDCMW-UHFFFAOYSA-N 1,2-phenylenediamine Chemical compound NC1=CC=CC=C1N GEYOCULIXLDCMW-UHFFFAOYSA-N 0.000 description 2
- PKYCWFICOKSIHZ-UHFFFAOYSA-N 1-(3,7-dihydroxyphenoxazin-10-yl)ethanone Chemical compound OC1=CC=C2N(C(=O)C)C3=CC=C(O)C=C3OC2=C1 PKYCWFICOKSIHZ-UHFFFAOYSA-N 0.000 description 2
- STQGQHZAVUOBTE-UHFFFAOYSA-N 7-Cyan-hept-2t-en-4,6-diinsaeure Natural products C1=2C(O)=C3C(=O)C=4C(OC)=CC=CC=4C(=O)C3=C(O)C=2CC(O)(C(C)=O)CC1OC1CC(N)C(O)C(C)O1 STQGQHZAVUOBTE-UHFFFAOYSA-N 0.000 description 2
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 2
- 102100029822 B- and T-lymphocyte attenuator Human genes 0.000 description 2
- 102100038080 B-cell receptor CD22 Human genes 0.000 description 2
- 108010074708 B7-H1 Antigen Proteins 0.000 description 2
- 102100038077 CD226 antigen Human genes 0.000 description 2
- 102100027207 CD27 antigen Human genes 0.000 description 2
- 101710185679 CD276 antigen Proteins 0.000 description 2
- 108010021064 CTLA-4 Antigen Proteins 0.000 description 2
- 229940045513 CTLA4 antagonist Drugs 0.000 description 2
- 102000002004 Cytochrome P-450 Enzyme System Human genes 0.000 description 2
- 108010015742 Cytochrome P-450 Enzyme System Proteins 0.000 description 2
- 241000701022 Cytomegalovirus Species 0.000 description 2
- 102100039498 Cytotoxic T-lymphocyte protein 4 Human genes 0.000 description 2
- 108020004414 DNA Proteins 0.000 description 2
- 239000012591 Dulbecco’s Phosphate Buffered Saline Substances 0.000 description 2
- 241000196324 Embryophyta Species 0.000 description 2
- 102100034458 Hepatitis A virus cellular receptor 2 Human genes 0.000 description 2
- 102100026122 High affinity immunoglobulin gamma Fc receptor I Human genes 0.000 description 2
- 101000864344 Homo sapiens B- and T-lymphocyte attenuator Proteins 0.000 description 2
- 101000884305 Homo sapiens B-cell receptor CD22 Proteins 0.000 description 2
- 101000884298 Homo sapiens CD226 antigen Proteins 0.000 description 2
- 101000914511 Homo sapiens CD27 antigen Proteins 0.000 description 2
- 101000913074 Homo sapiens High affinity immunoglobulin gamma Fc receptor I Proteins 0.000 description 2
- 101000917858 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-A Proteins 0.000 description 2
- 101000917839 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-B Proteins 0.000 description 2
- 101000831007 Homo sapiens T-cell immunoreceptor with Ig and ITIM domains Proteins 0.000 description 2
- 101000801234 Homo sapiens Tumor necrosis factor receptor superfamily member 18 Proteins 0.000 description 2
- 101000851376 Homo sapiens Tumor necrosis factor receptor superfamily member 8 Proteins 0.000 description 2
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 2
- 241000701044 Human gammaherpesvirus 4 Species 0.000 description 2
- 108060003951 Immunoglobulin Proteins 0.000 description 2
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 2
- 108010009254 Lysosomal-Associated Membrane Protein 1 Proteins 0.000 description 2
- 102100035133 Lysosome-associated membrane glycoprotein 1 Human genes 0.000 description 2
- 241000829100 Macaca mulatta polyomavirus 1 Species 0.000 description 2
- 241000124008 Mammalia Species 0.000 description 2
- 108010052285 Membrane Proteins Proteins 0.000 description 2
- 229910019142 PO4 Inorganic materials 0.000 description 2
- 229930012538 Paclitaxel Natural products 0.000 description 2
- 102100024216 Programmed cell death 1 ligand 1 Human genes 0.000 description 2
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 2
- 235000014680 Saccharomyces cerevisiae Nutrition 0.000 description 2
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 2
- 102100024834 T-cell immunoreceptor with Ig and ITIM domains Human genes 0.000 description 2
- 210000001744 T-lymphocyte Anatomy 0.000 description 2
- 102100033728 Tumor necrosis factor receptor superfamily member 18 Human genes 0.000 description 2
- 101710165473 Tumor necrosis factor receptor superfamily member 4 Proteins 0.000 description 2
- 102100036857 Tumor necrosis factor receptor superfamily member 8 Human genes 0.000 description 2
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 2
- 238000002835 absorbance Methods 0.000 description 2
- RJURFGZVJUQBHK-UHFFFAOYSA-N actinomycin D Natural products CC1OC(=O)C(C(C)C)N(C)C(=O)CN(C)C(=O)C2CCCN2C(=O)C(C(C)C)NC(=O)C1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=CC=C3C(=O)NC4C(=O)NC(C(N5CCCC5C(=O)N(C)CC(=O)N(C)C(C(C)C)C(=O)OC4C)=O)C(C)C)=C3N=C21 RJURFGZVJUQBHK-UHFFFAOYSA-N 0.000 description 2
- 239000000654 additive Substances 0.000 description 2
- 239000000443 aerosol Substances 0.000 description 2
- 229940045799 anthracyclines and related substance Drugs 0.000 description 2
- 239000003242 anti bacterial agent Substances 0.000 description 2
- 230000001093 anti-cancer Effects 0.000 description 2
- 229940088710 antibiotic agent Drugs 0.000 description 2
- 230000001580 bacterial effect Effects 0.000 description 2
- 230000008901 benefit Effects 0.000 description 2
- 108010005774 beta-Galactosidase Proteins 0.000 description 2
- 102000005936 beta-Galactosidase Human genes 0.000 description 2
- 239000011230 binding agent Substances 0.000 description 2
- 230000004071 biological effect Effects 0.000 description 2
- 229960000074 biopharmaceutical Drugs 0.000 description 2
- 230000000903 blocking effect Effects 0.000 description 2
- XJMXIWNOKIEIMX-UHFFFAOYSA-N bromo chloro 1h-indol-2-yl phosphate Chemical group C1=CC=C2NC(OP(=O)(OBr)OCl)=CC2=C1 XJMXIWNOKIEIMX-UHFFFAOYSA-N 0.000 description 2
- 239000000872 buffer Substances 0.000 description 2
- 239000001506 calcium phosphate Substances 0.000 description 2
- 239000002775 capsule Substances 0.000 description 2
- YCIMNLLNPGFGHC-UHFFFAOYSA-N catechol Chemical compound OC1=CC=CC=C1O YCIMNLLNPGFGHC-UHFFFAOYSA-N 0.000 description 2
- 239000011248 coating agent Substances 0.000 description 2
- 238000000576 coating method Methods 0.000 description 2
- 230000001268 conjugating effect Effects 0.000 description 2
- 239000006059 cover glass Substances 0.000 description 2
- CVSVTCORWBXHQV-UHFFFAOYSA-N creatine Chemical compound NC(=[NH2+])N(C)CC([O-])=O CVSVTCORWBXHQV-UHFFFAOYSA-N 0.000 description 2
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 2
- 230000001461 cytolytic effect Effects 0.000 description 2
- 229940127089 cytotoxic agent Drugs 0.000 description 2
- STQGQHZAVUOBTE-VGBVRHCVSA-N daunorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(C)=O)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 STQGQHZAVUOBTE-VGBVRHCVSA-N 0.000 description 2
- 238000002022 differential scanning fluorescence spectroscopy Methods 0.000 description 2
- 230000029087 digestion Effects 0.000 description 2
- 239000003085 diluting agent Substances 0.000 description 2
- 239000000839 emulsion Substances 0.000 description 2
- 230000012202 endocytosis Effects 0.000 description 2
- VJJPUSNTGOMMGY-MRVIYFEKSA-N etoposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@H](C)OC[C@H]4O3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 VJJPUSNTGOMMGY-MRVIYFEKSA-N 0.000 description 2
- 229960005420 etoposide Drugs 0.000 description 2
- 238000002474 experimental method Methods 0.000 description 2
- 238000002866 fluorescence resonance energy transfer Methods 0.000 description 2
- 230000004927 fusion Effects 0.000 description 2
- 230000002068 genetic effect Effects 0.000 description 2
- 125000003147 glycosyl group Chemical group 0.000 description 2
- 239000008187 granular material Substances 0.000 description 2
- 210000004408 hybridoma Anatomy 0.000 description 2
- 239000012642 immune effector Substances 0.000 description 2
- 230000028993 immune response Effects 0.000 description 2
- 102000018358 immunoglobulin Human genes 0.000 description 2
- 229940099472 immunoglobulin a Drugs 0.000 description 2
- 229940121354 immunomodulator Drugs 0.000 description 2
- 230000001939 inductive effect Effects 0.000 description 2
- 230000002401 inhibitory effect Effects 0.000 description 2
- 230000005764 inhibitory process Effects 0.000 description 2
- 239000000314 lubricant Substances 0.000 description 2
- KNJDBYZZKAZQNG-UHFFFAOYSA-N lucigenin Chemical compound [O-][N+]([O-])=O.[O-][N+]([O-])=O.C12=CC=CC=C2[N+](C)=C(C=CC=C2)C2=C1C1=C(C=CC=C2)C2=[N+](C)C2=CC=CC=C12 KNJDBYZZKAZQNG-UHFFFAOYSA-N 0.000 description 2
- 210000004072 lung Anatomy 0.000 description 2
- 230000014759 maintenance of location Effects 0.000 description 2
- 239000003550 marker Substances 0.000 description 2
- 230000001404 mediated effect Effects 0.000 description 2
- SGDBTWWWUNNDEQ-LBPRGKRZSA-N melphalan Chemical compound OC(=O)[C@@H](N)CC1=CC=C(N(CCCl)CCCl)C=C1 SGDBTWWWUNNDEQ-LBPRGKRZSA-N 0.000 description 2
- 229960001924 melphalan Drugs 0.000 description 2
- 210000004379 membrane Anatomy 0.000 description 2
- 239000012528 membrane Substances 0.000 description 2
- 108091070501 miRNA Proteins 0.000 description 2
- 239000002679 microRNA Substances 0.000 description 2
- 229960004857 mitomycin Drugs 0.000 description 2
- 239000002105 nanoparticle Substances 0.000 description 2
- JPXMTWWFLBLUCD-UHFFFAOYSA-N nitro blue tetrazolium(2+) Chemical compound COC1=CC(C=2C=C(OC)C(=CC=2)[N+]=2N(N=C(N=2)C=2C=CC=CC=2)C=2C=CC(=CC=2)[N+]([O-])=O)=CC=C1[N+]1=NC(C=2C=CC=CC=2)=NN1C1=CC=C([N+]([O-])=O)C=C1 JPXMTWWFLBLUCD-UHFFFAOYSA-N 0.000 description 2
- 229960001592 paclitaxel Drugs 0.000 description 2
- 239000010452 phosphate Substances 0.000 description 2
- 239000000843 powder Substances 0.000 description 2
- 238000003672 processing method Methods 0.000 description 2
- 210000001236 prokaryotic cell Anatomy 0.000 description 2
- 239000001397 quillaja saponaria molina bark Substances 0.000 description 2
- 102000005962 receptors Human genes 0.000 description 2
- 108020003175 receptors Proteins 0.000 description 2
- 230000006798 recombination Effects 0.000 description 2
- 230000004044 response Effects 0.000 description 2
- 229930182490 saponin Natural products 0.000 description 2
- 150000007949 saponins Chemical class 0.000 description 2
- 230000028327 secretion Effects 0.000 description 2
- 235000020183 skimmed milk Nutrition 0.000 description 2
- 239000000758 substrate Substances 0.000 description 2
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 description 2
- 230000001225 therapeutic effect Effects 0.000 description 2
- 108091005703 transmembrane proteins Proteins 0.000 description 2
- 102000035160 transmembrane proteins Human genes 0.000 description 2
- 230000005748 tumor development Effects 0.000 description 2
- 239000004474 valine Substances 0.000 description 2
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Chemical compound O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 2
- 229950007157 zolbetuximab Drugs 0.000 description 2
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 1
- KIUKXJAPPMFGSW-DNGZLQJQSA-N (2S,3S,4S,5R,6R)-6-[(2S,3R,4R,5S,6R)-3-Acetamido-2-[(2S,3S,4R,5R,6R)-6-[(2R,3R,4R,5S,6R)-3-acetamido-2,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl]oxy-2-carboxy-4,5-dihydroxyoxan-3-yl]oxy-5-hydroxy-6-(hydroxymethyl)oxan-4-yl]oxy-3,4,5-trihydroxyoxane-2-carboxylic acid Chemical compound CC(=O)N[C@H]1[C@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O[C@H]1[C@H](O)[C@@H](O)[C@H](O[C@H]2[C@@H]([C@@H](O[C@H]3[C@@H]([C@@H](O)[C@H](O)[C@H](O3)C(O)=O)O)[C@H](O)[C@@H](CO)O2)NC(C)=O)[C@@H](C(O)=O)O1 KIUKXJAPPMFGSW-DNGZLQJQSA-N 0.000 description 1
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 1
- UCLKLGIYGBLTSM-UHFFFAOYSA-N 1,2,3,4-tetrachloro-5-(2,5-dichlorophenyl)benzene Chemical compound ClC1=CC=C(Cl)C(C=2C(=C(Cl)C(Cl)=C(Cl)C=2)Cl)=C1 UCLKLGIYGBLTSM-UHFFFAOYSA-N 0.000 description 1
- QLAJNZSPVITUCQ-UHFFFAOYSA-N 1,3,2-dioxathietane 2,2-dioxide Chemical compound O=S1(=O)OCO1 QLAJNZSPVITUCQ-UHFFFAOYSA-N 0.000 description 1
- KJCVRFUGPWSIIH-UHFFFAOYSA-N 1-naphthol Chemical compound C1=CC=C2C(O)=CC=CC2=C1 KJCVRFUGPWSIIH-UHFFFAOYSA-N 0.000 description 1
- HWTAKVLMACWHLD-UHFFFAOYSA-N 2-(9h-carbazol-1-yl)ethanamine Chemical compound C12=CC=CC=C2NC2=C1C=CC=C2CCN HWTAKVLMACWHLD-UHFFFAOYSA-N 0.000 description 1
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 1
- WONRDHPFOHAWOG-UHFFFAOYSA-N 2-chloronaphthalen-1-ol Chemical compound C1=CC=C2C(O)=C(Cl)C=CC2=C1 WONRDHPFOHAWOG-UHFFFAOYSA-N 0.000 description 1
- UAIUNKRWKOVEES-UHFFFAOYSA-N 3,3',5,5'-tetramethylbenzidine Chemical compound CC1=C(N)C(C)=CC(C=2C=C(C)C(N)=C(C)C=2)=C1 UAIUNKRWKOVEES-UHFFFAOYSA-N 0.000 description 1
- YLZOPXRUQYQQID-UHFFFAOYSA-N 3-(2,4,6,7-tetrahydrotriazolo[4,5-c]pyridin-5-yl)-1-[4-[2-[[3-(trifluoromethoxy)phenyl]methylamino]pyrimidin-5-yl]piperazin-1-yl]propan-1-one Chemical compound N1N=NC=2CN(CCC=21)CCC(=O)N1CCN(CC1)C=1C=NC(=NC=1)NCC1=CC(=CC=C1)OC(F)(F)F YLZOPXRUQYQQID-UHFFFAOYSA-N 0.000 description 1
- IITIZHOBOIBGBW-UHFFFAOYSA-N 3-ethyl-2h-1,3-benzothiazole Chemical compound C1=CC=C2N(CC)CSC2=C1 IITIZHOBOIBGBW-UHFFFAOYSA-N 0.000 description 1
- FWBHETKCLVMNFS-UHFFFAOYSA-N 4',6-Diamino-2-phenylindol Chemical compound C1=CC(C(=N)N)=CC=C1C1=CC2=CC=C(C(N)=N)C=C2N1 FWBHETKCLVMNFS-UHFFFAOYSA-N 0.000 description 1
- YRNWIFYIFSBPAU-UHFFFAOYSA-N 4-[4-(dimethylamino)phenyl]-n,n-dimethylaniline Chemical compound C1=CC(N(C)C)=CC=C1C1=CC=C(N(C)C)C=C1 YRNWIFYIFSBPAU-UHFFFAOYSA-N 0.000 description 1
- TVZGACDUOSZQKY-LBPRGKRZSA-N 4-aminofolic acid Chemical compound C1=NC2=NC(N)=NC(N)=C2N=C1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 TVZGACDUOSZQKY-LBPRGKRZSA-N 0.000 description 1
- 102000007469 Actins Human genes 0.000 description 1
- 108010085238 Actins Proteins 0.000 description 1
- 101150051188 Adora2a gene Proteins 0.000 description 1
- 108010088751 Albumins Proteins 0.000 description 1
- 102000009027 Albumins Human genes 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- 229920000945 Amylopectin Polymers 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 241000228257 Aspergillus sp. Species 0.000 description 1
- 102100022005 B-lymphocyte antigen CD20 Human genes 0.000 description 1
- 244000063299 Bacillus subtilis Species 0.000 description 1
- 235000014469 Bacillus subtilis Nutrition 0.000 description 1
- 108010006654 Bleomycin Proteins 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 102000017420 CD3 protein, epsilon/gamma/delta subunit Human genes 0.000 description 1
- 108050005493 CD3 protein, epsilon/gamma/delta subunit Proteins 0.000 description 1
- 108010029697 CD40 Ligand Proteins 0.000 description 1
- 101150013553 CD40 gene Proteins 0.000 description 1
- 102100032912 CD44 antigen Human genes 0.000 description 1
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 1
- UXVMQQNJUSDDNG-UHFFFAOYSA-L Calcium chloride Chemical compound [Cl-].[Cl-].[Ca+2] UXVMQQNJUSDDNG-UHFFFAOYSA-L 0.000 description 1
- 241000282472 Canis lupus familiaris Species 0.000 description 1
- 102100025466 Carcinoembryonic antigen-related cell adhesion molecule 3 Human genes 0.000 description 1
- 102000000844 Cell Surface Receptors Human genes 0.000 description 1
- 108010001857 Cell Surface Receptors Proteins 0.000 description 1
- 102100021396 Cell surface glycoprotein CD200 receptor 1 Human genes 0.000 description 1
- 229920002261 Corn starch Polymers 0.000 description 1
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 1
- IGXWBGJHJZYPQS-SSDOTTSWSA-N D-Luciferin Chemical compound OC(=O)[C@H]1CSC(C=2SC3=CC=C(O)C=C3N=2)=N1 IGXWBGJHJZYPQS-SSDOTTSWSA-N 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 1
- 239000012625 DNA intercalator Substances 0.000 description 1
- 108010092160 Dactinomycin Proteins 0.000 description 1
- WEAHRLBPCANXCN-UHFFFAOYSA-N Daunomycin Natural products CCC1(O)CC(OC2CC(N)C(O)C(C)O2)c3cc4C(=O)c5c(OC)cccc5C(=O)c4c(O)c3C1 WEAHRLBPCANXCN-UHFFFAOYSA-N 0.000 description 1
- 241000702421 Dependoparvovirus Species 0.000 description 1
- 238000009007 Diagnostic Kit Methods 0.000 description 1
- 235000019739 Dicalciumphosphate Nutrition 0.000 description 1
- 206010059866 Drug resistance Diseases 0.000 description 1
- 102100025137 Early activation antigen CD69 Human genes 0.000 description 1
- 241000792859 Enema Species 0.000 description 1
- 241000283086 Equidae Species 0.000 description 1
- 229930189413 Esperamicin Natural products 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- GHASVSINZRGABV-UHFFFAOYSA-N Fluorouracil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 description 1
- 241000233866 Fungi Species 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Chemical compound OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- 239000004366 Glucose oxidase Substances 0.000 description 1
- 108010015776 Glucose oxidase Proteins 0.000 description 1
- 102000051366 Glycosyltransferases Human genes 0.000 description 1
- 108700023372 Glycosyltransferases Proteins 0.000 description 1
- 102000001554 Hemoglobins Human genes 0.000 description 1
- 108010054147 Hemoglobins Proteins 0.000 description 1
- 101710083479 Hepatitis A virus cellular receptor 2 homolog Proteins 0.000 description 1
- 241000238631 Hexapoda Species 0.000 description 1
- 102100022132 High affinity immunoglobulin epsilon receptor subunit gamma Human genes 0.000 description 1
- 108091010847 High affinity immunoglobulin epsilon receptor subunit gamma Proteins 0.000 description 1
- 101000897405 Homo sapiens B-lymphocyte antigen CD20 Proteins 0.000 description 1
- 101000868273 Homo sapiens CD44 antigen Proteins 0.000 description 1
- 101000914337 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 3 Proteins 0.000 description 1
- 101000969553 Homo sapiens Cell surface glycoprotein CD200 receptor 1 Proteins 0.000 description 1
- 101000934374 Homo sapiens Early activation antigen CD69 Proteins 0.000 description 1
- 101001068133 Homo sapiens Hepatitis A virus cellular receptor 2 Proteins 0.000 description 1
- 101000878602 Homo sapiens Immunoglobulin alpha Fc receptor Proteins 0.000 description 1
- 101001046686 Homo sapiens Integrin alpha-M Proteins 0.000 description 1
- 101000935040 Homo sapiens Integrin beta-2 Proteins 0.000 description 1
- 101000777628 Homo sapiens Leukocyte antigen CD37 Proteins 0.000 description 1
- 101001137987 Homo sapiens Lymphocyte activation gene 3 protein Proteins 0.000 description 1
- 101001018258 Homo sapiens Macrophage receptor MARCO Proteins 0.000 description 1
- 101000934338 Homo sapiens Myeloid cell surface antigen CD33 Proteins 0.000 description 1
- 101001109503 Homo sapiens NKG2-C type II integral membrane protein Proteins 0.000 description 1
- 101001098352 Homo sapiens OX-2 membrane glycoprotein Proteins 0.000 description 1
- 101001012157 Homo sapiens Receptor tyrosine-protein kinase erbB-2 Proteins 0.000 description 1
- 101000738771 Homo sapiens Receptor-type tyrosine-protein phosphatase C Proteins 0.000 description 1
- 101000596234 Homo sapiens T-cell surface protein tactile Proteins 0.000 description 1
- 101000914484 Homo sapiens T-lymphocyte activation antigen CD80 Proteins 0.000 description 1
- 101000851007 Homo sapiens Vascular endothelial growth factor receptor 2 Proteins 0.000 description 1
- 206010021432 Immunisation reaction Diseases 0.000 description 1
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 description 1
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 description 1
- 102100038005 Immunoglobulin alpha Fc receptor Human genes 0.000 description 1
- 206010061218 Inflammation Diseases 0.000 description 1
- 102100022338 Integrin alpha-M Human genes 0.000 description 1
- 102100025390 Integrin beta-2 Human genes 0.000 description 1
- 244000017020 Ipomoea batatas Species 0.000 description 1
- 235000002678 Ipomoea batatas Nutrition 0.000 description 1
- 102000002698 KIR Receptors Human genes 0.000 description 1
- 108010043610 KIR Receptors Proteins 0.000 description 1
- 241000235058 Komagataella pastoris Species 0.000 description 1
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 1
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 1
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 1
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 1
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 1
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 1
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 1
- 102000017578 LAG3 Human genes 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 102100031586 Leukocyte antigen CD37 Human genes 0.000 description 1
- 101710099301 Low affinity immunoglobulin gamma Fc region receptor III-A Proteins 0.000 description 1
- 108060001084 Luciferase Proteins 0.000 description 1
- 239000005089 Luciferase Substances 0.000 description 1
- 108010064548 Lymphocyte Function-Associated Antigen-1 Proteins 0.000 description 1
- 229920002774 Maltodextrin Polymers 0.000 description 1
- 239000005913 Maltodextrin Substances 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- 102000018697 Membrane Proteins Human genes 0.000 description 1
- 206010027476 Metastases Diseases 0.000 description 1
- 229930192392 Mitomycin Natural products 0.000 description 1
- 241000713333 Mouse mammary tumor virus Species 0.000 description 1
- 101100341510 Mus musculus Itgal gene Proteins 0.000 description 1
- 101001126413 Mus musculus Platelet-derived growth factor receptor alpha Proteins 0.000 description 1
- 102100025243 Myeloid cell surface antigen CD33 Human genes 0.000 description 1
- ZDZOTLJHXYCWBA-VCVYQWHSSA-N N-debenzoyl-N-(tert-butoxycarbonyl)-10-deacetyltaxol Chemical compound O([C@H]1[C@H]2[C@@](C([C@H](O)C3=C(C)[C@@H](OC(=O)[C@H](O)[C@@H](NC(=O)OC(C)(C)C)C=4C=CC=CC=4)C[C@]1(O)C3(C)C)=O)(C)[C@@H](O)C[C@H]1OC[C@]12OC(=O)C)C(=O)C1=CC=CC=C1 ZDZOTLJHXYCWBA-VCVYQWHSSA-N 0.000 description 1
- 102100022683 NKG2-C type II integral membrane protein Human genes 0.000 description 1
- 108090000772 Neuropilin-1 Proteins 0.000 description 1
- 102000004207 Neuropilin-1 Human genes 0.000 description 1
- 241000221961 Neurospora crassa Species 0.000 description 1
- 101710163270 Nuclease Proteins 0.000 description 1
- 102100037589 OX-2 membrane glycoprotein Human genes 0.000 description 1
- 108010038807 Oligopeptides Proteins 0.000 description 1
- 102000015636 Oligopeptides Human genes 0.000 description 1
- 108700020796 Oncogene Proteins 0.000 description 1
- 108700026244 Open Reading Frames Proteins 0.000 description 1
- 101150038994 PDGFRA gene Proteins 0.000 description 1
- 108090000526 Papain Proteins 0.000 description 1
- 229930040373 Paraformaldehyde Natural products 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 102000057297 Pepsin A Human genes 0.000 description 1
- 108090000284 Pepsin A Proteins 0.000 description 1
- 108091005804 Peptidases Proteins 0.000 description 1
- 102000035195 Peptidases Human genes 0.000 description 1
- 102000003992 Peroxidases Human genes 0.000 description 1
- 241000288906 Primates Species 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 229940079156 Proteasome inhibitor Drugs 0.000 description 1
- 108010076504 Protein Sorting Signals Proteins 0.000 description 1
- 241000588770 Proteus mirabilis Species 0.000 description 1
- 241000589774 Pseudomonas sp. Species 0.000 description 1
- 239000012980 RPMI-1640 medium Substances 0.000 description 1
- 244000088415 Raphanus sativus Species 0.000 description 1
- 235000006140 Raphanus sativus var sativus Nutrition 0.000 description 1
- 102100030086 Receptor tyrosine-protein kinase erbB-2 Human genes 0.000 description 1
- 102100037422 Receptor-type tyrosine-protein phosphatase C Human genes 0.000 description 1
- 108020005091 Replication Origin Proteins 0.000 description 1
- 108090000829 Ribosome Inactivating Proteins Proteins 0.000 description 1
- 241000720795 Schizosaccharomyces sp. Species 0.000 description 1
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 1
- 108091027967 Small hairpin RNA Proteins 0.000 description 1
- 108020004459 Small interfering RNA Proteins 0.000 description 1
- 241001147693 Staphylococcus sp. Species 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- 235000021355 Stearic acid Nutrition 0.000 description 1
- 241000187180 Streptomyces sp. Species 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- 241000282887 Suidae Species 0.000 description 1
- 230000006052 T cell proliferation Effects 0.000 description 1
- 108091008874 T cell receptors Proteins 0.000 description 1
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 1
- 229940126547 T-cell immunoglobulin mucin-3 Drugs 0.000 description 1
- 102100034922 T-cell surface glycoprotein CD8 alpha chain Human genes 0.000 description 1
- 102100035268 T-cell surface protein tactile Human genes 0.000 description 1
- 102100027222 T-lymphocyte activation antigen CD80 Human genes 0.000 description 1
- 229940123237 Taxane Drugs 0.000 description 1
- 108020005038 Terminator Codon Proteins 0.000 description 1
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 1
- 239000004473 Threonine Substances 0.000 description 1
- 102000007238 Transferrin Receptors Human genes 0.000 description 1
- 108010033576 Transferrin Receptors Proteins 0.000 description 1
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 1
- 102100040245 Tumor necrosis factor receptor superfamily member 5 Human genes 0.000 description 1
- 108010053099 Vascular Endothelial Growth Factor Receptor-2 Proteins 0.000 description 1
- 102100033177 Vascular endothelial growth factor receptor 2 Human genes 0.000 description 1
- JXLYSJRDGCGARV-WWYNWVTFSA-N Vinblastine Natural products O=C(O[C@H]1[C@](O)(C(=O)OC)[C@@H]2N(C)c3c(cc(c(OC)c3)[C@]3(C(=O)OC)c4[nH]c5c(c4CCN4C[C@](O)(CC)C[C@H](C3)C4)cccc5)[C@@]32[C@H]2[C@@]1(CC)C=CCN2CC3)C JXLYSJRDGCGARV-WWYNWVTFSA-N 0.000 description 1
- 229940122803 Vinca alkaloid Drugs 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- SXEHKFHPFVVDIR-UHFFFAOYSA-N [4-(4-hydrazinylphenyl)phenyl]hydrazine Chemical compound C1=CC(NN)=CC=C1C1=CC=C(NN)C=C1 SXEHKFHPFVVDIR-UHFFFAOYSA-N 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- RJURFGZVJUQBHK-IIXSONLDSA-N actinomycin D Chemical compound C[C@H]1OC(=O)[C@H](C(C)C)N(C)C(=O)CN(C)C(=O)[C@@H]2CCCN2C(=O)[C@@H](C(C)C)NC(=O)[C@H]1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=CC=C3C(=O)N[C@@H]4C(=O)N[C@@H](C(N5CCC[C@H]5C(=O)N(C)CC(=O)N(C)[C@@H](C(C)C)C(=O)O[C@@H]4C)=O)C(C)C)=C3N=C21 RJURFGZVJUQBHK-IIXSONLDSA-N 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 229940009456 adriamycin Drugs 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 230000002776 aggregation Effects 0.000 description 1
- 238000004220 aggregation Methods 0.000 description 1
- 238000013019 agitation Methods 0.000 description 1
- 230000029936 alkylation Effects 0.000 description 1
- 238000005804 alkylation reaction Methods 0.000 description 1
- 125000003368 amide group Chemical group 0.000 description 1
- 125000000539 amino acid group Chemical group 0.000 description 1
- 125000003277 amino group Chemical group 0.000 description 1
- 229960003896 aminopterin Drugs 0.000 description 1
- 238000004873 anchoring Methods 0.000 description 1
- 210000004102 animal cell Anatomy 0.000 description 1
- 239000005557 antagonist Substances 0.000 description 1
- 230000000259 anti-tumor effect Effects 0.000 description 1
- 238000011394 anticancer treatment Methods 0.000 description 1
- 230000000890 antigenic effect Effects 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 108010044540 auristatin Proteins 0.000 description 1
- 238000011888 autopsy Methods 0.000 description 1
- OHDRQQURAXLVGJ-HLVWOLMTSA-N azane;(2e)-3-ethyl-2-[(e)-(3-ethyl-6-sulfo-1,3-benzothiazol-2-ylidene)hydrazinylidene]-1,3-benzothiazole-6-sulfonic acid Chemical compound [NH4+].[NH4+].S/1C2=CC(S([O-])(=O)=O)=CC=C2N(CC)C\1=N/N=C1/SC2=CC(S([O-])(=O)=O)=CC=C2N1CC OHDRQQURAXLVGJ-HLVWOLMTSA-N 0.000 description 1
- VSRXQHXAPYXROS-UHFFFAOYSA-N azanide;cyclobutane-1,1-dicarboxylic acid;platinum(2+) Chemical compound [NH2-].[NH2-].[Pt+2].OC(=O)C1(C(O)=O)CCC1 VSRXQHXAPYXROS-UHFFFAOYSA-N 0.000 description 1
- 239000000022 bacteriostatic agent Substances 0.000 description 1
- IYXMNTLBLQNMLM-UHFFFAOYSA-N benzene-1,4-diamine;hydron;dichloride Chemical compound Cl.Cl.NC1=CC=C(N)C=C1 IYXMNTLBLQNMLM-UHFFFAOYSA-N 0.000 description 1
- 229960002685 biotin Drugs 0.000 description 1
- 235000020958 biotin Nutrition 0.000 description 1
- 239000011616 biotin Substances 0.000 description 1
- 229960001561 bleomycin Drugs 0.000 description 1
- OYVAGSVQBOHSSS-UAPAGMARSA-O bleomycin A2 Chemical compound N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC=C(N=1)C=1SC=C(N=1)C(=O)NCCC[S+](C)C)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1N=CNC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C OYVAGSVQBOHSSS-UAPAGMARSA-O 0.000 description 1
- 229960001467 bortezomib Drugs 0.000 description 1
- GXJABQQUPOEUTA-RDJZCZTQSA-N bortezomib Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)B(O)O)NC(=O)C=1N=CC=NC=1)C1=CC=CC=C1 GXJABQQUPOEUTA-RDJZCZTQSA-N 0.000 description 1
- 210000004556 brain Anatomy 0.000 description 1
- 239000007853 buffer solution Substances 0.000 description 1
- 239000007975 buffered saline Substances 0.000 description 1
- 239000011575 calcium Substances 0.000 description 1
- 229910052791 calcium Inorganic materials 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- CJZGTCYPCWQAJB-UHFFFAOYSA-L calcium stearate Chemical compound [Ca+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O CJZGTCYPCWQAJB-UHFFFAOYSA-L 0.000 description 1
- 235000013539 calcium stearate Nutrition 0.000 description 1
- 239000008116 calcium stearate Substances 0.000 description 1
- 229930195731 calicheamicin Natural products 0.000 description 1
- HXCHCVDVKSCDHU-LULTVBGHSA-N calicheamicin Chemical compound C1[C@H](OC)[C@@H](NCC)CO[C@H]1O[C@H]1[C@H](O[C@@H]2C\3=C(NC(=O)OC)C(=O)C[C@](C/3=C/CSSSC)(O)C#C\C=C/C#C2)O[C@H](C)[C@@H](NO[C@@H]2O[C@H](C)[C@@H](SC(=O)C=3C(=C(OC)C(O[C@H]4[C@@H]([C@H](OC)[C@@H](O)[C@H](C)O4)O)=C(I)C=3C)OC)[C@@H](O)C2)[C@@H]1O HXCHCVDVKSCDHU-LULTVBGHSA-N 0.000 description 1
- 239000007963 capsule composition Substances 0.000 description 1
- 229960004562 carboplatin Drugs 0.000 description 1
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 1
- 229930188550 carminomycin Natural products 0.000 description 1
- XREUEWVEMYWFFA-CSKJXFQVSA-N carminomycin Chemical compound C1[C@H](N)[C@H](O)[C@H](C)O[C@H]1O[C@@H]1C2=C(O)C(C(=O)C3=C(O)C=CC=C3C3=O)=C3C(O)=C2C[C@@](O)(C(C)=O)C1 XREUEWVEMYWFFA-CSKJXFQVSA-N 0.000 description 1
- XREUEWVEMYWFFA-UHFFFAOYSA-N carminomycin I Natural products C1C(N)C(O)C(C)OC1OC1C2=C(O)C(C(=O)C3=C(O)C=CC=C3C3=O)=C3C(O)=C2CC(O)(C(C)=O)C1 XREUEWVEMYWFFA-UHFFFAOYSA-N 0.000 description 1
- 229950001725 carubicin Drugs 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 239000006143 cell culture medium Substances 0.000 description 1
- 230000030833 cell death Effects 0.000 description 1
- 230000005859 cell recognition Effects 0.000 description 1
- 230000030570 cellular localization Effects 0.000 description 1
- 239000001913 cellulose Substances 0.000 description 1
- 229920002678 cellulose Polymers 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- JCKYGMPEJWAADB-UHFFFAOYSA-N chlorambucil Chemical compound OC(=O)CCCC1=CC=C(N(CCCl)CCCl)C=C1 JCKYGMPEJWAADB-UHFFFAOYSA-N 0.000 description 1
- 229960004630 chlorambucil Drugs 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 229960004316 cisplatin Drugs 0.000 description 1
- DQLATGHUWYMOKM-UHFFFAOYSA-L cisplatin Chemical compound N[Pt](N)(Cl)Cl DQLATGHUWYMOKM-UHFFFAOYSA-L 0.000 description 1
- 230000004186 co-expression Effects 0.000 description 1
- 230000008045 co-localization Effects 0.000 description 1
- 229940110456 cocoa butter Drugs 0.000 description 1
- 235000019868 cocoa butter Nutrition 0.000 description 1
- 239000003086 colorant Substances 0.000 description 1
- 239000012141 concentrate Substances 0.000 description 1
- 235000008504 concentrate Nutrition 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 239000008120 corn starch Substances 0.000 description 1
- 239000013601 cosmid vector Substances 0.000 description 1
- 229960003624 creatine Drugs 0.000 description 1
- 239000006046 creatine Substances 0.000 description 1
- 239000012228 culture supernatant Substances 0.000 description 1
- 238000005520 cutting process Methods 0.000 description 1
- 230000001085 cytostatic effect Effects 0.000 description 1
- 239000002254 cytotoxic agent Substances 0.000 description 1
- 231100000599 cytotoxic agent Toxicity 0.000 description 1
- 229960000640 dactinomycin Drugs 0.000 description 1
- 229960000975 daunorubicin Drugs 0.000 description 1
- 238000000354 decomposition reaction Methods 0.000 description 1
- 230000007423 decrease Effects 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 230000018109 developmental process Effects 0.000 description 1
- 229960000633 dextran sulfate Drugs 0.000 description 1
- UQLDLKMNUJERMK-UHFFFAOYSA-L di(octadecanoyloxy)lead Chemical compound [Pb+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O UQLDLKMNUJERMK-UHFFFAOYSA-L 0.000 description 1
- 238000003745 diagnosis Methods 0.000 description 1
- 238000000502 dialysis Methods 0.000 description 1
- NEFBYIFKOOEVPA-UHFFFAOYSA-K dicalcium phosphate Chemical compound [Ca+2].[Ca+2].[O-]P([O-])([O-])=O NEFBYIFKOOEVPA-UHFFFAOYSA-K 0.000 description 1
- 229910000390 dicalcium phosphate Inorganic materials 0.000 description 1
- 229940038472 dicalcium phosphate Drugs 0.000 description 1
- CEJLBZWIKQJOAT-UHFFFAOYSA-N dichloroisocyanuric acid Chemical compound ClN1C(=O)NC(=O)N(Cl)C1=O CEJLBZWIKQJOAT-UHFFFAOYSA-N 0.000 description 1
- 235000005911 diet Nutrition 0.000 description 1
- 230000037213 diet Effects 0.000 description 1
- 235000013681 dietary sucrose Nutrition 0.000 description 1
- 238000007865 diluting Methods 0.000 description 1
- 238000010790 dilution Methods 0.000 description 1
- 239000012895 dilution Substances 0.000 description 1
- 238000006471 dimerization reaction Methods 0.000 description 1
- 239000007884 disintegrant Substances 0.000 description 1
- 239000002270 dispersing agent Substances 0.000 description 1
- 239000003534 dna topoisomerase inhibitor Substances 0.000 description 1
- 229960003668 docetaxel Drugs 0.000 description 1
- AMRJKAQTDDKMCE-UHFFFAOYSA-N dolastatin Chemical compound CC(C)C(N(C)C)C(=O)NC(C(C)C)C(=O)N(C)C(C(C)C)C(OC)CC(=O)N1CCCC1C(OC)C(C)C(=O)NC(C=1SC=CN=1)CC1=CC=CC=C1 AMRJKAQTDDKMCE-UHFFFAOYSA-N 0.000 description 1
- 229930188854 dolastatin Natural products 0.000 description 1
- 239000002552 dosage form Substances 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 210000003038 endothelium Anatomy 0.000 description 1
- 239000007920 enema Substances 0.000 description 1
- 229940095399 enema Drugs 0.000 description 1
- 239000003623 enhancer Substances 0.000 description 1
- 102000052116 epidermal growth factor receptor activity proteins Human genes 0.000 description 1
- 108700015053 epidermal growth factor receptor activity proteins Proteins 0.000 description 1
- YSMODUONRAFBET-UHNVWZDZSA-N erythro-5-hydroxy-L-lysine Chemical group NC[C@H](O)CC[C@H](N)C(O)=O YSMODUONRAFBET-UHNVWZDZSA-N 0.000 description 1
- LJQQFQHBKUKHIS-WJHRIEJJSA-N esperamicin Chemical compound O1CC(NC(C)C)C(OC)CC1OC1C(O)C(NOC2OC(C)C(SC)C(O)C2)C(C)OC1OC1C(\C2=C/CSSSC)=C(NC(=O)OC)C(=O)C(OC3OC(C)C(O)C(OC(=O)C=4C(=CC(OC)=C(OC)C=4)NC(=O)C(=C)OC)C3)C2(O)C#C\C=C/C#C1 LJQQFQHBKUKHIS-WJHRIEJJSA-N 0.000 description 1
- MVPICKVDHDWCJQ-UHFFFAOYSA-N ethyl 3-pyrrolidin-1-ylpropanoate Chemical compound CCOC(=O)CCN1CCCC1 MVPICKVDHDWCJQ-UHFFFAOYSA-N 0.000 description 1
- 230000029142 excretion Effects 0.000 description 1
- 239000010685 fatty oil Substances 0.000 description 1
- 239000012894 fetal calf serum Substances 0.000 description 1
- 239000000835 fiber Substances 0.000 description 1
- GNBHRKFJIUUOQI-UHFFFAOYSA-N fluorescein Chemical compound O1C(=O)C2=CC=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 GNBHRKFJIUUOQI-UHFFFAOYSA-N 0.000 description 1
- 229960002949 fluorouracil Drugs 0.000 description 1
- 230000002538 fungal effect Effects 0.000 description 1
- 230000002496 gastric effect Effects 0.000 description 1
- 210000001156 gastric mucosa Anatomy 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 229960005277 gemcitabine Drugs 0.000 description 1
- SDUQYLNIPVEERB-QPPQHZFASA-N gemcitabine Chemical compound O=C1N=C(N)C=CN1[C@H]1C(F)(F)[C@H](O)[C@@H](CO)O1 SDUQYLNIPVEERB-QPPQHZFASA-N 0.000 description 1
- 230000008571 general function Effects 0.000 description 1
- 229940116332 glucose oxidase Drugs 0.000 description 1
- 235000019420 glucose oxidase Nutrition 0.000 description 1
- 108091005996 glycated proteins Proteins 0.000 description 1
- 230000036252 glycation Effects 0.000 description 1
- 125000005456 glyceride group Chemical group 0.000 description 1
- 239000007902 hard capsule Substances 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 229920002674 hyaluronan Polymers 0.000 description 1
- 229960003160 hyaluronic acid Drugs 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- 238000004191 hydrophobic interaction chromatography Methods 0.000 description 1
- 238000012872 hydroxylapatite chromatography Methods 0.000 description 1
- 230000036737 immune function Effects 0.000 description 1
- 238000012760 immunocytochemical staining Methods 0.000 description 1
- 238000003365 immunocytochemistry Methods 0.000 description 1
- 238000010166 immunofluorescence Methods 0.000 description 1
- 238000003125 immunofluorescent labeling Methods 0.000 description 1
- 230000002163 immunogen Effects 0.000 description 1
- 238000003364 immunohistochemistry Methods 0.000 description 1
- 238000001114 immunoprecipitation Methods 0.000 description 1
- 239000003547 immunosorbent Substances 0.000 description 1
- 239000012535 impurity Substances 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- 230000004054 inflammatory process Effects 0.000 description 1
- 239000004615 ingredient Substances 0.000 description 1
- 239000007972 injectable composition Substances 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 238000001361 intraarterial administration Methods 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000010255 intramuscular injection Methods 0.000 description 1
- 239000007927 intramuscular injection Substances 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 238000010253 intravenous injection Methods 0.000 description 1
- 238000004255 ion exchange chromatography Methods 0.000 description 1
- UWKQSNNFCGGAFS-XIFFEERXSA-N irinotecan Chemical compound C1=C2C(CC)=C3CN(C(C4=C([C@@](C(=O)OC4)(O)CC)C=4)=O)C=4C3=NC2=CC=C1OC(=O)N(CC1)CCC1N1CCCCC1 UWKQSNNFCGGAFS-XIFFEERXSA-N 0.000 description 1
- NLYAJNPCOHFWQQ-UHFFFAOYSA-N kaolin Chemical compound O.O.O=[Al]O[Si](=O)O[Si](=O)O[Al]=O NLYAJNPCOHFWQQ-UHFFFAOYSA-N 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 239000006193 liquid solution Substances 0.000 description 1
- 244000144972 livestock Species 0.000 description 1
- 239000007937 lozenge Substances 0.000 description 1
- HWYHZTIRURJOHG-UHFFFAOYSA-N luminol Chemical compound O=C1NNC(=O)C2=C1C(N)=CC=C2 HWYHZTIRURJOHG-UHFFFAOYSA-N 0.000 description 1
- 210000001165 lymph node Anatomy 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- 210000002540 macrophage Anatomy 0.000 description 1
- 229940035034 maltodextrin Drugs 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 230000002503 metabolic effect Effects 0.000 description 1
- 230000009401 metastasis Effects 0.000 description 1
- 208000037819 metastatic cancer Diseases 0.000 description 1
- 208000011575 metastatic malignant neoplasm Diseases 0.000 description 1
- 229960000485 methotrexate Drugs 0.000 description 1
- 230000011278 mitosis Effects 0.000 description 1
- 238000003032 molecular docking Methods 0.000 description 1
- 210000003205 muscle Anatomy 0.000 description 1
- YOHYSYJDKVYCJI-UHFFFAOYSA-N n-[3-[[6-[3-(trifluoromethyl)anilino]pyrimidin-4-yl]amino]phenyl]cyclopropanecarboxamide Chemical compound FC(F)(F)C1=CC=CC(NC=2N=CN=C(NC=3C=C(NC(=O)C4CC4)C=CC=3)C=2)=C1 YOHYSYJDKVYCJI-UHFFFAOYSA-N 0.000 description 1
- 229910052757 nitrogen Inorganic materials 0.000 description 1
- 208000002154 non-small cell lung carcinoma Diseases 0.000 description 1
- 239000002773 nucleotide Substances 0.000 description 1
- 125000003729 nucleotide group Chemical group 0.000 description 1
- QIQXTHQIDYTFRH-UHFFFAOYSA-N octadecanoic acid Chemical compound CCCCCCCCCCCCCCCCCC(O)=O QIQXTHQIDYTFRH-UHFFFAOYSA-N 0.000 description 1
- OQCDKBAXFALNLD-UHFFFAOYSA-N octadecanoic acid Natural products CCCCCCCC(C)CCCCCCCCC(O)=O OQCDKBAXFALNLD-UHFFFAOYSA-N 0.000 description 1
- 239000001048 orange dye Substances 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 238000004091 panning Methods 0.000 description 1
- 229940055729 papain Drugs 0.000 description 1
- 235000019834 papain Nutrition 0.000 description 1
- 229920002866 paraformaldehyde Polymers 0.000 description 1
- 238000007911 parenteral administration Methods 0.000 description 1
- 244000052769 pathogen Species 0.000 description 1
- 229940111202 pepsin Drugs 0.000 description 1
- 108040007629 peroxidase activity proteins Proteins 0.000 description 1
- 238000002823 phage display Methods 0.000 description 1
- 239000000546 pharmaceutical excipient Substances 0.000 description 1
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 1
- 239000006187 pill Substances 0.000 description 1
- 210000002381 plasma Anatomy 0.000 description 1
- 239000013600 plasmid vector Substances 0.000 description 1
- 229910052697 platinum Inorganic materials 0.000 description 1
- BASFCYQUMIYNBI-UHFFFAOYSA-N platinum Substances [Pt] BASFCYQUMIYNBI-UHFFFAOYSA-N 0.000 description 1
- 230000008488 polyadenylation Effects 0.000 description 1
- 229920000642 polymer Polymers 0.000 description 1
- 229920001184 polypeptide Polymers 0.000 description 1
- 229920001592 potato starch Polymers 0.000 description 1
- 238000002360 preparation method Methods 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 239000000047 product Substances 0.000 description 1
- 239000003380 propellant Substances 0.000 description 1
- 239000003207 proteasome inhibitor Substances 0.000 description 1
- 231100000654 protein toxin Toxicity 0.000 description 1
- 229940024999 proteolytic enzymes for treatment of wounds and ulcers Drugs 0.000 description 1
- 210000001938 protoplast Anatomy 0.000 description 1
- INCIMLINXXICKS-UHFFFAOYSA-M pyronin Y Chemical compound [Cl-].C1=CC(=[N+](C)C)C=C2OC3=CC(N(C)C)=CC=C3C=C21 INCIMLINXXICKS-UHFFFAOYSA-M 0.000 description 1
- UOWVMDUEMSNCAV-WYENRQIDSA-N rachelmycin Chemical compound C1([C@]23C[C@@H]2CN1C(=O)C=1NC=2C(OC)=C(O)C4=C(C=2C=1)CCN4C(=O)C1=CC=2C=4CCN(C=4C(O)=C(C=2N1)OC)C(N)=O)=CC(=O)C1=C3C(C)=CN1 UOWVMDUEMSNCAV-WYENRQIDSA-N 0.000 description 1
- 239000000941 radioactive substance Substances 0.000 description 1
- 238000003127 radioimmunoassay Methods 0.000 description 1
- 238000003156 radioimmunoprecipitation Methods 0.000 description 1
- 238000003753 real-time PCR Methods 0.000 description 1
- 238000005215 recombination Methods 0.000 description 1
- 230000001105 regulatory effect Effects 0.000 description 1
- 230000010076 replication Effects 0.000 description 1
- 210000002345 respiratory system Anatomy 0.000 description 1
- 230000001177 retroviral effect Effects 0.000 description 1
- 150000003839 salts Chemical class 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 210000002966 serum Anatomy 0.000 description 1
- 230000019491 signal transduction Effects 0.000 description 1
- HBMJWWWQQXIZIP-UHFFFAOYSA-N silicon carbide Chemical compound [Si+]#[C-] HBMJWWWQQXIZIP-UHFFFAOYSA-N 0.000 description 1
- 229910010271 silicon carbide Inorganic materials 0.000 description 1
- 238000001542 size-exclusion chromatography Methods 0.000 description 1
- 210000003491 skin Anatomy 0.000 description 1
- 239000004055 small Interfering RNA Substances 0.000 description 1
- 150000003384 small molecules Chemical class 0.000 description 1
- 229940045902 sodium stearyl fumarate Drugs 0.000 description 1
- 239000007901 soft capsule Substances 0.000 description 1
- 239000000600 sorbitol Substances 0.000 description 1
- 235000010356 sorbitol Nutrition 0.000 description 1
- 210000000278 spinal cord Anatomy 0.000 description 1
- 239000007921 spray Substances 0.000 description 1
- 238000005507 spraying Methods 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 238000011255 standard chemotherapy Methods 0.000 description 1
- 238000010561 standard procedure Methods 0.000 description 1
- 239000008107 starch Substances 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 239000008117 stearic acid Substances 0.000 description 1
- 239000008223 sterile water Substances 0.000 description 1
- 210000002784 stomach Anatomy 0.000 description 1
- 239000012089 stop solution Substances 0.000 description 1
- 238000010254 subcutaneous injection Methods 0.000 description 1
- 239000007929 subcutaneous injection Substances 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- 229960004793 sucrose Drugs 0.000 description 1
- 239000006228 supernatant Substances 0.000 description 1
- 239000002511 suppository base Substances 0.000 description 1
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 208000024891 symptom Diseases 0.000 description 1
- 239000006188 syrup Substances 0.000 description 1
- 235000020357 syrup Nutrition 0.000 description 1
- 230000008685 targeting Effects 0.000 description 1
- NRUKOCRGYNPUPR-QBPJDGROSA-N teniposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@@H](OC[C@H]4O3)C=3SC=CC=3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 NRUKOCRGYNPUPR-QBPJDGROSA-N 0.000 description 1
- 229960001278 teniposide Drugs 0.000 description 1
- 210000001578 tight junction Anatomy 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- 229940044693 topoisomerase inhibitor Drugs 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 238000011426 transformation method Methods 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- LZAJKCZTKKKZNT-PMNGPLLRSA-N trichothecene Chemical compound C12([C@@]3(CC[C@H]2OC2C=C(CCC23C)C)C)CO1 LZAJKCZTKKKZNT-PMNGPLLRSA-N 0.000 description 1
- 229930013292 trichothecene Natural products 0.000 description 1
- 230000005747 tumor angiogenesis Effects 0.000 description 1
- 210000004881 tumor cell Anatomy 0.000 description 1
- 230000004614 tumor growth Effects 0.000 description 1
- 208000029729 tumor suppressor gene on chromosome 11 Diseases 0.000 description 1
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 1
- 238000000108 ultra-filtration Methods 0.000 description 1
- 241000701161 unidentified adenovirus Species 0.000 description 1
- 241000701447 unidentified baculovirus Species 0.000 description 1
- 241001430294 unidentified retrovirus Species 0.000 description 1
- 229960003048 vinblastine Drugs 0.000 description 1
- JXLYSJRDGCGARV-XQKSVPLYSA-N vincaleukoblastine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1NC1=CC=CC=C21 JXLYSJRDGCGARV-XQKSVPLYSA-N 0.000 description 1
- 229960004528 vincristine Drugs 0.000 description 1
- OGWKCGZFUXNPDA-XQKSVPLYSA-N vincristine Chemical compound C([N@]1C[C@@H](C[C@]2(C(=O)OC)C=3C(=CC4=C([C@]56[C@H]([C@@]([C@H](OC(C)=O)[C@]7(CC)C=CCN([C@H]67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)C[C@@](C1)(O)CC)CC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-XQKSVPLYSA-N 0.000 description 1
- OGWKCGZFUXNPDA-UHFFFAOYSA-N vincristine Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(OC(C)=O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-UHFFFAOYSA-N 0.000 description 1
- 239000013603 viral vector Substances 0.000 description 1
- 230000003612 virological effect Effects 0.000 description 1
- 239000002699 waste material Substances 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/39—Medicinal preparations containing antigens or antibodies characterised by the immunostimulating additives, e.g. chemical adjuvants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/574—Immunoassay; Biospecific binding assay; Materials therefor for cancer
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/77—Internalization into the cell
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/94—Stability, e.g. half-life, pH, temperature or enzyme-resistance
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Organic Chemistry (AREA)
- Molecular Biology (AREA)
- Microbiology (AREA)
- Epidemiology (AREA)
- Biochemistry (AREA)
- Biomedical Technology (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Urology & Nephrology (AREA)
- Hematology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Mycology (AREA)
- General Physics & Mathematics (AREA)
- Biotechnology (AREA)
- Pathology (AREA)
- Food Science & Technology (AREA)
- Analytical Chemistry (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Cell Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Physics & Mathematics (AREA)
- Oncology (AREA)
- Genetics & Genomics (AREA)
- Hospice & Palliative Care (AREA)
- Biophysics (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Abstract
본 발명은 클라우딘-18.2(claudin-18 spliced variant 2, CLDN18.2)에 특이적으로 결합하는 단클론항체 및 이의 용도에 관한 것으로, 본 발명의 항체는 CLDN18.2에 대한 높은 결합력 및 우수한 세포내재화(internalization)능을 가지고 있으므로, 단클론항체 또는 변형된 형태(항체-약물 접합체, 키메라 항원 수용체, 또는 다중특이적 항체)로 암 치료제 개발에 유용하게 활용될 수 있을 것이다.
Description
본 발명은 클라우딘-18.2(claudin-18 spliced variant 2, CLDN18.2)에 특이적으로 결합하는 단클론항체 및 이의 용도에 관한 것이다.
클라우딘-18은 대략 27 kDa의 분자량을 가지며 상피와 내피의 접합부에 존재하는 내인성 막 단백질 패밀리에 속한다. 구조는 2개의 세포 외 루프(Loop)와 4개의 막투과성(transmembrane, TM) 도메인으로 이루어져 있고, 8개의 아미노산만이 상이한 2가지의 스플라이스 변이체(splice variant)인, 클라우딘-18.1(Genebank accession number, NM_016369) 및 클라우딘-18.2(Genebank accession number, NM_001002026)가 존재한다. 클라우딘-18.1은 정상적인 폐와 위 상피에서 발현되지만, 클라우딘-18.2는 위 점막을 제외한 정상 세포에서는 발현이 매우 제한되어 있고, 위암, 간암, 담도암, 유방암, 신장암, 췌장암, 비소세포폐암, 중피종(mesothelioma) 등 다양한 암 및 그들의 전이성 암에서 과별현 된다(Okugawa T, et al. Dig Sci (2012) 57:1562-7; Rohde C, et al. Jpn J Clin Oncol (2019) 49:870-6). 클라우딘 단백질은 종양 발생과 전이 및 염증에 중요한 역할을 할 수 있다. 클라우딘 단백질의 발현 변화는 밀착연접(tight junction)의 기능 저하를 초래하고, 신호 전달 경로에 영향을 미쳐 종양을 촉진하는 것으로 알려져 있다.
따라서 우수한 항암 치료제 개발을 위해 클라우딘-18.1과 달리 종양 특이적 발현을 보이는 클라우딘-18.2에만 특이적으로 결합하는 항체 개발이 요구된다.
최근 종양세포 표면에서 클라우딘-18.2에 결합하는 강력한 키메라 IgG1 mAb(IgG1 단클론항체)인 졸베툭시맙(zolbetuximab)이 개발되어 임상시험이 진행되고 있다. 특히, 3상 시험(SPOTLIGHT trial, NCT03504397)에서 1차 치료제로 사용한 졸베툭시맙은 표준 화학요법에 비해 클라우딘-18.2-발현 위암 환자의 무진행 질병생존기간(progression-free survival; PFS)과 전체생존기간(overall survival; OS)을 향상시켰다.
이러한 기술적 배경 하에서, 본 발명자들은 인간 클라우딘-18.2 단백질을 항원으로 사용하여, 인간 클라우딘-18.2에만 특이적으로 결합하는 단클론항체를 완전인간항체 서열로 구성된 파아지 디스플레이 기술을 이용하여 스크리닝 하였고, 스크리닝된 항체 클론의 중쇄와 경쇄의 가변부위를 바탕으로 제조된 인간항체 형태(IgG; immunoglobulin)의 단클론항체가 세포 표면에 발현된 인간 CLDN18.2 단백질에 선택적으로 결합할 수 있으며, 세포내재화(internalization) 능력이 우수한 것을 확인함으로써, 본 발명을 완성하였다.
한편, 한국공개특허 제2022-0136267호에는 '인간 CLDN18.2에 대한 항체를 포함하는 항체 약물 접합체 및 이의 용도'가 개시되어 있고, 한국공개특허 제2022-0121873호에는 '항-클라우딘 18.2 항체 및 그 용도'가 개시되어 있으나, 본 발명의 '클라우딘-18.2에 특이적으로 결합하는 단클론항체 및 이의 용도'에 대해서는 기재된 바가 없다.
본 발명의 목적은 클라우딘-18.2(claudin-18 spliced variant 2, CLDN18.2)에 대한 신규 항체 또는 그의 항원 결합 단편을 제공하는데 있다.
본 발명의 다른 목적은 상기 항체 또는 그의 항원 결합 단편을 코딩하는 폴리뉴클레오티드를 제공하는데 있다.
본 발명의 다른 목적은 상기 폴리뉴클레오티드를 포함하는 벡터, 상기 벡터가 도입된 형질전환체 및 이의 제조방법을 제공하는데 있다.
본 발명의 또 다른 목적은 상기 항체 또는 그의 항원 결합 단편을 포함하는 암 치료용 조성물을 제공하는데 있다.
상기 과제를 해결하기 위해, 본 발명은 서열번호 1로 기재된 중쇄 CDR (complementarity-determining region) 1; 서열번호 2로 기재된 중쇄 CDR2; 및 서열번호 3으로 기재된 중쇄 CDR3를 포함하는 중쇄가변영역과, 서열번호 5로 기재된 경쇄 CDR1; 아미노산 서열 DVS로 이루어진 경쇄 CDR2; 및 서열번호 6으로 기재된 경쇄 CDR3를 포함하는 경쇄가변영역을 포함하는, 클라우딘-18.2(claudin-18 spliced variant 2, CLDN18.2)에 특이적으로 결합하는 단클론항체 또는 이의 항원 결합 단편을 제공한다.
또한, 본 발명은 서열번호 1로 기재된 중쇄 CDR1; 서열번호 2로 기재된 중쇄 CDR2; 및 서열번호 8로 기재된 중쇄 CDR3를 포함하는 중쇄가변영역과, 서열번호 10으로 기재된 경쇄 CDR1; 아미노산 서열 AAS로 이루어진 경쇄 CDR2; 및 서열번호 11로 기재된 경쇄 CDR3를 포함하는 경쇄가변영역을 포함하는, 클라우딘-18.2에 특이적으로 결합하는 단클론항체 또는 이의 항원 결합 단편을 제공한다.
또한, 본 발명은 서열번호 1로 기재된 중쇄 CDR1; 서열번호 2로 기재된 중쇄 CDR2; 및 서열번호 13으로 기재된 중쇄 CDR3를 포함하는 중쇄가변영역과, 서열번호 15로 기재된 경쇄 CDR1; 아미노산 서열 GAF로 이루어진 경쇄 CDR2; 및 서열번호 11로 기재된 경쇄 CDR3를 포함하는 경쇄가변영역을 포함하는, 클라우딘-18.2에 특이적으로 결합하는 단클론항체 또는 이의 항원 결합 단편을 제공한다.
또한, 본 발명은 상기 단클론항체 또는 이의 항원 결합 단편의 중쇄가변영역 및 경쇄가변영역을 코딩하는 폴리뉴클레오티드를 제공한다.
또한, 본 발명은 상기 폴리뉴클레오티드를 포함하는 발현 벡터를 제공한다.
또한, 본 발명은 상기 발현 벡터로 형질전환된 인간을 제외한 형질전환체를 제공한다.
또한, 본 발명은 상기 형질전환체를 배양하여 클라우딘-18.2에 특이적으로 결합하는 단클론항체 또는 이의 항원 결합 단편을 제조하는 방법을 제공한다.
또한, 본 발명은 상기 단클론항체 또는 이의 항원 결합 단편을 유효성분으로 포함하는 암 치료용 약학 조성물을 제공한다.
또한, 본 발명은 상기 암 치료용 약학 조성물을 개체에 투여하는 단계를 포함하는, 암을 치료하는 방법을 제공한다.
또한, 본 발명은 상기 단클론항체 또는 이의 항원 결합 단편을 포함하는 암 진단용 조성물 및 상기 암 진단용 조성물을 포함하는 암 진단용 키트를 제공한다.
또한, 본 발명은 상기 단클론항체 또는 이의 항원 결합 단편에 약물이 결합된 항체-약물 접합체(antibody-drug conjugate)를 제공한다.
또한, 본 발명은 ⅰ) 상기 단클론항체; ⅱ) 막투과성 도메인(transmembrane domain); 및 ⅲ) 상기 i)의 항체가 항원에 결합하면 T 세포 활성화를 가져오는 것이 특징인 세포 내 신호전달 도메인을 포함하는 키메라 항원 수용체(chimeric antigen receptor, CAR) 단백질을 제공한다.
또한, 본 발명은 상기 단클론항체 또는 이의 항원 결합 단편을 포함하는 다중특이적 항체(multi-specific antibody)를 제공한다.
본 발명에 따른 클라우딘-18.2(CLDN18.2)에 결합하는 신규한 단클론항체는 세포내재화 완전인간항체서열로 구성되어 있고, 특이적 항원 결합력과 다양한 세포내재화(internalization)능을 나타내며, 열 안정성(thermal stability)이 확인되므로, 단클론항체 또는 변형된 형태(항체-약물 접합체, 키메라 항원 수용체, 또는 다중특이적 항체 등)로 클라우딘-18.2를 발현하는 암 질환 및 관련된 질환의 치료 및/또는 예방에 유용하게 활용될 수 있을 것으로 기대된다.
도 1은 인간 클라우딘-18.2(CLDN18.2)가 발현되어 있지 않은 HEK293E 세포주를 이용한 유세포 분석 결과이다.
도 2는 CLDN18.2가 과발현된 HEK293E 세포주(HEK293E/18.2)를 이용한 유세포 분석 결과이다.
도 3은 CLDN18.2가 과발현된 CHO-K1 세포주(CHO-K1/18.2)를 이용한 유세포 분석 결과이다.
도 4는 인간 CLDN18.2를 코팅 항원으로 한 ELISA 분석 결과이다.
도 5는 인간 CLDN18.1을 코팅 항원으로 한 ELISA 분석 결과이다.
도 6 은 BxPC3 세포주(내생적으로 인간 CLDN18.1를 발현하는 세포주)를 이용한 유세포 분석 결과이다.
도 7은 도 6에 사용된 BxPC3 세포주의 CLDN18.1 발현 수준을 유세포 분석으로 확인한 결과이다.
도 8은 HEK293E 세포주(CLDN18.2 음성)에서 단클론항체의 세포내재화(internalization)능을 라이브 세포 분석기기(Incucyte)로 분석한 것이다.
도 9는 HEK293E/18.2 세포주(CLDN18.2 과발현)에서 단클론항체의 세포내재화능을 분석한 것이다.
도 10 및 도 11은 세포면역형광법(cell immunofluorescence staining)을 통해 CHO-K1/18.2 세포주(CLDN18.2 과발현)에서 단클론항체의 세포내재화능을 분석한 것이다.
도 12는 HEK293E/18.2 세포주(CLDN18.2 과발현)에서 단클론항체의 세포내재화 및 세포용해(cytolytic) 활성을 FabZAP 어세이를 통해 분석한 것이다.
도 13은 HEK293E 세포주(CLDN18.2 음성)에서 단클론항체의 세포내재화 및 세포용해(cytolytic) 활성을 FabZAP 어세이를 통해 분석한 것이다.
도 14는 CLDN18.2에 특이적인 단클론항체의 열 안정성을 시차 주사 형광측정법(Differential scanning fluorimetry)을 통해 분석한 결과이다.
도 2는 CLDN18.2가 과발현된 HEK293E 세포주(HEK293E/18.2)를 이용한 유세포 분석 결과이다.
도 3은 CLDN18.2가 과발현된 CHO-K1 세포주(CHO-K1/18.2)를 이용한 유세포 분석 결과이다.
도 4는 인간 CLDN18.2를 코팅 항원으로 한 ELISA 분석 결과이다.
도 5는 인간 CLDN18.1을 코팅 항원으로 한 ELISA 분석 결과이다.
도 6 은 BxPC3 세포주(내생적으로 인간 CLDN18.1를 발현하는 세포주)를 이용한 유세포 분석 결과이다.
도 7은 도 6에 사용된 BxPC3 세포주의 CLDN18.1 발현 수준을 유세포 분석으로 확인한 결과이다.
도 8은 HEK293E 세포주(CLDN18.2 음성)에서 단클론항체의 세포내재화(internalization)능을 라이브 세포 분석기기(Incucyte)로 분석한 것이다.
도 9는 HEK293E/18.2 세포주(CLDN18.2 과발현)에서 단클론항체의 세포내재화능을 분석한 것이다.
도 10 및 도 11은 세포면역형광법(cell immunofluorescence staining)을 통해 CHO-K1/18.2 세포주(CLDN18.2 과발현)에서 단클론항체의 세포내재화능을 분석한 것이다.
도 12는 HEK293E/18.2 세포주(CLDN18.2 과발현)에서 단클론항체의 세포내재화 및 세포용해(cytolytic) 활성을 FabZAP 어세이를 통해 분석한 것이다.
도 13은 HEK293E 세포주(CLDN18.2 음성)에서 단클론항체의 세포내재화 및 세포용해(cytolytic) 활성을 FabZAP 어세이를 통해 분석한 것이다.
도 14는 CLDN18.2에 특이적인 단클론항체의 열 안정성을 시차 주사 형광측정법(Differential scanning fluorimetry)을 통해 분석한 결과이다.
본 발명의 목적을 달성하기 위하여, 본 발명은 서열번호 1로 기재된 중쇄 CDR (complementarity-determining region) 1; 서열번호 2로 기재된 중쇄 CDR2; 및 서열번호 3으로 기재된 중쇄 CDR3를 포함하는 중쇄가변영역과, 서열번호 5로 기재된 경쇄 CDR1; 아미노산 서열 DVS로 이루어진 경쇄 CDR2; 및 서열번호 6으로 기재된 경쇄 CDR3를 포함하는 경쇄가변영역을 포함하는, 클라우딘-18.2(claudin-18 spliced variant 2, CLDN18.2)에 특이적으로 결합하는 단클론항체 또는 이의 항원 결합 단편을 제공한다.
본 발명은 또한, 서열번호 1로 기재된 중쇄 CDR1; 서열번호 2로 기재된 중쇄 CDR2; 및 서열번호 8로 기재된 중쇄 CDR3를 포함하는 중쇄가변영역과, 서열번호 10으로 기재된 경쇄 CDR1; 아미노산 서열 AAS로 이루어진 경쇄 CDR2; 및 서열번호 11로 기재된 경쇄 CDR3를 포함하는 경쇄가변영역을 포함하는, 클라우딘-18.2에 특이적으로 결합하는 단클론항체 또는 이의 항원 결합 단편을 제공한다.
본 발명은 또한, 서열번호 1로 기재된 중쇄 CDR1; 서열번호 2로 기재된 중쇄 CDR2; 및 서열번호 13으로 기재된 중쇄 CDR3를 포함하는 중쇄가변영역과, 서열번호 15로 기재된 경쇄 CDR1; 아미노산 서열 GAF로 이루어진 경쇄 CDR2; 및 서열번호 11로 기재된 경쇄 CDR3를 포함하는 경쇄가변영역을 포함하는, 클라우딘-18.2에 특이적으로 결합하는 단클론항체 또는 이의 항원 결합 단편을 제공한다.
본 발명에 따른 서열번호 1로 기재된 중쇄 CDR1; 서열번호 2로 기재된 중쇄 CDR2; 및 서열번호 3으로 기재된 중쇄 CDR3를 포함하는 중쇄가변영역과, 서열번호 5로 기재된 경쇄 CDR1; 아미노산 서열 DVS로 이루어진 경쇄 CDR2; 및 서열번호 6으로 기재된 경쇄 CDR3를 포함하는 경쇄가변영역을 포함하는 클라우딘-18.2에 특이적으로 결합하는 단클론항체는 보다 구체적으로는, 서열번호 4의 아미노산 서열로 기재된 중쇄가변영역 및 서열번호 7의 아미노산 서열로 기재된 경쇄가변영역을 포함하는 것일 수 있고,
서열번호 1로 기재된 중쇄 CDR1; 서열번호 2로 기재된 중쇄 CDR2; 및 서열번호 8로 기재된 중쇄 CDR3를 포함하는 중쇄가변영역과, 서열번호 10으로 기재된 경쇄 CDR1; 아미노산 서열 AAS로 이루어진 경쇄 CDR2; 및 서열번호 11로 기재된 경쇄 CDR3를 포함하는 경쇄가변영역을 포함하는 클라우딘-18.2에 특이적으로 결합하는 단클론항체는 보다 구체적으로는, 서열번호 9의 아미노산 서열로 기재된 중쇄가변영역 및 서열번호 12의 아미노산 서열로 기재된 경쇄가변영역을 포함하는 것일 수 있으며,
서열번호 1로 기재된 중쇄 CDR1; 서열번호 2로 기재된 중쇄 CDR2; 및 서열번호 13으로 기재된 중쇄 CDR3를 포함하는 중쇄가변영역과, 서열번호 15로 기재된 경쇄 CDR1; 아미노산 서열 GAF로 이루어진 경쇄 CDR2; 및 서열번호 11로 기재된 경쇄 CDR3를 포함하는 경쇄가변영역을 포함하는 클라우딘-18.2에 특이적으로 결합하는 단클론항체는 보다 구체적으로는, 서열번호 14의 아미노산 서열로 기재된 중쇄가변영역 및 서열번호 16의 아미노산 서열로 기재된 경쇄가변영역을 포함하는 것일 수 있다.
본 발명에서 용어 "단클론항체"란 단일한 항원성 부위(단일 에피토프)에 대해서 지시되어 이와 특이적인 결합을 하는 단백질 분자를 의미한다. 상기 단클론항체는 당해 기술 분야에 공지된 다양한 방법을 통해 제조될 수 있다.
본 발명에서 항체(antibody)는 전체(whole) 항체 형태를 의미하며, 전체 항체는 2개의 전체 길이의 경쇄 및 2개의 전체 길이의 중쇄를 가지는 구조이며 각각의 경쇄는 중쇄와 디설파이드 결합으로 연결되어 있다. 상기 전체 항체는 IgA (immunoglobulin A), IgD, IgE, IgM 및 IgG를 포함하며, IgG는 아형(subtype)으로, IgG1, IgG2, IgG3 및 IgG4를 포함한다. 또한, 중쇄 불변영역은 감마(γ), 뮤(μ), 알파(α), 델타(δ) 및 엡실론(ε) 타입을 가지며, 서브클래스로 감마1(γ1), 감마2(γ2), 감마3(γ3), 감마4(γ4), 알파1(α1) 및 알파2(α2)를 가진다. 경쇄의 불변영역은 카파(κ) 및 람다(λ) 타입을 가진다.
본 발명의 단클론 항체는 인간항체(fully human antibody), 인간화 항체(humanized antibody), 키메릭 항체(chimeric antibody), 마우스 항체(mouse antibody) 및 재조합 항체로 이루어진 군으로부터 선택되는 것일 수 있고, 바람직하게는 인간항체일 수 있으나, 이에 제한되지 않는다. 상기 인간항체는 모든 구조가 인간으로부터 유래되었기 때문에, 기존의 인간화 항체 또는 마우스 항체에 비해서 면역화 반응이 일어날 확률이 적어서 인간에게 투여하였을 경우 원하지 않는 면역반응이 일어나지 않는 장점이 있다. 따라서 치료용 항체로서 매우 유용하게 사용될 수 있다.
본 발명에서 용어 "항원 결합 단편"이란, 항원 결합 기능을 보유하고 있는 단편을 뜻하며 Fab, F(ab'), F(ab')2 및 Fv 등을 포함한다. 항체 단편 중 Fab는 경쇄 및 중쇄의 가변영역과 경쇄의 불변영역 및 중쇄의 첫 번째 불변영역(CH1)을 가지는 구조로 1개의 항원 결합 부위를 가진다. Fab'는 중쇄 CH1 도메인의 C 말단에 하나 이상의 시스테인 잔기를 포함하는 힌지 영역(hinge region)을 가진다는 점에서 Fab와 차이가 있다. F(ab')2 항체는 Fab'의 힌지 영역의 시스테인 잔기가 디설파이드 결합을 이루면서 생성된다. Fv는 중쇄 가변부위 및 경쇄 가변 부위만을 가지고 있는 최소의 항체조각으로 Fv 단편을 생성하는 재조합 기술은 국제공개 특허 WO 88/10649 등에 개시되어 있다. 이중쇄 Fv(dsFv)는 디설파이드 결합으로 중쇄 가변부위와 경쇄 가변부위가 연결되어 있고 단쇄 Fv(scFv)는 일반적으로 펩타이드 링커를 통하여 중쇄의 가변영역과 경쇄의 가변영역이 공유결합으로 연결되어 있다. 이러한 항체 단편은 단백질 가수분해 효소를 이용해서 얻을 수 있고(예를 들어, 전체 항체를 파파인으로 제한 절단하면 Fab를 얻을 수 있고, 펩신으로 절단하면 F(ab')2 단편을 얻을 수 있다), 바람직하게는 유전자 재조합 기술을 통하여 제작할 수 있다.
본 발명에서 용어 "가변영역(variable region)"이란 항원과 특이적으로 결합하는 기능을 수행하면서 서열상의 많은 변이를 보이는 부위를 의미하고, 가변영역에는 상보성결정영역인 CDR1, CDR2 및 CDR3가 존재한다. 상기 상보성결정영역 사이에는 프레임워크 영역(FR, framework region) 부분이 존재하여 상보성결정영역 고리를 지지해주는 역할을 한다.
본 발명에서 용어 "상보성결정영역(CDR, complementarity determining region)"은 항원의 인식에 관여하는 고리모양의 부위로서 이 부위의 서열이 변함에 따라 항체의 항원에 대한 특이성이 결정된다.
본 발명의 일 실시예에 의하면, 본 발명자들은 천연 인간 단쇄 Fv 라이브러리(native human single chain Fv library)로부터 클라우딘-18.2에 특이적으로 결합하는 scFv를 스크리닝한 다음, 이를 IgG 형태로 전환(conversion)함으로써 클라우딘-18.2에 특이적으로 결합하는 인간항체를 제조하였다.
본 발명에서 용어 "바이오 패닝(biopanning)"은 파지의 외벽(coat)에 펩타이드를 발현(display)하는 파아지 라이브러리로부터, 표적 분자(항체, 효소, 세포표면 리셉터 등)과 결합하는 성질을 지닌 펩타이드를 표면에 발현하고 있는 파지만을 선택해 내는 과정을 일컫는다.
본 발명의 단클론항체 또는 이의 항원 결합 단편은 특별히 이에 제한되지 않으나, 투여된 생체 내에서의 체류시간을 증진시키기 위하여, 당화(glycosylation) 및/또는 페길화(PEGylation)될 수 있다.
본 발명의 용어 "당화(glycosylation)"는 글리코실기를 단백질에 전위시키는 가공방법을 의미한다. 상기 당화는 글리코실 전달효소에 의해 글리코실기가 표적 단백질의 세린, 트레오닌, 아스파라긴 또는 히드록실리신 잔기에 결합되어 수행되는데, 상기 당화된 단백질은 생체조직의 구성물질로서 사용될 수 있을 뿐만 아니라, 세포표면에서 세포인식에도 중요한 역할을 수행한다. 따라서, 본 발명에서는 단클론항체 또는 이의 항원 결합 단편의 당화 또는 상기 당화의 패턴을 변화시켜서 항체의 효과를 향상시킬 수 있다.
본 발명의 용어 "페길화(PEGlation)"는 상기 단클론항체 또는 이의 항원 결합 단편에 폴리에틸렌글리콜을 도입함으로써, 항체의 혈중 체류시간을 향상시키는 가공방법을 의미한다. 구체적으로, 폴리에틸렌글리콜로 고분자 나노 입자를 페길화하는 것에 의해, 나노 입자의 표면의 친수성이 증가되며 병원균, 노폐물 및 외부 유입 물질을 포식하고 소화시키는 인체 내의 대식세포(macrophage) 등을 포함하는 면역 기능으로부터의 인식을 방지하는 소위 스텔스 효과(stealth effect)를 통한 신체 내에서의 빠른 분해가 방지될 수 있다. 따라서, 상기 페길화에 의하여 항체의 혈중 체류 시간이 향상될 수 있다. 본 발명에서 사용되는 페길화는 히알루론산의 카르복실 그룹과 폴리에틸렌글리콜의 아민 그룹의 결합에 의해 아미드 그룹을 형성하는 방법으로 형성될 수 있으나, 이에 제한되지 않으며, 다양한 방법으로 페길화를 수행할 수 있다. 이때, 사용되는 폴리에틸렌글리콜은 특별히 이에 제한되지 않으나, 바람직하게는 100 내지 1,000 사이의 분자량을 갖고, 선형 또는 가지형의 구조를 가지는 것을 사용함이 바람직하다.
상기 당화 및/또는 페길화는 본 발명의 항체의 기능을 유지하는 한 당업계의 공지된 방법에 의해 다양한 당화 및/또는 페길화 패턴이 변형될 수 있고, 본 발명의 항체는 다양한 당화 및/또는 페길화 패턴이 변형된 변이 단클론항체 또는 이의 항원 결합 단편을 모두 포함한다.
용어 "친화도"는 항원의 특정 부위를 특이적으로 인식하고 결합하는 능력으로, 항체의 항원에 대한 특이성과 함께 고도의 친화도는 면역 반응에서 중요한 요소이다. 항원에 대한 친화도 측정 방법은 당업계에 공지된 다양한 방법을 사용할 수 있고, 표면 플라즈몬 공명 기술(surface plasmon resonance technology)이 그의 예이다.
본 발명은 또한, 본 발명의 단클론항체 또는 이의 항원 결합 단편의 중쇄가변영역 및 경쇄가변영역을 코딩하는 폴리뉴클레오티드를 제공한다.
본 발명의 단클론항체 또는 이의 항원 결합 단편의 경쇄 및 중쇄를 암호화하는 폴리뉴클레오티드는 코돈의 축퇴성(degeneracy)으로 인하여 또는 상기 인간항체의 경쇄 및 중쇄 또는 그의 단편을 발현시키고자 하는 생물에서 선호되는 코돈을 고려하여, 코딩영역으로부터 발현되는 항체의 경쇄 및 중쇄의 아미노산 서열을 변화시키지 않는 범위 내에서 코딩영역에 다양한 변형이 이루어질 수 있고, 코딩영역을 제외한 부분에서도 유전자의 발현에 영향을 미치지 않는 범위 내에서 다양한 변형 또는 수식이 이루어질 수 있으며, 그러한 변형 유전자 역시 본 발명의 범위에 포함됨을 당업자는 잘 이해할 수 있을 것이다. 즉, 본 발명의 폴리뉴클레오티드는 이와 동등한 활성을 갖는 단백질을 코딩하는 한, 하나 이상의 핵산 염기가 치환, 결실, 삽입 또는 이들의 조합에 의해 변이될 수 있으며, 이들 또한 본 발명의 범위에 포함된다. 이러한 폴리뉴클레오티드의 서열은 단쇄 또는 이중쇄일 수 있으며, DNA 분자 또는 RNA(mRNA) 분자일 수 있다.
본 발명은 또한, 본 발명의 단클론항체 또는 이의 항원 결합 단편의 중쇄 및 경쇄 가변영역을 코딩하는 폴리뉴클레오티드를 포함하는 발현 벡터를 제공한다.
본 발명에서 용어 "발현 벡터"란 숙주세포에서 목적유전자를 발현시키기 위한 수단으로 플라스미드 벡터; 코스미드(cosmid) 벡터, 아데노바이러스(Adenovirus) 벡터, 레트로바이러스(Retrovirus) 벡터 및 아데노-연관 바이러스(adeno-associated virus) 벡터 같은 바이러스 벡터 등을 포함하며, 유전자 삽입물이 발현되도록 작동가능하게 연결된 필수적인 조절 요소를 포함하는 유전자 작제물을 말한다. 본 발명에서 "작동가능하게 연결된(operably linked)"이란 일반적 기능을 수행하도록 핵산 발현조절 서열과 목적하는 단백질을 코딩하는 폴리뉴클레오티드가 기능적으로 연결되어 있는 것을 말한다. 발현 벡터와의 작동적 연결은 당해 기술분야에서 잘 알려진 유전자 재조합 기술을 이용하여 제조할 수 있으며, 부위-특이적 DNA 절단 및 연결은 당해 기술 분야에서 일반적으로 알려진 효소 등을 사용하여 용이하게 할 수 있다.
본 발명의 적합한 발현 벡터는 프로모터(promoter), 개시코돈(initiation codon), 종결코돈(termination codon), 폴리아데닐화 시그널(polyadenylation signal) 및 인핸서(enhancer) 같은 발현 조절 요소 외에도 막 표적화 또는 분비를 위한 시그널 서열을 포함할 수 있다. 개시 코돈 및 종결 코돈은 일반적으로 면역원성 표적 단백질을 코딩하는 뉴클레오타이드 서열의 일부로 간주되며, 유전자 작제물이 투여되었을 때 개체에서 반드시 작용을 나타내야 하며 코딩 서열과 인프레임(in frame)에 있어야 한다. 프로모터는 구성적 또는 유도성일 수 있다. 원핵 세포에는 Lac, Tac, T3 또는 T7 프로모터가 있으나 이로 제한되지는 않는다. 진핵세포에는 원숭이 바이러스 40(Simian virus 40, SV40) 프로모터, 마우스 유방종양 바이러스(Mouse mammary tumor virus, MMTV) 프로모터, 사람 면역 결핍 바이러스(Human immunodeficiency virus, HIV) 프로모터, HIV의 긴 말단 반복부(LTR) 프로모터, 몰로니(moloney) 바이러스 프로모터, 시토메갈로바이러스(Cytomegalovirus, CMV) 프로모터, 엡스타인바 바이러스(Epstein-Barr virus, EBV) 프로모터 뿐만 아니라, β액틴 프로모터, 사람 헤모글로빈, 사람 근육 크레아틴, 사람 메탈로티오네인 유래의 프로모터가 있으나, 이로 제한되지 않는다.
발현 벡터는 벡터를 함유하는 숙주 세포를 선택하기 위한 선택성 마커를 포함할 수 있다. 선택마커는 벡터로 형질전환된 세포를 선별하기 위한 것으로, 약물 내성, 영양 요구성, 세포 독성제에 대한 내성 또는 표면 단백질의 발현과 같은 선택가능 표현형을 부여하는 마커들이 사용될 수 있다. 선택제(selective agent)가 처리된 환경에서 선별 마커를 발현하는 세포만 생존하므로 형질전환된 세포가 선별 가능하다.
또한, 벡터는 복제가능한 발현벡터인 경우, 복제가 개시되는 특정 폴리뉴클레오티드인 복제원점(replication origin)을 포함할 수 있다. 바이러스(예를 들어, 바쿨로바이러스) 또는 파지 벡터, 및 레트로바이러스 벡터와 같은 숙주 세포의 게놈내로 삽입될 수 있는 벡터도 사용 가능하다. 전체 항체 또는 항체 단편을 발현하는 벡터는, 경쇄와 중쇄가 하나의 벡터에서 동시에 발현되는 벡터 시스템이거나 또는 경쇄와 중쇄를 각각 별도의 벡터에서 발현시키는 시스템 모두 가능하다. 후자의 경우, 두 벡터는 동시 형질전환(cotransformation) 및 표적 형질전환(targeted transformation)을 통하여 숙주세포로 도입하고, 경쇄(또는 중쇄)를 함유하는 벡터로 형질전환된 세포를 선별하고 경쇄를 발현하는 선별된 세포를 중쇄(또는 경쇄)를 포함하는 벡터로 다시 형질전환하여 경쇄 및 중쇄 모두를 발현하는 세포를 최종적으로 선별한다.
Fab 형태의 항체를 제작하기 위해서, 인간 경쇄의 가변영역(VL)과 불변영역(CL) 및 인간 중쇄의 가변영역(VH)과 첫 번째 불변 영역 도메인(CH1)의 아미노산을 코딩하는 유전자를 삽입한 벡터를 이용한다.
본 발명은 또한, 본 발명의 상기 발현 벡터로 형질전환된 인간을 제외한 형질전환체를 제공한다.
상기 벡터의 적합한 숙주세포는 대장균(Escherichia coli), 바실러스 서브틸리스(Bacillus subtilis), 스트렙토마이세스 속(Streptomyces sp.), 슈도모나스 속(Pseudomonas sp.), 프로테우스 미라빌리스(Proteus mirabilis) 또는 스타필로코쿠스 속(Staphylococcus sp.)과 같은 원핵 세포, 아스퍼질러스 속(Aspergillus sp.)과 같은 진균, 피치아 파스토리스(Pichia pastoris), 사카로마이세스 세레비지애(Saccharomyces cerevisiae), 쉬조사카로마세스 속(Schizosaccharomyces sp.) 및 뉴로스포라 크라사(Neurospora crassa)와 같은 효모, 그 밖의 하등 진핵 세포, 및 곤충 세포와 같은 고등 진핵생물의 세포와 식물 세포일 수 있다. 또한 포유동물로부터 유래된 COS-7, BHK, CHO, CHO-K1, DXB-11, DG-44, CHO/-DHFR, CV1, COS-7, HEK293, BHK, TM4, VERO, HELA, MDCK, BRL3A, W138, Hep G2, SK-Hep, MMT, TRI, MRC 5, FS4, 3T3, RIN, A549, PC12, K562, PER.C6, SP2/0, NS-0, U20S 또는 HT1080 세포를 포함할 수 있으나, 이에 제한되는 것은 아니다.
본 발명에서 "숙주세포로의 형질 전환"은 핵산을 유기체, 세포, 조직 또는 기관에 도입하는 어떤 방법도 포함되며 당 분야에서 공지된 바와 같이 숙주 세포에 따라 적합한 표준 기술을 선택하여 수행할 수 있다. 이런 방법에는 전기충격유전자전달법(electroporation), 원형질 융합, 인산 칼슘(CaPO4) 침전, 염화 칼슘(CaCl2) 침전, 실리콘 카바이드 섬유 이용한 교반, 아그로박테리아 매개된 형질전환, PEG (Polyethylene glycol), 덱스트란 설페이트, 리포펙타민(lipofectamine) 및 건조/억제 매개된 형질전환 방법 등이 포함되나, 이에 제한되지 않는다.
본 발명은 또한,
(a) 상기 형질전환체를 배양하여 배양액을 제조하는 단계; 및
(b) 상기 (a) 단계의 배양액으로부터 본 발명의 단클론항체 또는 이의 항원 결합 단편을 정제하는 단계를 포함하는, 클라우딘-18.2에 특이적으로 결합하는 단클론항체 또는 이의 항원 결합 단편을 제조하는 방법을 제공한다.
상기 제조방법에 있어서 형질전환체의 배양은 당업계에 알려진 적당한 배지와 배양조건에 따라 이루어질 수 있다. 이러한 배양과정은 당업자라면 선택되는 균주 또는 세포의 종류에 따라 용이하게 조정하여 사용할 수 있다.
또한, 형질전환체를 배양하여 수득한 항체는 정제하지 않은 상태로 사용될 수 있으며 추가로 다양한 통상의 방법, 예를 들면 원심분리 또는 한외여과(ultrafiltration)에 의해 불순물을 제거하고, 그 결과물을 투석, 염 침전, 크로마토그래피 등을 이용하여 정제할 수 있으며, 이들을 단독 또는 조합하여 이용할 수 있다. 그 중에서 친화 크로마토그래피가 가장 많이 사용되며, 이온교환 크로마토그래피, 크기배제 크로마토그래피, 소수성 상호작용 크로마토그래피, 히드록실아파타이트 크로마토그래피 등이 있다. 상기 방법으로 제작된 항체는 항원에 대한 친화도(affinity)가 증가된 항체이다.
본 발명은 또한, 상기 클라우딘-18.2에 특이적으로 결합하는 단클론항체 또는 이의 항원 결합 단편을 유효성분으로 포함하는 암 치료용 약학 조성물을 제공한다.
상기 단클론항체 또는 이의 항원 결합 단편에 대해서는 전술한 바와 같다.
본 발명의 약학 조성물은 대상체에 본 발명의 항체를 투여하면 대상체에서 종양의 성장이 억제되도록 한다.
본 발명의 용어, "암의 치료"는 상기 조성물의 투여에 의해 암의 증세가 호전되거나 이롭게 변경되는 모든 행위를 의미한다.
본 발명에 따른 약학 조성물에 있어서, 상기 암은 췌장암, 식도암, 난소암, 폐암, 위암, 대장암, 간암, 담도암, 유방암, 신장암, 중피종(mesothelioma) 및 두경부암으로 구성되는 군으로부터 선택되는 것일 수 있으나, 이에 제한되지 않는다.
본 발명의 상기 약학 조성물은 약학적으로 허용가능한 담체를 추가로 포함할 수 있고, 상기 담체는 비자연적 담체(nonnaturally occuring carrier)를 포함할 수 있다.
본 발명에서 용어, "약학적으로 허용가능한 담체"는 생물체를 자극하지 않고 투여 화합물의 생물학적 활성 및 특성을 저해하지 않는 담체 또는 희석제를 의미한다. 액상 용액으로 제제화되는 조성물에 허용되는 약학적 담체로는, 멸균 및 생체에 적합한 것으로서, 식염수, 멸균수, 링거액, 완충 식염수, 알부민 주사용액, 덱스트로즈 용액, 말토 덱스트린 용액, 글리세롤, 에탄올 및 이들 성분 중 하나 이상의 성분을 혼합하여 사용할 수 있으며, 필요에 따라 항산화제, 완충액, 정균제 등 다른 통상의 첨가제를 첨가할 수 있다. 또한, 희석제, 분산제, 계면활성제, 결합제 및 윤활제를 부가적으로 첨가하여 수용액, 현탁액, 유탁액 등과 같은 주사용 제형, 환약, 캡슐, 과립 또는 정제로 제제화할 수 있다.
본 발명의 상기 단클론항체 및 약학적으로 허용 가능한 담체를 포함하는 암 치료용 조성물은 이를 유효성분으로 포함하는 어떠한 제형으로도 적용가능하며, 경구용 또는 비경구용 제형으로 제조할 수 있다. 본 발명의 약학적 제형은 구강(oral), 직장(rectal), 비강(nasal), 국소(topical; 볼 및 혀 밑을 포함), 피하, 질(vaginal) 또는 비경구(parenteral; 근육내, 피하 및 정맥내를 포함) 투여에 적당한 것 또는 흡입(inhalation)에 의한 투여에 적당한 형태를 포함한다.
본 발명의 약학 조성물을 유효성분으로 포함하는 경구 투여용 제형으로는, 예를 들어 정제, 트로키제, 로렌지, 수용성 또는 유성현탁액, 조제분말 또는 과립, 에멀젼, 하드 또는 소프트 캡슐, 시럽 또는 엘릭시르제로 제제화할 수 있다. 정제 및 캡슐 등의 제형으로 제제화하기 위해, 락토오스, 사카로오스, 솔비톨, 만니톨, 전분, 아밀로펙틴, 셀룰로오스 또는 젤라틴과 같은 결합제, 디칼슘 포스페이트와 같은 부형제, 옥수수 전분 또는 고구마 전분과 같은 붕괴제, 스테아르산 마스네슘, 스테아르산 칼슘, 스테아릴푸마르산 나트륨 또는 폴리에틸렌글리콜 왁스와 같은 윤활유를 포함할 수 있으며, 캡슐제형의 경우 상기 언급한 물질 외에도 지방유와 같은 액체 담체를 더 함유할 수 있다.
본 발명의 약학 조성물을 유효성분으로 포함하는 비경구 투여용 제형으로는, 피하주사, 정맥주사 또는 근육내 주사 등의 주사용 형태, 좌제 주입방식 또는 호흡기를 통하여 흡입이 가능하도록 하는 에어로졸제 등 스프레이용으로 제제화할 수 있다. 주사용 제형으로 제제화하기 위해서는 본 발명의 조성물을 안정제 또는 완충제와 함께 물에서 혼합하여 용액 또는 현탁액으로 제조하고, 이를 앰플 또는 바이알의 단위 투여용으로 제제화할 수 있다. 좌제로 주입하기 위해서는, 코코아버터 또는 다른 글리세라이드 등 통상의 좌약 베이스를 포함하는 좌약 또는 관장제와 같은 직장투여용 조성물로 제제화할 수 있다. 에어로졸제 등의 스프레이용으로 제형화하는 경우, 수분산된 농축물 또는 습윤 분말이 분산되도록 추진제 등이 첨가제와 함께 배합될 수 있다.
또한, 상기 약학 조성물은 약학적으로 유효한 양으로 투여될 수 있다.
본 발명에서 용어, "약학적으로 유효한 양"은 의학적 치료에 적용 가능한 합리적인 수혜/위험 비율로 질환을 치료하기에 충분한 양을 의미하며, 유효 용량 수준은 개체 종류 및 중증도, 연령, 성별, 암의 종류, 약물의 활성, 약물에 대한 민감도, 투여 시간, 투여 경로 및 배출 비율, 치료기간, 동시 사용되는 약물을 포함한 요소 및 기타 의학 분야에 잘 알려진 요소에 따라 결정될 수 있다. 본 발명의 조성물은 개별 치료제로 투여하거나 다른 치료제와 병용하여 투여될 수 있고 종래의 치료제와는 순차적 또는 동시에 투여될 수 있다. 그리고 단일 또는 다중 투여될 수 있다. 상기 요소를 모두 고려하여 부작용 없이 최소한의 양으로 최대 효과를 얻을 수 있는 양을 투여하는 것이 중요하며, 당업자에 의해 용이하게 결정될 수 있다.
본 발명의 상기 약학 조성물은 항암효과를 갖는 공지의 유효성분을 1종 이상 추가로 포함할 수 있으며, 상기 항암효과를 갖는 공지의 유효성분은 바람직하게는 화학요법제 또는 면역관문억제제일 수 있으나, 이에 제한되지 않는다.
상기 화학요법제는 카보플라틴(Carboplatin), 파클리탁셀(Paclitaxel) 등의 알킬화 계열 항암제; 젬시타빈(Gemcitabin) 등의 대사 길항제 계열 항암제; 독소루비신(Doxorubicin) 등의 안트라사이클린 계열 항암제; 및 보테조밉(Bortezomib) 등의 프로테아좀 억제제 계열항암제;로 이루어진 군에서 선택된 1종 이상일 수 있으나, 이에 제한되지 않으며, 상기 면역관문억제제는 PD-1, PD-L1, BTLA, CTLA-4, VISTA, LAG3, TIM3, CD137(4-1BB), VISTA, CD258(LIGHT), TIGIT, CD134(OX40), CD28, CD278(ICOS), CD27, CD154(CD40L), CD357(GITR), CD30, DR3, CD226(DNAM1), CD96, CD200, CD200R, Transferrin receptor, c-Met, EGFR, HER2, KDR, PDGFRa, NRP1, MARCO으로 구성된 군에서 선택된 하나 이상을 타겟으로 하는 것일 수 있으나, 이에 제한되지 않는다.
본 발명은 또한, 상기 암 치료용 약학 조성물을 개체에 투여하는 단계를 포함하는, 암을 치료하는 방법을 제공한다.
본 발명에서 용어, "투여"는 어떠한 적절한 방법으로 환자에게 본 발명의 약제학적 조성물을 도입하는 것을 의미한다. 본 발명의 조성물의 투여 경로는 목적 조직에 도달할 수 있는 한 경구 또는 비경구의 다양한 경로를 통하여 투여될 수 있으며, 구체적으로, 구강, 직장, 국소, 정맥내, 복강내, 근육내, 동맥내, 경피, 비측내, 흡입, 안구 내 또는 피내(intradermal) 경로를 통해 통상적인 방식으로 투여될 수 있다.
본 발명의 치료방법은 본 발명의 암 치료용 조성물을 약학적 유효량으로 투여하는 것을 포함한다. 적합한 총 1일 사용량은 올바른 의학적 판단범위 내에서 처치의에 의해 결정될 수 있다는 것은 당업자에게 자명한 일이다. 특정 환자에 대한 구체적인 치료적 유효량은 달성하고자 하는 반응의 종류와 정도, 경우에 따라 다른 제제가 사용되는지의 여부를 비롯한 구체적 조성물, 환자의 연령, 체중, 일반 건강 상태, 성별 및 식이, 투여 시간, 투여 경로 및 조성물의 분비율, 치료기간, 구체적 조성물과 함께 사용되거나 동시 사용되는 약물을 비롯한 다양한 인자와 의약 분야에 잘 알려진 유사 인자에 따라 다르게 적용하는 것이 바람직하다. 따라서 본 발명의 목적에 적합한 암의 예방 또는 치료용 조성물의 유효량은 전술한 사항을 고려하여 결정하는 것이 바람직하다.
또한, 상기 개체는 클라우딘-18.2의 과도한 활성으로 인하여 종양 발달과 신생혈관생성 등의 질병이 발생할 수 있는 임의의 동물을 의미하는 것으로, 상기 동물은 인간 및 영장류뿐만 아니라, 소, 돼지, 양, 말, 개 및 고양이 등의 가축을 포함할 수 있고, 바람직하게는 인간을 제외한 포유동물일 수 있으나, 이에 제한되지 않는다.
본 발명은 또한, 상기 클라우딘-18.2에 특이적으로 결합하는 단클론항체 또는 이의 항원 결합 단편을 포함하는 암 진단용 조성물 및 상기 암 진단용 조성물을 포함하는 암 진단용 키트를 제공한다.
상기 단클론항체 또는 이의 항원 결합 단편, 그리고 암에 대해서는 전술한 바와 같다. 본 발명의 클라우딘-18.2에 특이적인 단클론항체 또는 이의 항원 결합 단편을 포함하는 진단용 조성물을 사용하여 클라우딘-18.2의 발현 여부와 발현 정도와 관련된 질환, 예컨대 암을 진단할 수 있다.
상기 암을 진단하는 방법은 본 발명의 클라우딘-18.2에 특이적인 단클론항체를 암이 의심되는 개체의 분리된 생물학적 시료와 반응시키고 항원-항체 복합체 형성을 분석함으로써 검출할 수 있으며, 이를 통해 암의 진단을 위한 정보를 제공할 수 있다.
본 발명에서 용어 "생물학적 시료"란, 조직, 세포, 전혈, 혈청, 혈장, 조직 부검 시료(뇌, 피부, 림프절, 척수 등), 세포 배양 상등액, 파열된 진핵세포 및 세균 발현계 등을 들 수 있으나, 이에 제한되는 것은 아니다. 이들 생물학적 시료를 조작하거나 조작하지 않은 상태로 본 발명의 항체와 반응시켜 클라우딘-18.2의 존재 또는 암의 유무를 확인할 수 있다.
본 발명에서 용어 "항원-항체 복합체"란, 시료 중의 클라우딘-18.2 단백질 항원과 이를 인지하는 본 발명에 따른 단클론항체 또는 이의 항원 결합 단편의 결합물을 의미하며, 이러한 항원-항체 복합체의 형성은 통상적인 면역분석 방법에 따라 측정할 수 있으며, 상기 클라우딘-18.2에 대한 항체를 이용한 방사선 면역측정법(radioimmunoassay), 방사선 면역침전법(radioimmunoprecipitation), 면역침전, 면역조직화학염색(immunohistochemistry), ELISA(enzyme-linked immunosorbant assay), 캡처-ELISA, 억제 또는 경쟁 분석, 샌드위치 분석, 유세포 분석(flow cytometry) 및 형광면역분석(fluorescenceimmunoassay)을 통해 측정할 수 있으나, 이에 한정되는 것은 아니다.
상기 면역분석 과정에 의한 최종적인 시그널의 세기를 분석함으로써, 암을 진단할 수 있다. 즉, 의심되는 개체로부터 분리한 생물학적 시료에서 본 발명의 클라우딘-18.2 단백질이 과발현되어 시그널이 정상 개체로부터 분리한 생물학적 시료보다 강하게 나오는 경우에는 암으로 진단된다.
또한, 본 발명에 따른 키트는 본 발명의 클라우딘-18.2에 대한 항체를 포함하고, 시료와 항체가 반응함으로써 나타내는 시그널을 분석하여, 암을 진단할 수 있다. 이 때, 상기 시그널은 항체에 결합된 효소 (예를 들어, 알칼린 포스파타아제, β-갈락토시다아제, 호스 래디쉬 퍼옥시다아제, 루시퍼라아제 또는 사이토크롬 P450 등)에 의해 나타날 수 있고, 이 때 효소에 대한 기질은 효소로서 알칼린 포스파타아제가 이용되는 경우에는, 기질로서 브로모클로로인돌일 포스페이트(BCIP), 니트로 블루 테트라졸리움(nitroblue tetrazolium, NBT), 나프톨-AS-B1-포스페이트(naphthol-AS-B1-phosphate) 및 ECF (enhanced chemifluorescence)와 같은 발색반응 기질이 이용되고, 효소로서 호스 래디쉬 퍼옥시다아제가 이용되는 경우에는 기질로서 클로로나프톨, 아미노에틸카바졸, 디아미노벤지딘, D-루시페린, 루시게닌(비스-N-메틸아크리디늄 니트레이트), 레소루핀 벤질 에테르, 루미놀, 암플렉스 레드 시약(10-아세틸-3,7-디하이드록시페녹사진), HYR (p-phenylenediamine-HCl and pyrocatechol), TMB (tetramethylbenzidine), ABTS (2,2'-Azine-di[3-ethylbenzthiazoline sulfonate]), o-페닐렌디아민(o-Phenylenediamine, OPD) 및 나프톨/파이로닌, 글루코스 옥시다아제, t-NBT 또는 m-PMS (phenzaine methosulfate) 등이 이용될 수 있으나, 이에 제한되는 것은 아니다.
또한, 본 발명에 따른 키트는 검출 가능한 시그널을 발생시키는 레이블을 포함할 수 있으며, 상기 레이블은 화학물질 (예컨대, 바이오틴), 효소 (예컨대, 알칼린 포스파타아제, β-갈락토시다아제, 호스 래디쉬 퍼옥시다아제 및 사이토크롬 P450), 방사능물질 (예컨대, 14C, 125I, 32P 및 35S), 형광물질 (예컨대, 플루오레신), 발광물질, 화학발광물질(chemiluminescent) 및 FRET(fluorescence resonance energy transfer)을 포함할 수 있으나, 이에 제한되는 것은 아니다.
암 진단을 위해 사용되는 효소의 활성 측정 또는 시그널의 측정은 당업계에 공지된 다양한 방법에 따라 실시될 수 있다. 이를 통해 클라우딘-18.2의 발현을 정성적 또는 정량적으로 분석할 수 있다.
본 발명은 또한, 상기 클라우딘-18.2에 특이적으로 결합하는 단클론항체 또는 이의 항원 결합 단편에 약물이 결합된 항체-약물 접합체(antibody-drug conjugate)를 제공한다.
본 발명에서 용어 "약물"이란, 본 발명의 클라우딘-18.2에 특이적인 항체 또는 이의 항원 결합 단편에 결합될 수 있고, 산성조건에 의하여 상기 항체 또는 이의 항원 결합 단편과 분리될 수 있으며, 표적 세포에 대한 치료효과를 나타내는 화합물을 의미한다.
본 발명에 따른 항체-약물 접합체에 사용될 수 있는 약물은 세포독성 또는 세포증식 억제 효과를 갖는 임의의 화합물, 부분 또는 기를 포함하며, (i) 마이크로투불린 억제제, 유사분열 억제제, 토포이소머라아제 억제제, 또는 DNA 인터컬레이터로서 기능할 수 있는 화학요법제; (ⅱ) 효소적으로 기능할 수 있는 단백질 독소; 및 (ⅲ) 방사선동위원소(방사선 핵종) 등이 포함되며, 상기 화합물에서 1종 이상이 사용될 수 있다.
이러한 약물의 비제한적인 예로는 마이탄시노이드, 아우리스타틴, 돌라스타틴, 트리코테센, CC1065 (Rachelmycin), 칼리케아미신 및 다른 에네디인 항생제, 탁산, 안트라시클린, 메토트렉세이트, 아드리아마이신, 빈데신, 빈카 알카로이드(빈크리스틴, 빈블라스틴, 에토포시드), 독소루비신, 멜팔란, 미토마이신 C, 클로람부실, 다우노루비신, 다우노마이신, 에토포시드, 테니포시드, 카르미노마이신, 아미노프테린, 닥티노마이신, 미토마이신류, 블레오마이신류, 에스페라미신류, 5-플루오로우라실, 멜팔란, 기타 질소 머스타드 및 그의 입체 이성질체, 동배체, 동족체 또는 유도체, 시스-백금 및 시스-백금 동족체, 기타 삽입제인 효소 및 그의 단편, 예를 들어 핵산분해 효소, 항생제, 독소(세균, 진균, 식물 또는 동물 기원의 효소적 활성 독소 또는 소분자 독소), 시스플라틴, CPT-11, 독소루비신, 파클리탁셀 및 도세탁셀 등의 각종 항종양 또는 항암제 등이 포함되나, 이에 제한되지 않는다. 또한, 방사선 동위원소(방사선 핵종)에는 3H, 14C, 32P, 35S, 36Cl, 51Cr, 57Co, 58Co, 59Fe, 90Y, 125I, 131I, 186Re 등이 있으며, 이에 제한되지 않으며, 특정 암유전자(oncogene)의 발현을 억제시킬 수 있는 마이크로 RNA (miRNA), siRNA 및 shRNA 등도 사용될 수 있다.
본 발명은 또한, ⅰ) 상기 클라우딘-18.2에 특이적으로 결합하는 단클론항체; ⅱ) 막투과성 도메인(transmembrane domain); 및 ⅲ) 상기 i)의 항체가 항원에 결합하면 T 세포 활성화를 가져오는 것이 특징인 세포 내 신호전달 도메인을 포함하는 키메라 항원 수용체(chimeric antigen receptor, CAR) 단백질을 제공한다.
본 발명에서, 상기 CAR 단백질은 본 발명의 단클론항체와, 공지의 막통과 도메인 및 세포 내 신호전달 도메인으로 구성됨으로써 특정될 수 있다.
본 발명에서 용어, "CAR(chimeric antigen receptor)"은, 면역 효과기 세포에 특정 항원에 대한 특이성을 부여할 수 있는, 자연적으로 존재하지 않는 수용체를 의미한다. 보통, 상기 CAR은 T 세포에 단클론항체의 특이성을 이식하기 위하여 사용되는 수용체를 말한다. CAR은 대개 세포 외 도메인, 막투과성 도메인(transmembrane domain) 및 세포 내 도메인으로 구성된다. 상기 세포 외 도메인은 항원 인식 부위(antigen recognition region)를 포함하며, 본 발명에서 상기 항원 인식 부위는 클라우딘-18.2에 특이적인 항체이다. 클라우딘-18.2에 특이적인 항체는 전술한 것과 같으며, CAR에 사용되는 항체는 항체 단편의 형태인 것이 바람직하며, 더욱 바람직하게는 Fab 또는 scFv 형태이나, 이에 제한되지 않는다.
또한, CAR의 막투과성 도메인은 세포 외 도메인과 연결된 형태로서, 자연적 또는 합성된 것에서 유래한 것일 수 있다. 자연적으로 존재하는 것에서 유래한 경우, 막 결합 또는 막투과성 단백질에서 유래한 것일 수 있으며, T 세포 수용체의 알파, 베타 또는 제타 체인, CD28, CD3 엡실론, CD45, CD4, CD5, CDS, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, CD154 또는 CD8 등 다양한 단백질의 막투과성 영역에서 유래한 부분일 수 있다. 이러한 막투과성 도메인의 서열은 막투과성 단백질의 막투과성 영역 부분을 공지하고 있는 당업계에 공지된 문헌 등으로부터 얻을 수 있으나, 이에 제한되는 것은 아니다. 또한, 상기 막투과성 도메인이 합성된 것일 경우, 이는 류신 및 발린과 같은 소수성 아미노산 잔기를 주로 포함할 수 있으며, 그 예로 페닐알라닌, 트립토판 및 발린의 트리플렛(triplet)이 합성된 막통과 도메인에 존재할 수 있으나, 이에 제한되지 않는다.
본 발명의 CAR에서 상기 세포 내 도메인은 세포 내에 존재하는 CAR의 도메인 일부로서, 막투과성 도메인과 연결된 형태이다. 본 발명의 상기 세포 내 도메인은 CAR의 항원 결합 부위에 항원이 결합하면 T 세포 활성화, 바람직하게는 T 세포 증식을 가져오는 것이 특징인, 세포 내 신호전달 도메인을 포함할 수 있다. 상기 세포 내 신호전달 도메인은 세포 외에 존재하는 항원 결합 부위에 항체가 결합하면, T 세포 활성화를 가져올 수 있는 신호를 전달하는 부분이라면 특별히 그 종류에 제한되지 않으며, 다양한 종류의 세포 내 신호전달 도메인이 사용될 수 있으며, 그 예로 면역수용체 티로신-기반의 활성화 모티프(immunoreceptor tyrosine-based activation motif, ITAM)일 수 있으며, 상기 ITAM은 CD3 제타(ξ, zeta), FcR 감마, FcR 베타, CD3 감마, CD3 델타, CD3 엡실론, CDS, CD22, CD79a, CD79b, CD66d 또는 FcεRIγ에서 유래한 것을 포함할 수 있으나, 이에 제한되는 것은 아니다.
또한, 본 발명의 CAR의 세포 내 도메인은 세포 내 신호전달 도메인과 함께 공동자극 도메인(costimulatory domain)을 추가로 포함하는 것이 바람직하나, 이에 제한되지 않는다. 상기 공동자극 도메인은, 본 발명의 CAR에 포함되어 세포 내 신호전달 도메인에 의한 신호에 더하여, T 세포에 신호를 전달하는 역할을 수행하는 부분으로서, 공동자극 분자의 세포 내 도메인을 포함하는, CAR의 세포 내 부분을 의미한다. 상기 공동자극 분자는 세포 표면 분자로서, 항원에 대한 림프구의 충분한 반응을 가져오는데 필요한 분자를 의미하며, 그 예로 CD27, CD28, 4-1BB, OX40, CD30, CD40, PD-1, ICOS, LFA-1 (lymphocyte function-associated antigen-1), CD2, CD7, LIGHT, NKG2C, 또는 B7-H3일 수 있으나, 이에 제한되지 않는다. 상기 공동자극 도메인은 이러한 공동자극 분자 및 이의 조합으로 이루어진 군으로부터 선택된 분자의 세포 내 부분일 수 있다.
또한, 선택적으로, 짧은 올리고펩타이드 또는 폴리펩타이드 링커가 CAR의 세포 내 도메인 및 막투과성 도메인을 연결할 수 있으며, 상기 링커는 본 발명의 CAR에 포함되어도, 세포 외에 위치한 항체에 항원이 결합하였을 때 세포 내 도메인을 통한 T 세포 활성화를 유도할 수 있는 링커라면, 특별히 그 길이에 제한되지 않는다.
본 발명은 또한, 상기 클라우딘-18.2에 특이적으로 결합하는 단클론항체 또는 이의 항원 결합 단편을 포함하는 다중특이적 항체(multi-specific antibody)를 제공한다.
본 발명에 있어서, 상기 다중특이적 항체는 바람직하게는 이중특이적 항체일 수 있으나, 이에 제한되지 않는다.
본 발명에 따른 다중특이적 항체는 본 발명에 따른 항-클라우딘-18.2 항체가 면역효능세포-특이적 표적분자에 대한 결합능을 가지는 항체 또는 그 단편과 결합된 형태가 바람직하다. 면역효능세포-특이적 표적분자는 PD-1, PD-L1, CTLA-4, TIM-3, TIGIT, BTLA, KIR, A2aR, VISTA, B7-H3, TCR/CD3, CD16(FcγRⅢa) CD44, Cd56, CD69, CD64(FcγRI), CD89 및 CD11b/CD18(CR3)에서 선택되는 것이 바람직하지만, 이에 한정되는 것은 아니다.
다중특이적 항체는 동일한 항원 또는 두 개 이상의 다른 항원에 대하여 동시에 서로 다른 다중(이중 이상)의 에피토프를 인식하는 항체로, 다중특이적 항체에 속하는 항체들은 scFv 기반 항체, Fab 기반 항체 및 IgG 기반 항체 등으로 구분할 수 있다. 다중특이적, 예를 들어 이중특이적 항체의 경우 두 개의 신호를 동시에 억제 또는 증폭시킬 수 있기 때문에 하나의 신호를 억제/증폭하는 경우보다 더욱 효과적일 수 있으며, 각각의 신호를 각각의 신호억제제로 처리했을 경우와 비교하면, 저용량 투약이 가능하며, 동일한 시간 및 공간에서의 두 개의 신호를 억제/증폭시킬 수 있다.
이중특이적 항체의 제조 방법은 널리 공지되어 있다. 전통적으로, 이중특이적 항체의 재조합 생산은 두 개의 중쇄가 상이한 특이성을 가지는 조건에서 두 개의 면역글로불린 중쇄/경쇄 쌍의 공동 발현을 근간으로 한다.
scFv를 기반으로 하는 이중특이적 항체의 경우, 상이한 scFv들의 경쇄 가변영역(VL)과 중쇄 가변영역(VH)를 각기 서로 조합하여 혼성 scFv를 이종이중체(heterodimeric) 형태로 제조하여 디아바디(diabody)를 만들 수 있고(Holliger et al., Proc. Natl. Acad. Sci. U.S.A., 90:6444, 1993), 상이한 scFv를 서로 연결해서 tandem ScFv를 제조할 수 있으며, Fab의 CH1과 CL을 각각의 scFv의 말단에 발현시켜 heterodimeric 미니항체(miniantibody)를 제조할 수 있고(Muller et al., FEBS lett., 432:45, 1998), 그리고 Fc의 homodimeric 도메인인 CH3 도메인의 일부 아미노산을 치환하여 'knob into hole' 형태의 heterodimeric 구조로 변경시켜, 이들 변경된 CH3 도메인을 상이한 각각의 scFv 말단에 발현시킴으로써 heterodimeric scFv 형태의 미니바디(minibody)를 제조할 수 있다(Merchant et al., Nat. Biotechnol., 16:677, 1998).
Fab을 기반으로 하는 이중특이적 항체의 경우, 특정 항원에 대한 개별 Fab'를 이황화결합 또는 매개체를 이용해서 서로 조합하여 heterodimeric Fab 형태로 제조할 수 있고, 특정 Fab의 중쇄 또는 경쇄의 말단에 상이한 항원에 대한 scFv를 발현시킴으로써 항원 결합가(valency)를 2개로 하거나, Fab과 scFv 사이에 경첩부위(hinge region)를 둠으로써 homodimeric 형태로 4개의 항원결합가를 가지도록 제조할 수 있다. 또한, Fab의 경쇄 말단과 중쇄 말단에 상이한 항원에 대한 scFv를 융합시킴으로써 항원에 대한 결합가를 3개로 만든 이중표적 바이바디(bibody), Fab의 경쇄말단과 중쇄말단에 상이한 scFv를 각각 융합시킴으로써 항원에 대한 결합가를 3개로 가지도록 한 삼중표적 바이바디, 상이한 Fab 3개를 화학적으로 접합시킴으로써 얻어진 간단한 형태의 삼중표적항체 F(ab')3의 제조방법이 당업계에 알려져 있다.
IgG를 기반으로 하는 이중특이적 항체의 경우, 트리온파마(Trion Pharma)사에 의해 마우스와 렛트 하이브리도마를 다시 교잡함으로써, 하이브리드 하이브리도마, 일명 쿼드로마(quadromas)를 제조하여 이중특이적 항체를 생산하는 방법이 알려져 있다. 또한, 경쇄부분은 공유하면서, 상이한 중쇄에 대해서 Fc의 CH3 homodimeric 도메인의 일부 아미노산을 변형시켜 heterodimeric 형태로 제작한 이른 바 'Holes and Knob' 형태의 이중특이적 항체의 제조방법(Merchant et al., 1998), heterodimeric 형태의 이중특이적 항체 이외에, 상이한 2종의 scFv를 IgG의 경쇄와 중쇄의 가변 도메인 대신 불변(constant) 도메인에 각각 융합 발현시켜 homodimeric 형태의 (scFv)4-IgG로 제조한 방법이 알려져 있다. 또한, 임클론(ImClone)사는 인간 VEGFR-2에 대한 키메릭 단클론항체인 IMC-1C11을 기반으로하여, 이 항체의 경쇄 아미노 말단에 마우스 혈소판유도성장인자수용체-알파(Platelet-derived Growth Factor Receptor-α)에 대한 single variable domain만을 융합시켜 이중특이적 항체를 제작하여 보고하였다. 또한, Rossi 등은 단백질 카이네이즈 A(protein kinase A, PKA) R 서브유닛의 dimerization and docking 도메인과 PKA의 anchoring 도메인을 이용한 이른 바 'dock and lock' 방법을 통해서 CD20에 대한 다수의 항원결합가를 지니는 항체를 선보인 바 있다(Rossi et al., Proc. Natl. Acad. Sci. U.S.A., 103:6841, 2006).
이하, 본 발명을 실시예에 의해 상세히 설명한다. 단, 하기 실시예는 본 발명을 예시하는 것일 뿐, 본 발명의 내용이 하기 실시예에 한정되는 것은 아니다.
실시예 1. 클라우딘-18.2(CLDN18.2) 특이적 항체의 선별
CLDN18.2(R&D, #RDC2149)의 유전자를 HEK293E 동물세포주에 과발현하여 세포주를 확보하였다. CLDN18.2-VLPs 항원(Cusabio, #CSB-MP005498HU(A5))을 면역흡착튜브(Immunosorb tube)에 코팅한 후 블로킹(blocking)을 수행하였다. 인간 scFv 라이브러리 파지((주)와이바이오로직스)를 대장균에 감염시킨 후, 얻어진 대장균을 30℃에서 16시간 배양하였다. 배양액을 원심 분리하여 상층액을 PEG (polyethylene glycol)로 농축한 다음, 이를 PBS (phosphate buffered saline) 완충용액에 녹여 인간 항체 라이브러리 파지를 준비하였다.
상기 면역흡착튜브에 상기 라이브러리 파지를 넣고 실온에서 2시간 반응시킨 다음, 1x PBST와 1x PBS로 세척 후, 100 mM TAE와 Tris-HCl(pH 7.5) 용액을 차례로 처리하여 항원에 특이적으로 결합한 scFv-파지들만을 용출시켰다. 그리고 패닝 및 ELISA를 수행하여 최종적으로 CLDN18.2에 특이적으로 결합하는 3종의 양성 파지 클론을 선별하였다. 그리고 scFv 형태의 클론들을 IgG 형태로 전환하여 실험에 사용하였다.
선별된 단클론항체의 중쇄 및 경쇄 CDR 및 이를 포함하는 중쇄 가변영역 및 경쇄 가변영역의 서열은 하기 표 1 및 표 2와 같다.
클론명 | 중쇄 | 경쇄 | ||||
CDR1 | CDR2 | CDR3 | CDR1 | CDR2 | CDR3 | |
0058-001 | GFTFSSYA (서열번호 1) | ISGSGGST (서열번호 2) | AKEGVWWLRYFDH (서열번호 3) | SNDVGGYTY (서열번호 5) | DVS | SSYAGSYTWV (서열번호 6) |
0058-002 | GFTFSSYA (서열번호 1) | ISGSGGST (서열번호 2) | ARGLGYYYYGMDV (서열번호 8) | QTVSSW (서열번호 10) | AAS | QQYHSFPPT (서열번호 11) |
0058-003 | GFTFSSYA (서열번호 1) | ISGSGGST (서열번호 2) | ARGAASSYYFDY (서열번호 13) | AGVRNY (서열번호 15) | GAF | QQYHSFPPT (서열번호 11) |
클론명 | 중쇄 가변영역 | 경쇄 가변영역 |
0058-001 | QVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVAAISGSGGSTYFADSVRGRFTISRDNPQSTLYLQMNSLRAEDTAVYYCAKEGVWWLRYFDHWGQGTPITVSS (서열번호 4) | QSALTQPRSVSGSPGQSVTISCTGTSNDVGGYTYVSWYQQHPGKAPKLMIYDVSKRPSGVPDRFSGSKSGNTASLTISGLQAEDEADYYCSSYAGSYTWVFGGGTKLTVL (서열번호 7) |
0058-002 | QMQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGLGYYYYGMDVWGQGTTVTVSS (서열번호 9) | DIQMTQSPSSLSASVGDRVTITCRASQTVSSWLAWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFGTYYCQQYHSFPPTFGGGTKVGIK (서열번호 12) |
0058-003 | QVQLVQSGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGAASSYYFDYWGLGTTVTVSS (서열번호 14) | DIQMTQSPSSLAAYVGDTVTITCRASAGVRNYLAWVQQKPGKAPRSLIYGAFKLQSGVPSRFSGSGSGTEFTLTISSLQPEDFGTYYCQQYHSFPPTFGGGTKVDIK (서열번호 16) |
밑줄: CDR |
실시예 2. 선별된 CLDN18.2 특이 단클론항체의 특성
2-1. 유세포 분석을 통한 CLDN18.2 단클론항체의 비특이성
HEK293E 세포주에서 비특이적 결합력 실험을 실시하였다. 인간-CLDN18.2 발현은 anti-CLDN18.2(CUSABIO, #CSB-RA005498A1HU)를 사용하여 확인하였다.
인간 CLDN18.2를 발현하지 않는 HEK293E 세포를 시료당 0.5x106 세포가 되도록 준비하고, 선별 항체인 0058-001, 0058-002 및 0058-003을 7.5 ㎍/㎖의 농도로 희석하여 준비된 세포와 4℃에서 30분간 반응시켰다. 그 후, 세포를 2% 소태아혈청(fetal bovine serum)이 포함된 PBS (Welgene, #LB001-02)로 3회 세척하고, FITC (fluorescein isothiocyanate) 형광물질이 결합된 항-인간 IgG 항체(Vectorlabs, #FI-3000)를 사용하여 4℃에서 30분간 반응시킨 후, 상기와 동일하게 세척하였다. 세포를 0.2 ㎖의 2% FBS(Thermo, #26140-079)가 든 PBS로 현탁시킨 후, 유세포 분석기인 CytoFlex flow cytometer(Beckman coulter, 미국)를 사용하여 결합력을 분석하였다.
분석 결과, 선별 항체인 0058-001, 0058-002 및 0058-003 3종 모두 CLDN18.2가 발현되어 있지 않은 HEK293E 세포주에는 결합하지 않았다(도 1).
2-2. 유세포 분석을 통한 CLDN18.2 단클론항체의 특이성
인간 CLDN18.2를 과발현하는 HEK293E/18.2 세포와 CHO-K1/18.2 세포 각각을 시료당 0.5x106 세포가 되도록 준비하고, 항 CLDN18.2 항체를 각각 일정한 배수로 희석한 후 준비된 세포와 4℃에서 30분간 반응시켰다. 그 후, 세포를 2% 소태아혈청이 포함된 PBS로 3회 세척하고, FITC 형광물질이 결합된 항-인간 IgG 항체를 사용하여 4℃에서 20분간 반응시킨 후, 상기와 동일하게 세척하였다. 세포를 0.5 ㎖의 2% FBS가 든 PBS로 현탁시킨 후, 유세포 분석기인 CytoFlex flow cytometer를 사용하여 결합력을 분석하였다.
분석 결과, 항-CLDN18.2 선별 항체인 0058-001, 0058-002 및 0058-003 모두CLDN18.2가 높게 발현되어있는 HEK293E/18.2와 CHO-K1/18.2 세포주에 농도 의존적으로 결합하는 것을 확인하였다(도 2 및 도 3).
실시예 3. 선별된 CLDN18.2 특이 단클론항체의 CLDN18 이소폼(isoform)에 대한 결합력 분석
클라우딘-18.1은 정상적인 폐와 위 상피에서 발현되는 항원으로 클라우딘-18 유전자의 첫번째 엑손 내 어느 ATG를 개시코돈으로 사용하는지에 따라 CLDN18.1/18.2의 이소폼이 만들어지며 단백질 서열의 92%가 동일하기에, 클라우딘-18.1에는 결합하지 않고 클라우딘-18.2에만 특이적으로 결합하는 항체를 선별하기 위해 이소폼에 대한 선택적 결합능을 분석하였다.
3-1. ELISA를 통한 CLDN18 이소폼에 대한 결합능 분석
CLDN18.1(EUPROTEIN, #EPY255141) 및 CLDN18.2(CUSABIO, #CSB-MP005498HU(A5)) 단백질을 각각 희석용액(4% skim milk/0.05% tween-20/PBS)을 사용하여 1 ㎍/㎖로 준비한 후, 100 ㎕씩 면역 플레이트(Thermo, #439454)의 각 웰에 넣고 16시간 이상 4℃에서 정치 배양시켰다. 300 ㎕ 세척액(0.05% tween-20/PBS)으로 3회 세척한 후, 200 ㎕ 차단용액(4% skim milk/0.05% tween-20/PBS)을 웰에 넣고 상온에서 1시간 반응시켰다. 3회 세척 후, 각각 일정한 배수로 희석한 항-CLDN18.2 항체 100 ㎕를 웰에 넣고 상온에서 1시간 흔들어주었다(rocking). 3회 세척 후, 1:3,000의 희석 배율로 준비된 항-인간 카파-HRP(anti-human kappa-HRP; Sigma, #A7164) 100 ㎕를 각 웰에 넣고 상온에서 1시간 동안 반응시켰다. 3회 세척 후, 100 ㎕ TMB 기질(Sigma, #T0440)을 각 웰에 넣고 차광 하에 상온에서 반응시키면서 발색이 확인되었을 때 50 ㎕ 반응정지용액(1N H2SO4)을 넣어 반응을 정지시켰다. 흡광광도계(Promega, GM3000)로 흡광도를 측정하였다.
분석 결과, 선별 항체인 0058-001, 0058-002 및 0058-003은 CLDN18.2 항원에는 결합하였지만(도 4), CLDN18.1 항원에는 모두 결합하지 않아(도 5), CLDN18.2 항원에 선택적임을 확인하였다.
3-2. 유세포 분석을 통한 CLDN18 이소폼에 대한 결합능 분석
내생적으로 인간 CLDN18.1를 발현하는 BxPC3(도 7)를 시료당 0.5x106 세포가 되도록 준비하고, 50 nM 농도의 항CLDN18.1 항체(Cusabio, #CSB- RA005498A2HU)와 본 발명에 따른 항CLDN18.2 항체를 각각 준비된 BxPC3 세포와 4℃에서 30분간 반응시켰다. 그 후, 세포를 2% 소태아혈청이 포함된 PBS로 3회 세척하고, FITC 형광물질이 결합된 항-인간 IgG 항체를 사용하여 4℃에서 30분간 반응시킨 후, 상기와 동일하게 세척하였다. 세포를 0.2 ㎖의 2% FBS가 든 PBS로 현탁시킨 후, 유세포 분석기인 CytoFlex flow cytometer를 사용하여 결합력을 분석하였다.
그 결과, 항-CLDN18.1 항체는 BxPC3 세포주에 결합하였고, 항-CLDN18.2 선별 항체 모두는 BxPC3 세포주에 결합하지 않는 것으로 확인되었다(도 6). 이상의 결과를 통해 선별 항체인 0058-001, 0058-002 및 0058-003은 CLDN18.1 이소폼에는 결합하지 않고, CLDN18.2 항원에 선택적으로 결합하는 것을 확인하였다.
실시예 4. 선별된 CLDN18.2 특이 단클론항체의 세포내재화능
4-1. INCUCYTE를 이용한 세포내재화능 분석
항-CLDN18.2 대조 항체 SC0080와 선별 항체인 0058-001, 0058-002 및 0058-003의 세포내재화능은 각각 항체를 Incucyte®FabFluor human red fluorescent reagent (Essen Bioscience, 미국)와 접합시킨 후, CLDN18.2가 과발현된 HEK293E/18.2 세포와, CLDN18.2을 발현하지않는 HEK293E 세포에 처리하고 시간에 따라 세포 내로 유입되는 항체의 양을 모니터링하였다. 96-웰 플레이트(Nunc, 미국)에 웰당 1x104 개의 세포를 분주하여 24시간 부착시키고, 각각 4 ㎍/㎖의 항체를 동량의 Incucyte®FabFluor red antibody labeling reagent와 혼합하여 37℃에서 15분 동안 암반응시킨 후, 세포에 처리하였다. 항체의 세포내 유입량은 시간에 따라 세포의 라이소좀에 축적되는 항체의 양을 IncuCyte ZOOM HD/2CLR System (Essen Biosciences, 미국)을 통해 15분 간격으로 총 24시간 동안 확인하고 정량화를 실시하였다.
그 결과, 세포 표면에 결합한 항-CLDN18.2 선별 항체 0058-001, 0058-002 및 0058-003은 CLDN18.2를 발현하지 않는 HEK293E 세포에서는 세포내 유입이 확인되지 않았으며(도 8), HEK293E/18.2 세포에서는 5시간 이내에 항체의 50%가 세포내로 유입되는 것을 확인하였다(도 9). 특히, 선별 항체 0058-001 및 0058-002의 경우 대조항체(Ybiologics, #SC0080; IgG mAb zolbetuximab in-house) 보다 우수한 세포내재화능을 보여주었다. 상기 결과는 항-CLDN18.2 선별 항체 모두 타겟 특이적으로 세포 내로 약물을 전달할 수 있는 항체로서 기능할 수 있는 것으로 평가되며, 항체-약물 접합체로서 개발이 가능하다는 것을 시사한다.
4-2. 세포면역형광법을 이용한 세포내재화능 분석
항-CLDN18.2 항체가 세포 표면에 존재하는 항원과 결합한 후, 세포 내로 들어갈 수 있는지 확인하기 위하여 CLDN18.2이 과발현된 CHO-K1/18.2 세포에서 엔도사이토시스(endocytosis) 시험법을 수행하였고, 항체의 세포 내 위치를 확인하기 위하여 면역세포화학적 염색(ICC; immunocytochemistry)을 실시하였다. 참고로, CHO-K1/18.2 세포는 클라우딘18.2가 CHO-K1 세포 대비 약 161배 수준으로 과발현된 세포로서 이는 실시예 2-2와 동일한 방법으로 수행하여 확인하였다(도 10의 하단 참조).
24-웰 플레이트에 PPL(SIGMA-ALDRICH, #P4707)로 코팅된 12mm 커버글라스를 넣어 세포를 웰 당 5x104로 시딩(seeding)하고, 10 ㎍/㎖의 항-CLDN18.2 항체 0058-001, 0058-002 및 0058-003을 각각 처리하여 4℃에서 1시간 동안 세포 표면에 존재하는 항원에 항체가 결합하도록 반응시켰다. 이후 세포를 차가운 PBS로 수세하고, 항체의 세포내재화를 유도하기 위해 37℃에 미리 데운 완전배지[RPMI-1640 (GIBCO, #A1049101), 1% ANTI-ANTI (Thermo Fisher, #15240062), 10% FBS (Thermo Fisher, #26140-079)]로 교체하여, 37℃, 5% CO2 조건에서 24시간 동안 배양하였다. 배양 후, 세포를 PBS로 3회 수세하여 배지를 제거하고, 4% 파라포름알데하이드로 고정하였다. 고정된 세포는 PBS로 3회 수세한 후, 0.5% 사포닌(saponin, SIGMA, #47036)과 10% FBS가 포함된 PBS에 희석한 엔도좀(endosome) 표지 항체와 함께 상온에서 1시간 동안 반응되었다. 엔도좀 표지는 후기 엔도좀(late endosome)/라이소좀(lysosome) 표지항체로 항-토끼 LAMP1(Abcam, 미국)을 사용하였다. 표지항체 결합 후 세포는 10% FBS가 포함된 PBS로 3분 간격으로 3회 수세한 후, 항-CLDN18.2 항체에 대한 2차 항체인 FITC가 결합된 항-인간 IgG(Jackson ImmunoResearch, #709-545-149), 항-LAMP1에 대한 2차 항체인 Cy3가 결합된 항-토끼 IgG(Jackson ImmunoResearch, #711-165-152)를 0.5% 사포닌과 10% FBS가 포함된 PBS에 각각 1:200으로 희석하여 상온에서 1시간 동안 암배양하였다. 형광염색된 세포는 PBS로 3분 간격으로 3회 수세한 후, DAPI가 포함된 마운팅 용액(Vector laboratories, #H1200)을 슬라이드에 떨어뜨리고, 기포가 생기지 않도록 커버글라스 덮어 봉쇄한 후, 공초점 레이저 현미경(Confocal laser scanning microscope; ZEISS, LSM9, 독일)을 사용하여 관찰하였다. 각각의 형광색에 대한 신호 정보는 다음의 표 3과 같다.
색 | 신호 |
초록 (green) | FITC-항체 |
빨강 (red) | Cy3-LAMP1 |
파랑 (blue) | DAPI-nucleus |
노랑 또는 주황 (yellow or orange) | 융합된 항체(merged antibody) 및 LAMP1 |
그 결과, 대조항체(SC0080)와 3종의 CLDN18.2 단클론항체는 엔도사이토시스 유도 후 세포 내로 유입됨을 확인하였고, SC0117은 CLDN18.2에 결합하지 않는 Isotype 대조군으로 0시간과 24시간째에 세포 내에서 관찰되지 않았다(도 10 및 도 11). 한편 유입된 항-CLDN18.2 항체는 엔도좀/리소좀 표지항체인 항-LAMP1과 공-위치(colocalization)되는 빈도가 높아, 항-CLDN18.2 항체가 리소좀으로 전달됨을 알 수 있었다. 이를 통해 항-CLDN18.2 선별 항체 0058-001, 0058-002 및 0058-003 모두 세포 독성 물질을 세포 내로 전달하기 위한 항체-약물 접합체용으로 적합한 항체임을 재확인하였다.
실시예 5. 선별된 CLDN18.2 특이 단클론항체의 CLDN18.2 발현 암세포에서의 효능 시험
㈜와이바이오로직스에서 생산된 항-CLDN18.2 항체 3종에 대한 세포내재화(antibody internalization) 및 세포 독성(cell cytotoxicity) 여부를 Fab ZAP Human Antibody Internalization Kit (ATSbio, #KIT-51-Z4)를 이용하여 확인하였다.
무균실험대(Biosafety cabinet, #JSCB-1500SB, JSR)에서 HEK293E/CLDN 18.2 과발현 세포주 또는 HEK293E 모세포주를 배양 배지인 DMEM (HyClone, #SH30243.01) 100 ㎕에 1x103개의 세포가 되도록 96-웰 플레이트의 각 웰에 넣어주고 5% CO2, 37℃ 인큐베이터에서 16시간 동안 배양한다. 항체 처리 당일에 Fab-ZAP Kit의 리보솜 불활성화 단백질인 사포린(Saporin, ATSbio, #SAP-200)을 배양 배지인 DMEM에 처리 농도의 10배인 10,000 nM부터 10배씩 희석하여 0.001 nM까지 총 8개의 농도를 준비한다. 테스트 항체를 희석하기 위한 ZAP spike 배지는 DMEM에 Fab-ZAP Human (ATSbio, #IT-51-40)을 45 nM의 농도가 되도록 준비한 뒤 이를 이용하여 항체를 처리농도의 10배인 100 nM부터 10배씩 희석하여 0.00001 nM까지 총 8개의 농도를 준비한다. 인간 IgG (Human IgG, Invitrogen, #31154)를 테스트 항체의 대조물질(control)로 사용하였다. 사포린의 대조물질(Con-SAP)인 Fab IgG-SAP (ATSbio, #IT-67-40)은 세포배양 배지인 DMEM에 처리 농도의 10배인 100 nM이 되도록 준비한다. 이렇게 준비된 사포린, 테스트 항체 및 Fab IgG-SAP을 16시간 배양한 96-웰 플레이트의 각 웰에 멀티파이펫을 이용하여 10 ㎕씩 넣어준다. 이후 플레이트를 5% CO2, 37℃ 인큐베이터에서 72시간 동안 배양하였다.
무균실험대에서 DPBS(HyClone, #SH30028.02) 5.5 ㎖과 Fab ZAP Kit의 XTT (ATSbio, #XTT) 5.5 ㎖을 잘 섞어 DPBS/XTT(1:1) 시약 11 ㎖을 만든 뒤 키트 내의 PMS (ATSbio, #PMS-400) 92 ㎕를 넣어 XTT/PMS 시약을 만든다. 72 시간동안 배양한 플레이트를 꺼내 항체 및 사포린 등의 처리된 각 웰에 XTT/PMS 시약을 50 ㎕씩 분주한 뒤 플레이트를 5% CO2, 37℃ 인큐베이터에서 2시간 동안 배양하였다.
2시간 배양이 끝난 플레이트를 꺼내어 GloMax®Discover Microplate Reader(Promega, #GM3000)를 이용하여 450 nm파장에서 흡광도를 측정한다. 세포 생존력(cell viability, %)은 테스트 항체가 처리되지 않은 웰의 값을 100%로 기준하고, GraphPad prism(9.4 version)의 4-파라미터 비선형함수곡선(log vs response-variable slope 4 parameters)을 사용하여 IC50(the half maximal inhibitory concentration; 세포사멸을 50% 유도하는데 필요한 항체 양)을 산출하였다.
그 결과, 표 4, 도 12 및 도 13에 도시된 바와 같이 항원발현이 없는 HEK293E 모세포주에서는 테스트 항체들의 세포독성은 관찰되지 않았고, CLDN18.2가 과발현된 HEK293E/18.2 세포주에서 테스트 항체 처리 최고농도인 10 nM에서 세포 독성 효과가 관찰되고 IC50값은 0.04~0.10 nM 구간으로 테스트 항체들은 항원-특이적으로 내재화된 후 세포독성을 유발할 수 있으며 그 효과는 테스트 항체간 차이가 있는 것으로 나타났다.
HEK293E | HEK293E/18.2 | ||
Cell viability(%) at 10 nM | Cell viability(%) at 10 nM | IC50(nM) | |
Saporin | 97 | 98 | 51.53 |
Human IgG | 100 | 100 | N/A |
0058-001 | 125 | 76 | 0.10 |
0058-002 | 108 | 58 | 0.04 |
0058-003 | 91 | 56 | 0.04 |
N/A: not available |
실시예 6. 선별된 CLDN18.2 특이 단클론항체의 열 안정성
시차 주사 형광측정법(Differential Scanning Fluorimetry)을 이용하여 항체의 열안정성을 테스트하였다. 항체 단백질을 DPBS에 희석하여 3 μM, 45 ㎕를 만들고, 200x Sypro orange dye(Thermo, #S6650) 5 ㎕와 섞어서 qPCR 튜브(Bio-Rad, #TLS0851-white)에 50 ㎕씩 분주하고 뚜껑(Bio-Rad, #TCS0803)을 닫는다. Biorad CFX96 실시간 PCR 기기를 사용하여 qPCR을 실시하였다. qPCR은 25℃에서 30초간 반응시킨 후, 99℃까지 0.5℃씩 증가시키되 각 온도에서 0.5분간 반응시키고, 마지막으로 25℃에서 10초간 반응시켜 마무리하였다. 항체 구조가 풀리는 속도 상수로는 Tm(용융 온도)을 사용하였다.
항체 종류 | Tm (℃) |
SC0080 | 67.00 |
0058-001 | 64.50 |
0058-002 | 67.00, 81.50 |
0058-003 | 67.50, 79.50 |
분석 결과 상기 표 5와 같이, 대조항체와 선별 항체 0058-002 및 0058-003은 Tm값 65℃ 이상으로 열 안정성이 양호한 것으로 확인되었고 0058-001은 64.5℃ 로 약간 낮은 것으로 나타났다. 0058-002 및 0058-003 항체에서 2개의 Tm이 나타난 것은 항체를 구성하는 도메인들(CH2, CH3, Fab)간의 풀리는 속도가 달랐거나 첫 용융온도로부터 풀려서 생긴 불활성화된 단백질이 응집(aggregation)된 후 두번째 용융온도에서 2차로 풀렸기 때문인 것으로 사료되었다.
서열목록 전자파일 첨부
Claims (23)
- 서열번호 1로 기재된 중쇄 CDR (complementarity-determining region) 1; 서열번호 2로 기재된 중쇄 CDR2; 및 서열번호 3으로 기재된 중쇄 CDR3를 포함하는 중쇄가변영역과, 서열번호 5로 기재된 경쇄 CDR1; 아미노산 서열 DVS로 이루어진 경쇄 CDR2; 및 서열번호 6으로 기재된 경쇄 CDR3를 포함하는 경쇄가변영역을 포함하는, 클라우딘-18.2(claudin-18 spliced variant 2, CLDN18.2)에 특이적으로 결합하는 단클론항체 또는 이의 항원 결합 단편.
- 서열번호 1로 기재된 중쇄 CDR (complementarity-determining region) 1; 서열번호 2로 기재된 중쇄 CDR2; 및 서열번호 8로 기재된 중쇄 CDR3를 포함하는 중쇄가변영역과, 서열번호 10으로 기재된 경쇄 CDR1; 아미노산 서열 AAS로 이루어진 경쇄 CDR2; 및 서열번호 11로 기재된 경쇄 CDR3를 포함하는 경쇄가변영역을 포함하는, 클라우딘-18.2(claudin-18 spliced variant 2, CLDN18.2)에 특이적으로 결합하는 단클론항체 또는 이의 항원 결합 단편.
- 서열번호 1로 기재된 중쇄 CDR (complementarity-determining region) 1; 서열번호 2로 기재된 중쇄 CDR2; 및 서열번호 13으로 기재된 중쇄 CDR3를 포함하는 중쇄가변영역과, 서열번호 15로 기재된 경쇄 CDR1; 아미노산 서열 GAF로 이루어진 경쇄 CDR2; 및 서열번호 11로 기재된 경쇄 CDR3를 포함하는 경쇄가변영역을 포함하는, 클라우딘-18.2(claudin-18 spliced variant 2, CLDN18.2)에 특이적으로 결합하는 단클론항체 또는 이의 항원 결합 단편.
- 제1항에 있어서, 상기 단클론항체 또는 이의 항원 결합 단편은 서열번호 4의 아미노산 서열로 기재된 중쇄가변영역 및 서열번호 7의 아미노산 서열로 기재된 경쇄가변영역을 포함하는 것인 클라우딘-18.2에 특이적으로 결합하는 단클론항체 또는 이의 항원 결합 단편.
- 제2항에 있어서, 상기 단클론항체 또는 이의 항원 결합 단편은 서열번호 9의 아미노산 서열로 기재된 중쇄가변영역 및 서열번호 12의 아미노산 서열로 기재된 경쇄가변영역을 포함하는 것인 클라우딘-18.2에 특이적으로 결합하는 단클론항체 또는 이의 항원 결합 단편.
- 제3항에 있어서, 상기 단클론항체 또는 이의 항원 결합 단편은 서열번호 14의 아미노산 서열로 기재된 중쇄가변영역 및 서열번호 16의 아미노산 서열로 기재된 경쇄가변영역을 포함하는 것인 클라우딘-18.2에 특이적으로 결합하는 단클론항체 또는 이의 항원 결합 단편.
- 제1항 내지 제6항 중 어느 한 항에 있어서, 상기 단클론항체는 인간항체, 인간화항체, 키메릭항체 및 재조합항체로 이루어진 군으로부터 선택되는 것을 특징으로 하는 클라우딘-18.2에 특이적으로 결합하는 단클론항체 또는 이의 항원 결합 단편.
- 제1항 내지 제6항 중 어느 한 항에 있어서, 상기 항원 결합 단편은 클라우딘-18.2와 결합하는 scFv (single chain variable fragment), dsFv, Fab, F(ab') 및 F(ab')2로 이루어진 군으로부터 선택되는 것을 특징으로 하는 클라우딘-18.2에 특이적으로 결합하는 단클론항체 또는 이의 항원 결합 단편.
- 제1항 내지 제6항 중 어느 한 항의 단클론항체 또는 이의 항원 결합 단편의 중쇄가변영역 및 경쇄가변영역을 코딩하는 폴리뉴클레오티드.
- 제9항의 폴리뉴클레오티드를 포함하는 발현 벡터.
- 제10항의 발현 벡터로 형질전환된 인간을 제외한 형질전환체.
- (a) 제1항 내지 제6항 중 어느 한 항의 클라우딘-18.2(claudin-18 spliced variant 2, CLDN18.2)에 특이적으로 결합하는 단클론항체 또는 이의 항원 결합 단편의 중쇄가변영역 및 경쇄가변영역을 코딩하는 폴리뉴클레오티드를 포함하는 발현 벡터로 형질전환된 인간을 제외한 형질전환체를 배양하여 배양액을 제조하는 단계; 및
(b) 상기 (a) 단계의 배양액으로부터 상기 단클론항체 또는 이의 항원 결합 단편을 정제하는 단계를 포함하는, 클라우딘-18.2에 특이적으로 결합하는 단클론항체 또는 이의 항원 결합 단편을 제조하는 방법. - 제1항 내지 제6항 중 어느 한 항의 단클론항체 또는 이의 항원 결합 단편을 유효성분으로 포함하는 암 치료용 약학 조성물.
- 제13항에 있어서, 상기 암은 췌장암, 식도암, 난소암, 폐암, 위암, 대장암, 간암, 담도암, 유방암, 신장암, 중피종(mesothelioma) 및 두경부암으로 구성되는 군으로부터 선택되는 것을 특징으로 하는 암 치료용 약학 조성물.
- 제13항에 있어서, 상기 조성물은 항암제를 추가로 포함하는 것을 특징으로 하는 암 치료용 약학 조성물.
- 제15항에 있어서, 상기 항암제는 화학요법제 또는 면역관문억제제인 것을 특징으로 하는 암 치료용 약학 조성물.
- 제13항의 암 치료용 약학 조성물을 개체에 투여하는 단계를 포함하는, 암을 치료하는 방법.
- 제1항 내지 제6항 중 어느 한 항의 단클론항체 또는 이의 항원 결합 단편을 포함하는 암 진단용 조성물.
- 제18항의 조성물을 포함하는, 암 진단용 키트.
- 제1항 내지 제6항 중 어느 한 항의 단클론항체 또는 이의 항원 결합 단편에 약물이 결합된 항체-약물 접합체(antibody-drug conjugate).
- 제20항에 있어서, 상기 약물은 항암제인 것을 특징으로 하는 항체-약물 접합체.
- ⅰ) 제1항 내지 제6항 중 어느 한 항의 항체;
ⅱ) 막투과성 도메인(transmembrane domain); 및
ⅲ) 상기 i)의 항체가 표적 항원에 결합하면 T 세포 활성화를 가져오는 것이 특징인 세포 내 신호전달 도메인(intracellular signlaing domain)을 포함하는 키메라 항원 수용체(chimeric antigen receptor) 단백질. - 제1항 내지 제6항 중 어느 한 항의 클라우딘-18.2(claudin-18 spliced variant 2, CLDN18.2)에 특이적으로 결합하는 단클론항체 또는 이의 항원 결합 단편을 포함하는 다중특이적 항체(multi-specific antibody).
Priority Applications (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
KR1020220182621A KR20240101987A (ko) | 2022-12-23 | 2022-12-23 | 클라우딘-18.2에 특이적으로 결합하는 단클론항체 및 이의 용도 |
PCT/KR2023/021443 WO2024136594A1 (ko) | 2022-12-23 | 2023-12-22 | 클라우딘-18.2에 특이적으로 결합하는 단클론항체 및 이의 용도 |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
KR1020220182621A KR20240101987A (ko) | 2022-12-23 | 2022-12-23 | 클라우딘-18.2에 특이적으로 결합하는 단클론항체 및 이의 용도 |
Publications (1)
Publication Number | Publication Date |
---|---|
KR20240101987A true KR20240101987A (ko) | 2024-07-03 |
Family
ID=91589678
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
KR1020220182621A KR20240101987A (ko) | 2022-12-23 | 2022-12-23 | 클라우딘-18.2에 특이적으로 결합하는 단클론항체 및 이의 용도 |
Country Status (2)
Country | Link |
---|---|
KR (1) | KR20240101987A (ko) |
WO (1) | WO2024136594A1 (ko) |
Family Cites Families (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US11912763B2 (en) * | 2018-06-17 | 2024-02-27 | L & L Biopharma Co., Ltd. | Antibody targeting CLDN18.2, bispecific antibody, ADC, and CAR, and applications thereof |
US20210214433A1 (en) * | 2018-07-25 | 2021-07-15 | Accurus Biosciences, Inc. | Novel cldn 18.2-specific monoclonal antibodies and methods of use thereof |
TW202023613A (zh) * | 2018-08-27 | 2020-07-01 | 大陸商南京聖和藥業股份有限公司 | 一種抗Claudin18_2抗體及其應用 |
CN113490689B (zh) * | 2019-02-01 | 2024-06-04 | 恺兴生命科技(上海)有限公司 | Tcr融合蛋白及表达tcr融合蛋白的细胞 |
EP4252782A1 (en) * | 2020-11-30 | 2023-10-04 | CSPC Megalith Biopharmaceutical Co., Ltd. | Anti-cldn18.2 antibody, drug conjugate, and preparation method therefor and use thereof |
-
2022
- 2022-12-23 KR KR1020220182621A patent/KR20240101987A/ko unknown
-
2023
- 2023-12-22 WO PCT/KR2023/021443 patent/WO2024136594A1/ko unknown
Also Published As
Publication number | Publication date |
---|---|
WO2024136594A1 (ko) | 2024-06-27 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
CN111867630B (zh) | 靶向cldn18.2的抗体、双特异性抗体、adc和car及其应用 | |
RU2750705C1 (ru) | Антитела против TIGIT и их применение | |
CA2669731C (en) | Anti-human dlk-1 antibody showing anti-tumor activity in vivo | |
AU2020281130B2 (en) | Antibody binding specifically to MUC1 and use thereof | |
KR102250234B1 (ko) | Lag-3에 특이적으로 결합하는 단클론항체 및 이의 용도 | |
KR20170030585A (ko) | Axl에 결합하는 항체 | |
WO2020228806A1 (zh) | 针对密蛋白18a2的抗体及其应用 | |
US11306141B2 (en) | Antibody against human DLK1 and use thereof | |
US20220348663A1 (en) | Antibody binding specifically to b7-h3 and use thereof | |
US20230331867A1 (en) | Nectin-4 antibodies and uses thereof | |
KR20200055758A (ko) | 신규 항-cd19 항체 | |
RU2768002C1 (ru) | Антитело, специфически связывающееся с ecl-2 клаудина 3, его фрагмент и его применение | |
KR20180031727A (ko) | 항-코티닌 항체가 연결된 키메라 항체 수용체 및 이의 용도 | |
AU2017306506A1 (en) | Antibody to programmed cell death 1 (PD-1) and use thereof | |
KR20220099103A (ko) | 항-fgfr3 항체 및 이의 용도 | |
KR20240101987A (ko) | 클라우딘-18.2에 특이적으로 결합하는 단클론항체 및 이의 용도 | |
KR20220082776A (ko) | 항-tigit 항체 및 이의 용도 | |
JP7119225B2 (ja) | Pdgf受容体に対する抗体およびその用途 | |
WO2023190465A1 (ja) | 抗ヒトsema7a抗体 | |
KR20240016216A (ko) | 항-ror1 항체 및 이의 용도 |