KR20210149121A - Recombinant protein for preventing swine fever virus infection and composition and cell containing same - Google Patents
Recombinant protein for preventing swine fever virus infection and composition and cell containing same Download PDFInfo
- Publication number
- KR20210149121A KR20210149121A KR1020217035663A KR20217035663A KR20210149121A KR 20210149121 A KR20210149121 A KR 20210149121A KR 1020217035663 A KR1020217035663 A KR 1020217035663A KR 20217035663 A KR20217035663 A KR 20217035663A KR 20210149121 A KR20210149121 A KR 20210149121A
- Authority
- KR
- South Korea
- Prior art keywords
- recombinant protein
- seq
- composition
- polynucleotide
- moiety
- Prior art date
Links
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 title claims abstract description 57
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 title claims abstract description 57
- 241000710777 Classical swine fever virus Species 0.000 title claims abstract description 26
- 239000000203 mixture Substances 0.000 title claims abstract description 24
- 230000009385 viral infection Effects 0.000 title claims abstract description 16
- 102000008857 Ferritin Human genes 0.000 claims abstract description 21
- 108050000784 Ferritin Proteins 0.000 claims abstract description 21
- 238000008416 Ferritin Methods 0.000 claims abstract description 21
- 230000000890 antigenic effect Effects 0.000 claims abstract description 16
- 210000004027 cell Anatomy 0.000 claims description 42
- 238000000034 method Methods 0.000 claims description 40
- 108091033319 polynucleotide Proteins 0.000 claims description 32
- 102000040430 polynucleotide Human genes 0.000 claims description 32
- 239000002157 polynucleotide Substances 0.000 claims description 32
- 239000013604 expression vector Substances 0.000 claims description 25
- 210000004962 mammalian cell Anatomy 0.000 claims description 15
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 14
- 239000002671 adjuvant Substances 0.000 claims description 12
- 210000004978 chinese hamster ovary cell Anatomy 0.000 claims description 10
- 241000590002 Helicobacter pylori Species 0.000 claims description 6
- 229940037467 helicobacter pylori Drugs 0.000 claims description 6
- 239000003937 drug carrier Substances 0.000 claims description 5
- GVJHHUAWPYXKBD-UHFFFAOYSA-N (±)-α-Tocopherol Chemical compound OC1=C(C)C(C)=C2OC(CCCC(C)CCCC(C)CCCC(C)C)(C)CCC2=C1C GVJHHUAWPYXKBD-UHFFFAOYSA-N 0.000 claims description 4
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 claims description 4
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 3
- FHVDTGUDJYJELY-UHFFFAOYSA-N 6-{[2-carboxy-4,5-dihydroxy-6-(phosphanyloxy)oxan-3-yl]oxy}-4,5-dihydroxy-3-phosphanyloxane-2-carboxylic acid Chemical compound O1C(C(O)=O)C(P)C(O)C(O)C1OC1C(C(O)=O)OC(OP)C(O)C1O FHVDTGUDJYJELY-UHFFFAOYSA-N 0.000 claims description 2
- 229920002101 Chitin Polymers 0.000 claims description 2
- 229920002567 Chondroitin Polymers 0.000 claims description 2
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 claims description 2
- 229930003427 Vitamin E Natural products 0.000 claims description 2
- 229940072056 alginate Drugs 0.000 claims description 2
- 235000010443 alginic acid Nutrition 0.000 claims description 2
- 229920000615 alginic acid Polymers 0.000 claims description 2
- 229910052782 aluminium Inorganic materials 0.000 claims description 2
- XAGFODPZIPBFFR-UHFFFAOYSA-N aluminium Chemical compound [Al] XAGFODPZIPBFFR-UHFFFAOYSA-N 0.000 claims description 2
- 229920006318 anionic polymer Polymers 0.000 claims description 2
- DLGJWSVWTWEWBJ-HGGSSLSASA-N chondroitin Chemical compound CC(O)=N[C@@H]1[C@H](O)O[C@H](CO)[C@H](O)[C@@H]1OC1[C@H](O)[C@H](O)C=C(C(O)=O)O1 DLGJWSVWTWEWBJ-HGGSSLSASA-N 0.000 claims description 2
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 claims description 2
- 239000000839 emulsion Substances 0.000 claims description 2
- WIGCFUFOHFEKBI-UHFFFAOYSA-N gamma-tocopherol Natural products CC(C)CCCC(C)CCCC(C)CCCC1CCC2C(C)C(O)C(C)C(C)C2O1 WIGCFUFOHFEKBI-UHFFFAOYSA-N 0.000 claims description 2
- 235000011187 glycerol Nutrition 0.000 claims description 2
- 229910052500 inorganic mineral Inorganic materials 0.000 claims description 2
- 239000011707 mineral Substances 0.000 claims description 2
- 239000002953 phosphate buffered saline Substances 0.000 claims description 2
- 239000004094 surface-active agent Substances 0.000 claims description 2
- 229940046009 vitamin E Drugs 0.000 claims description 2
- 235000019165 vitamin E Nutrition 0.000 claims description 2
- 239000011709 vitamin E Substances 0.000 claims description 2
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 claims description 2
- 102000004506 Blood Proteins Human genes 0.000 claims 1
- 108010017384 Blood Proteins Proteins 0.000 claims 1
- 241000282887 Suidae Species 0.000 abstract description 17
- 241000282898 Sus scrofa Species 0.000 abstract description 17
- 206010037660 Pyrexia Diseases 0.000 abstract description 12
- 101710125507 Integrase/recombinase Proteins 0.000 abstract description 6
- 230000028993 immune response Effects 0.000 abstract 1
- 238000002474 experimental method Methods 0.000 description 24
- 108090000623 proteins and genes Proteins 0.000 description 22
- 102000004169 proteins and genes Human genes 0.000 description 21
- 229960005486 vaccine Drugs 0.000 description 15
- 238000002965 ELISA Methods 0.000 description 9
- 241000700605 Viruses Species 0.000 description 9
- 239000000427 antigen Substances 0.000 description 7
- 102000036639 antigens Human genes 0.000 description 7
- 108091007433 antigens Proteins 0.000 description 7
- VHJLVAABSRFDPM-QWWZWVQMSA-N dithiothreitol Chemical compound SC[C@@H](O)[C@H](O)CS VHJLVAABSRFDPM-QWWZWVQMSA-N 0.000 description 7
- 239000002105 nanoparticle Substances 0.000 description 7
- 238000001890 transfection Methods 0.000 description 7
- 238000001962 electrophoresis Methods 0.000 description 6
- 239000002609 medium Substances 0.000 description 6
- 238000004458 analytical method Methods 0.000 description 5
- 239000002773 nucleotide Substances 0.000 description 5
- 125000003729 nucleotide group Chemical group 0.000 description 5
- 239000007787 solid Substances 0.000 description 5
- 241001465754 Metazoa Species 0.000 description 4
- 241000283973 Oryctolagus cuniculus Species 0.000 description 4
- 238000012258 culturing Methods 0.000 description 4
- 238000010586 diagram Methods 0.000 description 4
- 238000002649 immunization Methods 0.000 description 4
- 230000003053 immunization Effects 0.000 description 4
- 238000011081 inoculation Methods 0.000 description 4
- 230000002265 prevention Effects 0.000 description 4
- 238000012216 screening Methods 0.000 description 4
- 230000028327 secretion Effects 0.000 description 4
- 230000004083 survival effect Effects 0.000 description 4
- 102000008482 12E7 Antigen Human genes 0.000 description 3
- 108010020567 12E7 Antigen Proteins 0.000 description 3
- GRRNUXAQVGOGFE-UHFFFAOYSA-N Hygromycin-B Natural products OC1C(NC)CC(N)C(O)C1OC1C2OC3(C(C(O)C(O)C(C(N)CO)O3)O)OC2C(O)C(CO)O1 GRRNUXAQVGOGFE-UHFFFAOYSA-N 0.000 description 3
- 238000004113 cell culture Methods 0.000 description 3
- 238000001514 detection method Methods 0.000 description 3
- 238000002296 dynamic light scattering Methods 0.000 description 3
- 230000000694 effects Effects 0.000 description 3
- 102000037865 fusion proteins Human genes 0.000 description 3
- 108020001507 fusion proteins Proteins 0.000 description 3
- GRRNUXAQVGOGFE-NZSRVPFOSA-N hygromycin B Chemical compound O[C@@H]1[C@@H](NC)C[C@@H](N)[C@H](O)[C@H]1O[C@H]1[C@H]2O[C@@]3([C@@H]([C@@H](O)[C@@H](O)[C@@H](C(N)CO)O3)O)O[C@H]2[C@@H](O)[C@@H](CO)O1 GRRNUXAQVGOGFE-NZSRVPFOSA-N 0.000 description 3
- 229940097277 hygromycin b Drugs 0.000 description 3
- 239000000463 material Substances 0.000 description 3
- 230000008569 process Effects 0.000 description 3
- 210000002966 serum Anatomy 0.000 description 3
- 239000000243 solution Substances 0.000 description 3
- 229940031626 subunit vaccine Drugs 0.000 description 3
- 208000011580 syndromic disease Diseases 0.000 description 3
- UAIUNKRWKOVEES-UHFFFAOYSA-N 3,3',5,5'-tetramethylbenzidine Chemical compound CC1=C(N)C(C)=CC(C=2C=C(C)C(N)=C(C)C=2)=C1 UAIUNKRWKOVEES-UHFFFAOYSA-N 0.000 description 2
- 108020004705 Codon Proteins 0.000 description 2
- 241000238631 Hexapoda Species 0.000 description 2
- 238000002835 absorbance Methods 0.000 description 2
- 230000005540 biological transmission Effects 0.000 description 2
- 210000004369 blood Anatomy 0.000 description 2
- 239000008280 blood Substances 0.000 description 2
- 239000003086 colorant Substances 0.000 description 2
- 150000001875 compounds Chemical class 0.000 description 2
- 238000010276 construction Methods 0.000 description 2
- 230000006378 damage Effects 0.000 description 2
- 238000004520 electroporation Methods 0.000 description 2
- 238000001914 filtration Methods 0.000 description 2
- 238000004108 freeze drying Methods 0.000 description 2
- 235000003869 genetically modified organism Nutrition 0.000 description 2
- 239000001963 growth medium Substances 0.000 description 2
- 230000005745 host immune response Effects 0.000 description 2
- 230000001939 inductive effect Effects 0.000 description 2
- 239000007788 liquid Substances 0.000 description 2
- 238000004519 manufacturing process Methods 0.000 description 2
- 229910021645 metal ion Inorganic materials 0.000 description 2
- 239000002245 particle Substances 0.000 description 2
- 102000004196 processed proteins & peptides Human genes 0.000 description 2
- 238000000746 purification Methods 0.000 description 2
- 239000011347 resin Substances 0.000 description 2
- 229920005989 resin Polymers 0.000 description 2
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 2
- 229960005322 streptomycin Drugs 0.000 description 2
- 239000006228 supernatant Substances 0.000 description 2
- 238000004114 suspension culture Methods 0.000 description 2
- 238000012360 testing method Methods 0.000 description 2
- 108010011170 Ala-Trp-Arg-His-Pro-Gln-Phe-Gly-Gly Proteins 0.000 description 1
- 241001550224 Apha Species 0.000 description 1
- 208000001726 Classical Swine Fever Diseases 0.000 description 1
- 108700010070 Codon Usage Proteins 0.000 description 1
- 208000035473 Communicable disease Diseases 0.000 description 1
- 241000699802 Cricetulus griseus Species 0.000 description 1
- 101150082674 E2 gene Proteins 0.000 description 1
- 206010015150 Erythema Diseases 0.000 description 1
- 241000701024 Human betaherpesvirus 5 Species 0.000 description 1
- 108060003951 Immunoglobulin Proteins 0.000 description 1
- 206010067482 No adverse event Diseases 0.000 description 1
- 206010030113 Oedema Diseases 0.000 description 1
- 229930182555 Penicillin Natural products 0.000 description 1
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 1
- 241000202347 Porcine circovirus Species 0.000 description 1
- 108010076504 Protein Sorting Signals Proteins 0.000 description 1
- 229920002684 Sepharose Polymers 0.000 description 1
- 238000003917 TEM image Methods 0.000 description 1
- 108010028230 Trp-Ser- His-Pro-Gln-Phe-Glu-Lys Proteins 0.000 description 1
- 208000025865 Ulcer Diseases 0.000 description 1
- 239000000654 additive Substances 0.000 description 1
- 238000005054 agglomeration Methods 0.000 description 1
- 230000002776 aggregation Effects 0.000 description 1
- 150000001413 amino acids Chemical class 0.000 description 1
- 230000036528 appetite Effects 0.000 description 1
- 235000019789 appetite Nutrition 0.000 description 1
- 230000002238 attenuated effect Effects 0.000 description 1
- 230000036760 body temperature Effects 0.000 description 1
- 210000004899 c-terminal region Anatomy 0.000 description 1
- 230000010261 cell growth Effects 0.000 description 1
- 238000005138 cryopreservation Methods 0.000 description 1
- 239000012228 culture supernatant Substances 0.000 description 1
- 230000034994 death Effects 0.000 description 1
- 231100000517 death Toxicity 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 230000006806 disease prevention Effects 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- 239000003814 drug Substances 0.000 description 1
- 238000003255 drug test Methods 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 239000012634 fragment Substances 0.000 description 1
- 238000010353 genetic engineering Methods 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 102000018358 immunoglobulin Human genes 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 238000001727 in vivo Methods 0.000 description 1
- 208000015181 infectious disease Diseases 0.000 description 1
- 239000007924 injection Substances 0.000 description 1
- 238000002347 injection Methods 0.000 description 1
- 238000010255 intramuscular injection Methods 0.000 description 1
- 239000007927 intramuscular injection Substances 0.000 description 1
- 210000003292 kidney cell Anatomy 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 229920000609 methyl cellulose Polymers 0.000 description 1
- 239000001923 methylcellulose Substances 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 239000000178 monomer Substances 0.000 description 1
- 230000004899 motility Effects 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 210000001672 ovary Anatomy 0.000 description 1
- 230000001575 pathological effect Effects 0.000 description 1
- 229940049954 penicillin Drugs 0.000 description 1
- 239000002504 physiological saline solution Substances 0.000 description 1
- 229920001184 polypeptide Polymers 0.000 description 1
- 230000002516 postimmunization Effects 0.000 description 1
- 238000002360 preparation method Methods 0.000 description 1
- 230000001681 protective effect Effects 0.000 description 1
- 239000012460 protein solution Substances 0.000 description 1
- 230000010076 replication Effects 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 238000003118 sandwich ELISA Methods 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 238000012807 shake-flask culturing Methods 0.000 description 1
- 210000000130 stem cell Anatomy 0.000 description 1
- 239000013589 supplement Substances 0.000 description 1
- 208000024891 symptom Diseases 0.000 description 1
- RTKIYNMVFMVABJ-UHFFFAOYSA-L thimerosal Chemical compound [Na+].CC[Hg]SC1=CC=CC=C1C([O-])=O RTKIYNMVFMVABJ-UHFFFAOYSA-L 0.000 description 1
- 229960004906 thiomersal Drugs 0.000 description 1
- 239000012096 transfection reagent Substances 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 230000014616 translation Effects 0.000 description 1
- 231100000397 ulcer Toxicity 0.000 description 1
- 241000701447 unidentified baculovirus Species 0.000 description 1
- 238000002255 vaccination Methods 0.000 description 1
- 210000003462 vein Anatomy 0.000 description 1
- 230000003612 virological effect Effects 0.000 description 1
- 238000001262 western blot Methods 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
- A61K39/187—Hog cholera virus
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
- C07K14/205—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Campylobacter (G)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K19/00—Hybrid peptides, i.e. peptides covalently bound to nucleic acids, or non-covalently bound protein-protein complexes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/12011—Asfarviridae
- C12N2710/12021—Viruses as such, e.g. new isolates, mutants or their genomic sequences
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/12011—Asfarviridae
- C12N2710/12034—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Genetics & Genomics (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Virology (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Engineering & Computer Science (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Microbiology (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Biotechnology (AREA)
- Gastroenterology & Hepatology (AREA)
- Biomedical Technology (AREA)
- Wood Science & Technology (AREA)
- General Engineering & Computer Science (AREA)
- Zoology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Epidemiology (AREA)
- Mycology (AREA)
- Immunology (AREA)
- Physics & Mathematics (AREA)
- Plant Pathology (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Oncology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Communicable Diseases (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Medicinal Preparation (AREA)
Abstract
본 발명은 돼지열병 바이러스 감염 예방용 재조합 단백질 및 이를 함유하는 조성물 및 세포에 관한 것이다. 재조합 단백질은 항원 모이어티와 페리틴 모이어티를 포함한다. 항원 모이어티는 돼지열병 바이러스의 E2 단백질이다. 본 발명의 재조합 단백질은 돼지가 돼지열병 바이러스 감염에 대한 면역반응을 일으킬 수 있으며, 돼지 산업에서 돼지열병 예방 및 방제 작업에 도움이 된다.The present invention relates to a recombinant protein for preventing swine fever virus infection, and a composition and cell containing the same. The recombinant protein comprises an antigenic moiety and a ferritin moiety. The antigenic moiety is the E2 protein of swine fever virus. The recombinant protein of the present invention can induce an immune response to swine fever virus infection in pigs, and is helpful in preventing and controlling swine fever in the swine industry.
Description
본 발명은 돼지열병 바이러스 감염 예방용 조성물에 관한 것으로, 특히 돼지열병 바이러스 감염 예방용 서브유닛 백신에 관한 것이다.The present invention relates to a composition for preventing swine fever virus infection, and more particularly to a subunit vaccine for preventing swine fever virus infection.
고전적 돼지열병으로도 알려진 돼지열병은 돼지열병 바이러스에 의해 발생하는 전염병이다. 이것은 높은 전염성과 높은 폐사율의 특성을 가지고 있으며 많은 양의 돼지 사망과 양돈 산업에 심각한 손실을 초래할 것이다.Swine fever, also known as classical swine fever, is an infectious disease caused by the swine fever virus. It has the characteristics of high contagiousness and high mortality, and will result in large numbers of pig deaths and serious losses to the pig industry.
현재 돼지열병 백신은 세 가지로 나눌 수 있다. 1. 전통적 돼지열병 백신: 이 백신은 약화된 돼지열병 종자 바이러스를 토끼에 접종하고, 특정 시점의 장기를 채취하고, 분쇄, 여과, 동결건조하여 돼지열병 백신을 제조한다. 2. 조직 배양 생바이러스 백신: 약화된 돼지열병 바이러스를 사용하여 1형 돼지 써코바이러스에 오염되지 않은 돼지 신장 세포를 감염시킨다. 바이러스 증식, 바이러스 액체 수집, 여과 및 동결 건조 후, 조직 배양 생 바이러스 백신을 얻는다. 3. 서브유닛 백신: 현재 시판되고 있는 Bayovac CSF-E2 백신과 같은 서브유닛 백신은 곤충 배큘로바이러스 발현 시스템에 의해 생산되며, 이는 E2 유전자를 보유하는 바이러스로 곤충 세포를 감염시켜 재조합 E2 단백질의 분비 발현을 수행한 다음 그 다음 재조합 E2 단백질을 사용하여 백신을 제조한다.Currently, there are three types of swine fever vaccines. 1. Traditional Swine Fever Vaccine: This vaccine is prepared by inoculating rabbits with weakened swine fever seed virus, collecting organs at a specific time point, crushing, filtering, and freeze-drying to produce a swine fever vaccine. 2. Tissue Culture Live Virus Vaccine: An attenuated swine fever virus is used to infect porcine kidney cells uncontaminated with type 1 porcine circovirus. After virus propagation, viral liquid collection, filtration and freeze-drying, tissue culture live virus vaccine is obtained. 3. Subunit vaccines: Subunit vaccines, such as the currently marketed Bayovac CSF-E2 vaccine, are produced by an insect baculovirus expression system, which infects insect cells with a virus carrying the E2 gene to secrete recombinant E2 protein. Expression is then performed using the recombinant E2 protein to prepare a vaccine.
돼지열병이 돼지 산업에 미치는 피해 및 잠재적 위협의 관점에서, 전염병 예방을 위한 보다 다양하고 보다 효율적인 옵션을 제공하기 위해 돼지 열병 바이러스 감염을 효과적으로 예방할 수 있는 더 많은 백신이 필요하다.In view of the harm and potential threat swine fever poses to the swine industry, more vaccines are needed to effectively prevent swine fever virus infection to provide more diverse and more effective options for epidemic prevention.
본 발명의 목적은 면역 보호 반응을 유도하여 돼지열병 바이러스 감염을 예방할 수 있는 신규한 재조합 단백질 및 이를 포함하는 조성물을 제공하는 것이다. 본 발명의 다른 목적은 본 발명의 재조합 단백질을 발현하는 데 사용할 수 있는 발현 카세트, 이를 포함하는 발현 벡터, 및 이러한 발현 카세트 또는 발현 벡터를 갖는 포유동물 세포를 제공하는 것이다.It is an object of the present invention to provide a novel recombinant protein capable of inducing an immune protective response to prevent swine fever virus infection and a composition comprising the same. Another object of the present invention is to provide an expression cassette that can be used to express the recombinant protein of the present invention, an expression vector comprising the same, and a mammalian cell having such an expression cassette or expression vector.
상기 목적을 달성하기 위하여, 본 발명은 SEQ ID NO: 01의 아미노산 서열을 갖는 항원 모이어티; 및 페리틴 모이어티를 포함하는 재조합 단백질을 제공한다.In order to achieve the above object, the present invention provides an antigenic moiety having the amino acid sequence of SEQ ID NO: 01; and a ferritin moiety.
본 발명은 또한 본 발명의 재조합 단백질 및 약학적으로 허용 가능한 담체를 포함하는 돼지열병 바이러스 감염 예방용 조성물을 제공한다.The present invention also provides a composition for preventing swine fever virus infection comprising the recombinant protein of the present invention and a pharmaceutically acceptable carrier.
본 발명은 프로모터를 포함하는 발현 요소; 및 발현 요소에 작동 가능하게 연결된 제 1 폴리뉴클레오타이드 및 제 2 폴리뉴클레오타이드를 포함하는 발현 카세트를 추가로 제공하며; 여기서 제 1 폴리뉴클레오티드는 SEQ ID NO: 01로 암호화되고, 제 2 폴리뉴클레오티드는 페리틴으로 암호화된다.The present invention relates to an expression element comprising a promoter; and an expression cassette comprising a first polynucleotide and a second polynucleotide operably linked to the expression element; wherein the first polynucleotide is encoded as SEQ ID NO: 01 and the second polynucleotide is encoded as ferritin.
본 발명은 본 발명의 발현 카세트를 포함하는 발현 벡터를 추가로 제공한다.The present invention further provides an expression vector comprising an expression cassette of the present invention.
본 발명은 본 발명의 발현 카세트를 갖는 포유동물 세포를 추가로 제공한다.The invention further provides a mammalian cell having an expression cassette of the invention.
본 발명은 숙주 세포에서 본 발명의 발현 카세트를 발현시키는 단계를 포함하는 본 발명의 재조합 단백질을 발현시키는 방법을 추가로 제공한다.The invention further provides a method of expressing a recombinant protein of the invention comprising the step of expressing an expression cassette of the invention in a host cell.
본 발명의 내용 중에 포함되어 있다.Included in the context of the present invention.
도 1은 실험 1의 발현 벡터의 개략도이다. 태그 DNA는 C-myc 태그, Strep-tag II 및 His 태그를 포함한다.
도 2는 C5-1, C5-4 및 C5-7 세포주의 재조합 단백질의 분비 및 발현량을 나타내는 실험 1의 단백질 전기영동도이다. 화살표는 본 발명의 재조합 단백질을 가리킨다. M은 시판 제품 BenchMarkTM 단백질 래더(Thermo Fisher Scientific)를 나타낸다.
도 3은 3일, 4일, 6일, 8일, 9일, 10일 및 11일에 C5-1 세포주의 재조합 단백질의 분비 및 발현량을 나타내는 실험 2의 단백질 전기영동도이다. 화살표는 본 발명의 재조합 단백질을 가리킨다. M은 시판 제품 BenchMarkTM 단백질 래더(Thermo Fisher Scientific)를 나타낸다.
도 4는 본 발명의 재조합 단백질의 모노머 및 멀티머를 나타내는 실험 2의 단백질 전기영동도이다. 화살표는 본 발명의 재조합 단백질을 가리킨다. M은 시판 제품 BenchMarkTM 단백질 래더(Thermo Fisher Scientific)를 나타낸다. DTT: 다이티오트레이톨. +: DTT로 처리됨; -: DTT 없이 처리됨.
도 5는 본 발명의 재조합 단백질이 나노입자를 형성함을 나타내는 실험 2의 동적 광산란 장치의 분석 결과이다.
도 6은 본 발명의 재조합 단백질이 나노입자를 형성함을 나타내는 실험 2의 투과전자현미경 사진이다. 왼쪽 사진: 눈금 막대 100nm; 오른쪽 사진: 스케일 바 20nm.
도 7은 실험 3에서 돼지 혈청의 항-돼지열 바이러스 항체 원자가를 나타낸다.
도 8은 실험 3에서 돼지열병 바이러스 챌린지(challenge) 후 실험 돼지의 생존율을 나타낸다.1 is a schematic diagram of the expression vector of Experiment 1. The tag DNA includes a C-myc tag, Strep-tag II and a His tag.
2 is a protein electrophoresis diagram of Experiment 1 showing the secretion and expression levels of recombinant proteins in C5-1, C5-4 and C5-7 cell lines. Arrows indicate recombinant proteins of the present invention. M stands for the commercially available BenchMark ™ Protein Ladder (Thermo Fisher Scientific).
3 is a protein electrophoresis diagram of Experiment 2 showing the secretion and expression level of a recombinant protein of a C5-1 cell line on days 3, 4, 6, 8, 9, 10 and 11; Arrows indicate recombinant proteins of the present invention. M stands for the commercially available BenchMark ™ Protein Ladder (Thermo Fisher Scientific).
4 is a protein electrophoresis diagram of Experiment 2 showing monomers and multimers of the recombinant protein of the present invention. Arrows indicate recombinant proteins of the present invention. M stands for the commercially available BenchMark ™ Protein Ladder (Thermo Fisher Scientific). DTT: dithiothreitol. +: treated with DTT; -: Processed without DTT.
5 is an analysis result of the dynamic light scattering device of Experiment 2 indicating that the recombinant protein of the present invention forms nanoparticles.
6 is a transmission electron micrograph of Experiment 2 showing that the recombinant protein of the present invention forms nanoparticles. Left photo: scale bar 100 nm; Right photo: scale bar 20 nm.
Figure 7 shows the anti-swine fever virus antibody valence of swine serum in Experiment 3.
8 shows the survival rate of experimental pigs after challenge with swine fever virus in Experiment 3.
본 명세서의 설명은 단지 예시적이고 설명적이며, 본 발명을 제한하려는 의도가 아니다. 본 명세서에서 사용되는 기술적, 과학적 용어는 달리 명확히 정의되지 않는 한, 당해 기술 분야에서 통상의 지식을 가진 자에 의해 일반적으로 이해되는 의미로 이해되어야 한다.The description herein is illustrative and explanatory only, and is not intended to limit the invention. Technical and scientific terms used in this specification should be understood as meanings commonly understood by those of ordinary skill in the art, unless clearly defined otherwise.
본 발명의 상세한 설명 및 특허청구범위에서 문맥상 명백하게 달리 지시되지 않는 한, 단수형 "한"(a 또는 an)은 복수형의 의미를 포함한다. 따라서, 예를 들어 "한 단백질"은 하나 이상의 (a) 단백질을 나타내고 "한 화합물"은 하나 이상의 화합물을 나타낸다. "포함한다"(comprise), "포함한다"(comprises), "포함하는"(comprising), "포함한다"(include), "포함한다"(includes) 및 "포함하는"(including)의 사용은 상호 교환 가능하며 제한적이지 않다. 각각의 특정 실시태양의 설명에서, "포함하는"이라는 용어가 사용될 때, 당업자는 일부 특정 상황에서 "기본적으로 ~로 구성된" 또는 "~이루어진"이라는 언어가 대신 사용될 수 있다는 것을 이해할 것임을 이해해야 한다.In the present description and claims, the singular "an" (a or an) includes the plural meaning, unless the context clearly dictates otherwise. Thus, for example, "a protein" refers to one or more (a) proteins and "a compound" refers to one or more compounds. The use of "comprise", "comprises", "comprising", "includes", "includes" and "including" interchangeable and non-restrictive. It should be understood that, when the term "comprising" is used in the description of each particular embodiment, those skilled in the art will understand that in some specific contexts the words "consisting essentially of" or "consisting of" may be used instead.
특정 범위의 수치 값이 제공되는 경우, 문맥이 달리 명시하지 않는 한, 수치 범위의 정수 및 수치 범위의 각 정수의 1/10, 및 범위의 상한과 하한 사이와 명시된 범위 내의 임의의 다른 명시된 값 또는 중간 범위는 본 발명에 포함된다.Where a range of numerical values is provided, unless the context dictates otherwise, the integers of the numerical range and tenths of each integer of the numerical range, and any other stated value within and between the upper and lower limits of the range, or Intermediate ranges are included in the present invention.
본 발명에 인용된 모든 문헌, 특허, 특허출원 및 기타 문헌은 참고자료로서 본 발명에 완전히 포함되며, 그 내용은 각각의 독립된 문헌, 특허, 특허출원 또는 기타 문헌에서 지적된 바와 같으며 참조 목적으로 본 발명에 포함된다.All documents, patents, patent applications, and other documents cited herein are fully incorporated herein by reference, the contents of which are as indicated in each independent document, patent, patent application, or other document and are incorporated by reference. Included in the present invention.
정의:Justice:
본 발명에 사용된 "암호화한다/암호화"(encode/encoding)는 폴리뉴클레오타이드가 전사 및/또는 번역되어 폴리펩타이드를 생성하거나 추가로 단백질을 형성하는 과정을 지칭한다. "SEQ ID NO: 01로 암호화된 제 1 폴리뉴클레오타이드"는 제 1 폴리뉴클레오타이드가 전사 및/또는 번역되어 서열이 SEQ ID NO: 01인 단백질을 생산하는 것을 의미한다. "페리틴으로 암호화된 제 2 폴리뉴클레오타이드"는 제 2 폴리뉴클레오타이드가 전사 및/또는 번역되어 페라틴인 단백질을 생산하는 것을 의미한다. 본 발명에서 사용된 다른 유사한 설명은 이러한 개념에 기초하여 해석될 수 있다. 암호화는 생체 내 또는 시험관 내에서 수행될 수 있다. 암호화는 상동 세포 또는 이종 세포에서 수행될 수 있다.As used herein, “encode/encoding” refers to the process by which a polynucleotide is transcribed and/or translated to produce a polypeptide or further form a protein. "A first polynucleotide encoded by SEQ ID NO: 01" means that the first polynucleotide is transcribed and/or translated to produce a protein having the sequence SEQ ID NO: 01. "Second polynucleotide encoded by ferritin" means that the second polynucleotide is transcribed and/or translated to produce a protein that is feratin. Other similar descriptions used herein may be interpreted based on these concepts. Encryption can be performed in vivo or in vitro. Encoding can be performed in homologous or heterologous cells.
본 발명에서 "돼지열병 바이러스 감염 예방"은 돼지열병 바이러스 감염에 의해 유발되는 질병 또는 증후군의 예방을 의미한다. 구체적으로, 예를 들어, 돼지열병 바이러스에 의한 불쾌감이나 증후군이 발생하는 것을 방지하거나, 불쾌감이나 증후군의 정도가 완화된다. 당해 기술분야에서 통상의 지식을 가진 자는 "돼지열병 바이러스 감염 예방"이 지정된 개인이 돼지열병 바이러스 감염에서 완전히 자유롭다는 것을 의미하는 것이 아니라, 전염병 예방의 관점에서, 지정된 개인에 대한 돼지열병 바이러스의 피해가 감소된다.In the present invention, "prevention of swine fever virus infection" means prevention of diseases or syndromes caused by swine fever virus infection. Specifically, for example, the occurrence of discomfort or syndrome caused by the swine fever virus is prevented, or the degree of discomfort or syndrome is alleviated. A person of ordinary skill in the art would know that "prevention of swine fever virus infection" does not mean that a designated individual is completely free from swine fever virus infection, but from the point of view of epidemic prevention, damage is reduced.
본 발명에 사용된 바와 같이, "서열이 SEQ ID NO인 것" 또는 유사한 설명은 단백질 또는 폴리뉴클레오타이드가 특정 서열을 포함하지만, 특정 서열에 제한되지 않는다는 것을 의미한다. 예를 들어, 본 발명에서 "아미노산 서열이 SEQ ID NO: 01인 항원 모이어티"는 항원 모이어티의 아미노산 서열이 SEQ ID NO: 01을 포함하는 것을 의미하나(특정 실시태양에서, SEQ ID NO: 01로 주로 구성된다), 당해 기술분야의 통상의 지식을 가진 자는 필요에 따라 당해 분야의 상식을 기초로 언급된 서열을 변형할 수 있으므로, 변형된 서열은 SEQ ID NO: 01 이외의 서열을 포함하도록 한다. 본 발명은 1개 내지 수 개의 아미노산에 의한 본 발명의 단백질의 N-말단 또는 C-말단 확장을 배제한다. 본 발명은 또한 특정 사용 요건에 기초하여 본 발명의 단백질의 N-말단 또는 C-말단에서 다른 단백질 서열의 확장을 배제하지 않는다. 예를 들어, His 태그, Strep 태그 및 T7 태그와 같은 다양한 친화성 태그는 SEQ ID NO: 01의 N-말단 또는 C-말단에 결합될 수 있다. 이러한 방식으로, 이러한 친화성 태그에 상응하는 항체는 재조합 단백질의 발현을 검출하기 위해 사용될 수 있다(예를 들어, 웨스턴 블롯 방법에 적용). 변형된 서열은 돼지열병 바이러스 감염 예방을 위한 본 발명의 효과를 상실하지 않는 한 여전히 본 발명의 범위에 속해야 한다.As used herein, "the sequence is SEQ ID NO" or similar description means that the protein or polynucleotide includes, but is not limited to, a specific sequence. For example, in the present invention, "an antigenic moiety whose amino acid sequence is SEQ ID NO: 01" means that the amino acid sequence of the antigenic moiety comprises SEQ ID NO: 01 (in certain embodiments, SEQ ID NO: 01), those of ordinary skill in the art can modify the sequence mentioned based on common sense in the art if necessary, so the modified sequence includes a sequence other than SEQ ID NO: 01 to do it The present invention excludes N-terminal or C-terminal expansion of the proteins of the invention by one to several amino acids. The present invention also does not preclude extension of other protein sequences at the N-terminus or C-terminus of the proteins of the present invention based on specific use requirements. For example, various affinity tags such as His tag, Strep tag and T7 tag can be bound to the N-terminus or C-terminus of SEQ ID NO: 01. In this way, antibodies corresponding to these affinity tags can be used to detect expression of the recombinant protein (eg, applied to Western blot methods). The modified sequence should still fall within the scope of the present invention as long as the effect of the present invention for preventing swine fever virus infection is not lost.
본 발명에 사용된 바와 같이, "작동가능하게 연결된"은 폴리뉴클레오타이드의 2개 이상의 단편이 유전 공학 수단에 의해 서로 연결되어 있고, 이들 폴리뉴클레오타이드가 숙주(표시된 뉴클레오타이드 서열을 발현하는 데 사용된 유기체로서 본 발명에서 지칭됨)에 의해 사용되도록 보장되어 원하는 단백질을 식별하고 암호화하는 것을 의미한다. 구체적으로, 실제 작업에서 서로 연결된 폴리뉴클레오타이드 사이의 여러 뉴클레오타이드를 채워야 하는 경우, 채워진 뉴클레오타이드가 하류 폴리뉴클레오타이드가 암호화를 상쇄하지 않도록 해야 한다. 예를 들어, 채워진 뉴클레오타이드 서열의 전체 길이는 3의 배수여야 하는데 이는 코돈은 3개의 뉴클레오티드를 가져야 하기 때문이다.As used herein, "operably linked" means that two or more fragments of polynucleotides are linked together by means of genetic engineering and that these polynucleotides are linked to a host (an organism used to express the indicated nucleotide sequence). referred to herein) to identify and encode the desired protein. Specifically, when in actual operation it is necessary to fill several nucleotides between polynucleotides linked to each other, the filled nucleotides must be such that the downstream polynucleotide does not cancel the coding. For example, the total length of a filled nucleotide sequence must be a multiple of 3 since the codon must have 3 nucleotides.
본 발명의 제 1 양태는 재조합 단백질 및 이를 함유하는 조성물에 관한 것이다. 재조합 단백질은 융합 단백질이며 항원성 모이어티와 페리틴 모이어티를 포함한다. 항원 모이어티는 주로 숙주 면역 반응을 유도하는 재조합 단백질의 부분을 의미한다. 본 발명은 재조합 단백질의 다른 부분이 또한 숙주 면역 반응을 유도하는 효과를 갖는 것을 배제하지 않는다. 바람직하게는, 항원 모이어티의 아미노산 서열은 SEQ ID NO: 01이다. 가능하게는, 항원 모이어티는 SEQ ID NO: 03에 의해 암호화된다. 당업자는 항원 모이어티가 상이한 유기체에서 발현되는 경우, 항원 모이어티를 암호화하는 데 사용되는 서열은 유기체의 코돈 사용 편향을 충족하도록 변경될 수 있음을 이해해야 한다.A first aspect of the present invention relates to a recombinant protein and a composition containing the same. A recombinant protein is a fusion protein and contains an antigenic moiety and a ferritin moiety. An antigenic moiety refers to a portion of a recombinant protein that primarily elicits a host immune response. The present invention does not exclude that other portions of the recombinant protein also have the effect of inducing a host immune response. Preferably, the amino acid sequence of the antigenic moiety is SEQ ID NO: 01. Possibly, the antigenic moiety is encoded by SEQ ID NO: 03. One of ordinary skill in the art should understand that when the antigenic moiety is expressed in a different organism, the sequence used to encode the antigenic moiety may be altered to meet the codon usage bias of the organism.
페리틴은 당업계에 정의된 바와 같으며; 바람직하게는, 본 발명에서 사용된 페리틴의 모이어티는 헬리코박터 파일로리(Helicobacter pylori)로부터 유래된다. 본 발명에서 사용된 "헬리코박터 파일로리로부터 유래된"은 페리틴 모이어티의 아미노산 서열이 야생형 헬리코박터 파일로리에 의해 운반되는 페리틴의 아미노산 서열과 실질적으로 동일함을 의미한다. 설명은 헬리코박터 파일로리로부터 정제 또는 단리되는 본 발명에 사용된 페리틴을 제한하지 않는다. 바람직한 실시태양에서, 페리틴 모이어티의 아미노산 서열은 SEQ ID NO: 02이다. 가능하게는, 페리틴 모이어티는 SEQ ID NO: 04에 의해 암호화된다.Ferritin is as defined in the art; Preferably, the moiety of ferritin used in the present invention is derived from Helicobacter pylori. As used herein, "derived from Helicobacter pylori" means that the amino acid sequence of the ferritin moiety is substantially identical to the amino acid sequence of ferritin carried by wild-type Helicobacter pylori. The description does not limit the ferritin used in the present invention to be purified or isolated from Helicobacter pylori. In a preferred embodiment, the amino acid sequence of the ferritin moiety is SEQ ID NO: 02. Possibly, the ferritin moiety is encoded by SEQ ID NO: 04.
특정 실시태양에서, 링커가 항원 모이어티와 페리틴 모이어티 사이에 추가로 포함된다. 실현 가능한 실시태양에서, 링커의 아미노산 서열은 SEQ ID NO: 05이다.In certain embodiments, a linker is further included between the antigenic moiety and the ferritin moiety. In a feasible embodiment, the amino acid sequence of the linker is SEQ ID NO: 05.
본 발명의 돼지열병 바이러스 감염 예방용 조성물은 본 발명의 재조합 단백질 및 약학적으로 허용 가능한 담체를 포함한다. 가능한 실시태양에서, 재조합 단백질의 농도는 조성물의 총 부피를 기준으로 1 내지 60㎍/mL이고; 바람직하게는 7.5 내지 30㎍/mL; 보다 바람직하게는 7.5 내지 15㎍/mL이다. 특정 실시태양에서, 재조합 단백질의 농도는 하기 농도 중 임의의 하나 또는 임의의 두 농도 사이의 농도이다: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, 33, 35, 37, 39, 41, 43, 45, 47, 49, 51, 53, 55, 57, 59 및 60㎍/mL.The composition for preventing swine fever virus infection of the present invention includes the recombinant protein of the present invention and a pharmaceutically acceptable carrier. In a possible embodiment, the concentration of the recombinant protein is between 1 and 60 μg/mL, based on the total volume of the composition; preferably 7.5 to 30 μg/mL; More preferably, it is 7.5-15 micrograms/mL. In certain embodiments, the concentration of the recombinant protein is a concentration between any one or any two of the following concentrations: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, 33, 35, 37, 39, 41, 43, 45, 47, 49, 51, 53, 55, 57, 59 and 60 μg/mL.
실현 가능한 실시태양에서, 약학적으로 허용 가능한 담체는 물, 인산염 완충 식염수, 알코올, 글리세린, 키틴, 알기네이트, 콘드로이틴, 비타민 E, 미네랄, 또는 이들의 조합이다. 특정 실시태양에서, 조성물은 사용자의 필요에 따라 고체, 액체 또는 콜로이드 상태로 제제화된다. 다른 실시태양에서, 조성물은 사용자의 편의를 위해 용기(예를 들어, 유리병)에 저장된다.In a feasible embodiment, the pharmaceutically acceptable carrier is water, phosphate buffered saline, alcohol, glycerin, chitin, alginate, chondroitin, vitamin E, minerals, or combinations thereof. In certain embodiments, the composition is formulated in a solid, liquid, or colloidal state depending on the needs of the user. In another embodiment, the composition is stored in a container (eg, a glass bottle) for the convenience of the user.
한 바람직한 실시태양에서, 조성물은 보조제를 추가로 포함한다. 보조제는 프로인트 완전 보조제, 프로인트 불완전 보조제, 알루미늄, 계면활성제, 음이온성 폴리머, 펩타이드, 오일 에멀젼 또는 이들의 조합일 수 있지만 이에 제한되지는 않는다. 구체적으로, MontanideTM ISA 201 VG(SEPPIC, France)와 같으나 이에 제한되지 않는 시장에서 입수가능한 보조제가 선택될 수 있다. 재조합 단백질에 대한 보조제의 비율은 상황에 따라 결정될 수 있다. 가능하게는, 비율은 1:1(w/w)이다.In one preferred embodiment, the composition further comprises an adjuvant. The adjuvant can be, but is not limited to, Freund's complete adjuvant, Freund's incomplete adjuvant, aluminum, surfactants, anionic polymers, peptides, oil emulsions, or combinations thereof. Specifically, adjuvants available on the market such as, but not limited to, Montanide ™ ISA 201 VG (SEPPIC, France) may be selected. The ratio of the adjuvant to the recombinant protein may be determined according to the circumstances. Possibly, the ratio is 1:1 (w/w).
본 발명의 제 2 양태는 발현 카세트, 이를 함유하는 발현 벡터, 및 이들 발현 카세트 또는 발현 벡터를 갖는 포유동물 세포에 관한 것이다. 본 발명에서 언급되는 발현 카세트는 발현 요소, 및 상기 발현 요소에 작동 가능하게 연결된 제 1 폴리뉴클레오타이드 및 제 2 폴리뉴클레오타이드를 포함하는 폴리뉴클레오타이드를 의미한다. 발현 요소는 프로모터를 포함하고; 제 1 폴리뉴클레오타이드는 SEQ ID NO: 01로 암호화되고 제 2 폴리뉴클레오타이드는 페리틴으로 암호화된다.A second aspect of the present invention relates to expression cassettes, expression vectors containing same, and mammalian cells having these expression cassettes or expression vectors. An expression cassette as referred to in the present invention means an expression element and a polynucleotide comprising a first polynucleotide and a second polynucleotide operably linked to the expression element. Expression elements include promoters; The first polynucleotide is encoded as SEQ ID NO: 01 and the second polynucleotide is encoded as ferritin.
바람직한 실시태양에서, 제 2 폴리뉴클레오타이드는 SEQ ID NO: 02로 암호화된다. 실현 가능한 실시태양에서, 제 2 폴리뉴클레오타이드는 SEQ ID NO: 04이다. 바람직하게는, 본 발명의 재조합 단백질은 발현 카세트의 발현 후에 수득될 수 있다. 가능하게는, 발현 카세트는 SEQ ID NO: 08이다.In a preferred embodiment, the second polynucleotide is encoded by SEQ ID NO: 02. In a feasible embodiment, the second polynucleotide is SEQ ID NO: 04. Preferably, the recombinant protein of the present invention can be obtained after expression of the expression cassette. Possibly, the expression cassette is SEQ ID NO: 08.
본 발명의 발현 벡터는 본 발명의 발현 카세트를 보유한다. 실현 가능한 실시태양에서, 발현 벡터는 미리 설정된 숙주에서 복제될 수 있는 서열을 갖는다. 또 다른 실현 가능한 실시태양에서, 발현 벡터는 신호 펩타이드, 태그 DNA, 또는 이들의 조합으로서 암호화된 서열을 추가로 포함한다. 한 바람직한 실시태양에서, 발현 벡터는 포유동물 세포 발현 시스템에서 사용된다.The expression vector of the present invention carries the expression cassette of the present invention. In a feasible embodiment, the expression vector has sequences capable of replication in a predetermined host. In another feasible embodiment, the expression vector further comprises a sequence encoded as a signal peptide, tag DNA, or a combination thereof. In one preferred embodiment, the expression vector is used in a mammalian cell expression system.
본 발명의 발현 카세트 또는 발현 벡터를 갖는 포유동물 세포는 세포 공학 기술에 의해 발현 카세트 또는 발현 벡터로 형질감염된 포유동물 세포를 지칭한다. 가능하게는, 형질감염은 전기천공 기술에 의해 수행된다.A mammalian cell having an expression cassette or expression vector of the present invention refers to a mammalian cell transfected with the expression cassette or expression vector by cell engineering techniques. Possibly, transfection is performed by electroporation techniques.
바람직하게는, 발현 카세트 또는 발현 벡터는 세포 내로 형질감염된 후 세포에서 유지될 것이다. 보다 바람직하게는, 발현 카세트 또는 발현 벡터가 세포 내로 형질감염된 후, 세포가 복제함에 따라 복제될 것이다. 실행 가능한 실시태양에서, 포유동물 세포는 차이니즈 햄스터 난소(CHO) 세포이다.Preferably, the expression cassette or expression vector will be maintained in the cell after transfection into the cell. More preferably, after the expression cassette or expression vector is transfected into a cell, it will replicate as the cell replicates. In a feasible embodiment, the mammalian cell is a Chinese Hamster Ovary (CHO) cell.
본 발명은 또한 본 발명의 포유동물 세포에서 발현 카세트를 발현시키는 것을 포함하는, 본 개시내용의 재조합 단백질을 발현시키는 방법에 관한 것이다. 가능하게는, 발현 카세트는 본 개시내용의 발현 벡터에 존재한다. 상기 방법은 포유동물 세포에 의해 발현되는 재조합 단백질을 얻기 위한 정제 단계를 추가로 포함할 수 있다.The present invention also relates to a method of expressing a recombinant protein of the present disclosure comprising expressing the expression cassette in a mammalian cell of the present invention. Possibly, the expression cassette is present in the expression vector of the present disclosure. The method may further comprise a purification step to obtain a recombinant protein expressed by the mammalian cells.
실험 1: 발현 벡터의 구축 및 CHO 세포의 형질감염.Experiment 1: Construction of expression vectors and transfection of CHO cells.
1. 재료 및 방법1. Materials and Methods
1.1 CHO 세포 및 배양 배지:1.1 CHO cells and culture medium:
CHO-S 세포(Thermo Fisher Scientific, USA)를 재조합 단백질 생산을 위한 숙주 세포로 사용하였다. HyClone CDM4PERMAb 배양 배지(GE Healthcare, USA)를 CHO 세포의 무혈청 현탁 배양에 사용하였으며 추가 페니실린-스트렙토마이신(Thermo Fisher Scientific; 페니실린의 최종 농도는 100U/mL이며; 스트렙토마이신의 최종 농도는 100㎍/mL이다) 및 GlutaMAX™ 보충제(Thermo Fisher Scientific; 최종 농도 6mM이다)를 첨가하였다.CHO-S cells (Thermo Fisher Scientific, USA) were used as host cells for recombinant protein production. HyClone CDM4PERMAb culture medium (GE Healthcare, USA) was used for serum-free suspension culture of CHO cells and additional penicillin-streptomycin (Thermo Fisher Scientific; penicillin final concentration was 100 U/mL; streptomycin final concentration was 100 µg/mL). mL) and GlutaMAX™ supplement (Thermo Fisher Scientific; final concentration is 6 mM).
안정한 세포주를 스크리닝하기 위해 사용된 반고체 배지는 ClonaCell™-CHO ACF 메틸셀룰로스 기반 반고체 배지(STEMCELL Technologies, USA)이었고, 추가 하이그로마이신 B(Thermo Fisher Scientific; 최종 농도는 400㎍/mL이다)는 스크리닝 과정에서 추가해야 한다. CHO 세포를 증폭 및 배양하는 이후 과정에서, 추가적인 세포 배양 첨가제(HyClone Cell Boost Kit, GE Healthcare)를 상황에 따라 첨가하였으며, 첨가 방법은 제조사의 권고에 따라 진행한다.The semi-solid medium used for screening the stable cell lines was ClonaCell™-CHO ACF methylcellulose based semi-solid medium (STEMCELL Technologies, USA) and additional hygromycin B (Thermo Fisher Scientific; final concentration is 400 μg/mL) was screened. should be added in the process. In the subsequent process of amplifying and culturing CHO cells, additional cell culture additives (HyClone Cell Boost Kit, GE Healthcare) were added according to the circumstances, and the addition method is performed according to the manufacturer's recommendations.
1.2 발현 벡터의 구축 및 CHO 세포의 형질감염:1.2 Construction of Expression Vector and Transfection of CHO Cells:
미국 GenScript사는 CHO 세포의 바람직한 코돈에 따라 본 발명의 재조합 단백질을 암호화할 수 있는 폴리뉴클레오타이드(SEQ ID NO: 07) 합성을 의뢰받았다. 하기 표 1에 도시된 바와 같이, 폴리뉴클레오타이드는 돼지열병 바이러스의 E2 단백질과 헬리코박터 파일로리로부터 유래된 페리틴을 포함하는 SEQ ID NO: 06의 서열을 갖는 융합 단백질을 암호화할 수 있다.GenScript, USA, was commissioned to synthesize a polynucleotide (SEQ ID NO: 07) capable of encoding a recombinant protein of the present invention according to a preferred codon of a CHO cell. As shown in Table 1 below, the polynucleotide may encode a fusion protein having the sequence of SEQ ID NO: 06 comprising the E2 protein of swine fever virus and ferritin derived from Helicobacter pylori.
VKVLRGQIVQGVIWLLLVTGAQGRLACKEDYRYAISSTDEIGLLGAGGLTTTWKEYTHDLQLNDGTVKATCVAGSFKVTALNVVSRRYLASLHKKALPTSVTFELLFDGTNPSTEEMGDDFGFGLCPFDTRPVVKGKYNATLVNGSAFYLVCPIGWTGVIECTAVSPTTLRTEVVKTFRRDKPFPHRMNCVTTTVENEDLFYCKLGGNWTCVKGEPVVYTGGLVKQCRWCGFDFNEPDGLPHYPIGKCILANETSYRVVDSTDCNRDGVVISTEGSHECLIGNTTVKVHASDERLGPMPCRPKEIVSSAGPAMKTSCTFNYAKTLKNRYYEPRDSYFQQYMLKGEYQYWFDLDATDRHSDYFAEF 
VKVLRGQIVQGVIWLLLVTGAQGRLACKEDYRYAISSTDEIGLLGAGGLTTTWKEYTHDLQLNDGTVKATCVAGSFKVTALNVVSRRYLASLHKKALPTSVTFELLFDGTNPSTEEMGDDFGFGLCPFDTRPVVKGKYNATLVNGSAFYLVCPIGWTGVIECTAVSPTTLRTEVVKTFRRDKPFPHRMNCVTTTVENEDLFYCKLGGNWTCVKGEPVVYTGGLVKQCRWCGFDFNEPDGLPHYPIGKCILANETSYRVVDSTDCNRDGVVISTEGSHECLIGNTTVKVHASDERLGPMPCRPKEIVSSAGPAMKTSCTFNYAKTLKNRYYEPRDSYFQQYMLKGEYQYWFDLDATDRHSDYFAEF
■
이탤릭체는 본 발명의 재조합 단백질의 페리틴 모이어티, SEQ ID NO: 02를 의미한다.
■
상자는 본 발명의 재조합 단백질의 링커, SEQ ID NO: 05를 나타낸다.■ Bold type refers to the antigenic moiety of the recombinant protein of the present invention, SEQ ID NO: 01.
■ Italics indicate the ferritin moiety of the recombinant protein of the present invention, SEQ ID NO: 02.
■ The box represents the linker of the recombinant protein of the present invention, SEQ ID NO: 05.
폴리뉴클레오타이드는 포유동물 세포 발현 벡터에 삽입된다. 본 발명의 재조합 단백질을 암호화하는 데 사용된 폴리뉴클레오타이드에 더하여, 이 실험에 사용된 발현 벡터는 여전히 인간 사이토메갈로바이러스(CMV 프로모터)의 초기 유전자로부터의 인핸서-프로모터, 마우스 IgK 분비 신호를 암호화하는 서열(면역글로불린 카파 분비 신호) 및 태그 DNA(도 1 참조)를 보유한다. 발현 벡터 서열이 맞는지 시퀀싱한 후, Amaxa™ Cell Line Nucleofector™ 키트 V(Lonza Bioscience, USA) 형질감염 시약과 DNA 형질감염에 대한 Nucleofector 2b 장치 전기천공 세포 형질감염 기기를 사용한다. 형질감염 당시의 CHO 세포의 수는 2 x 106이었고, 발현 벡터의 양은 1㎍이었다.The polynucleotide is inserted into a mammalian cell expression vector. In addition to the polynucleotide used to encode the recombinant protein of the present invention, the expression vector used in this experiment was still an enhancer-promoter from an early gene of human cytomegalovirus (CMV promoter), a sequence encoding a mouse IgK secretion signal. (Immunoglobulin kappa secretion signal) and tag DNA (see Figure 1). After sequencing for correct expression vector sequences, use Amaxa™ Cell Line Nucleofector™ Kit V (Lonza Bioscience, USA) transfection reagent and Nucleofector 2b device electroporation cell transfection instrument for DNA transfection. The number of CHO cells at the time of transfection was 2×10 6 , and the amount of expression vector was 1 μg.
1.3 고 항원 발현 세포주의 스크리닝 및 종자 세포 은행의 설립:1.3 Screening of highly antigen-expressing cell lines and establishment of seed cell banks:
형질감염된 CHO 세포를 2일 동안 HyClone CDM4PERMAb 배지에서 배양한 후, 히그로마이신 B를 첨가하여 약물 내성 세포주를 선택하였다. 하이그로마이신 B에 의해 선택된 미니풀은 약 600 cells/mL의 농도로 ClonaCell™-CHO ACF 반고체 배지에서 배양되었다. 단일 세포가 덩어리로 성장한 후(약 7 내지 9일), ClonePix FL 기기를 사용하여 96웰 플레이트에서 배양할 후보 세포주를 선택한다. 세포가 거의 완전히 덮인 후, 세포를 48웰 플레이트로 옮기고 이틀 동안 계속 배양한다. 다음으로, 세포 배양 상청액 100μL를 취하여 샌드위치 효소 결합 면역흡착 검사(ELISA) 분석을 수행하여, 본 발명의 재조합 단백질을 고발현할 수 있는 세포 집단을 스크리닝하였다.After culturing the transfected CHO cells in HyClone CDM4PERMAb medium for 2 days, hygromycin B was added to select drug-resistant cell lines. The minipools selected by hygromycin B were cultured in ClonaCell™-CHO ACF semi-solid medium at a concentration of about 600 cells/mL. After single cells have grown into clumps (approximately 7-9 days), select candidate cell lines for culture in 96-well plates using a ClonePix FL instrument. After the cells are almost completely covered, transfer the cells to a 48-well plate and continue to incubate for two days. Next, 100 μL of the cell culture supernatant was taken and subjected to a sandwich enzyme-linked immunosorbent assay (ELISA) analysis to screen a cell population capable of high expression of the recombinant protein of the present invention.
ELISA 방법에 사용된 포획 항체는 토끼 항-His 항체(Bethyl Laboratories, USA); 표지된 검출 항체는 토끼 항-c-myc 항체(HRP Conjugated, Bethyl Laboratories, USA)이고; 사용된 착색제는 TMB 기질 용액(United States Biological, USA)이다. 450nm에서 ELISA 판독기로 각 웰의 흡광도를 측정한다. ELISA 결과로부터, 항원 발현이 높은 세포주를 선별하였다.The capture antibodies used in the ELISA method were rabbit anti-His antibody (Bethyl Laboratories, USA); The labeled detection antibody was a rabbit anti-c-myc antibody (HRP Conjugated, Bethyl Laboratories, USA); The colorant used was TMB substrate solution (United States Biological, USA). Measure the absorbance of each well with an ELISA reader at 450 nm. From the results of ELISA, cell lines with high antigen expression were selected.
다음으로, 세포 진탕 플라스크(125mL)에서 배양하여 상기 선별된 고 항원 발현 세포주가 현탁 배양에서 덩어리지기 쉽지 않음을 확인한 후, 고 항원 발현 세포주의 선별을 E2 단백질 특이적 샌드위치 ELISA 및 단백질 전기영동 분석을 사용함으로써 추가로 수행하였다 Next, after confirming that the selected high antigen-expressing cell line is not prone to agglomeration in suspension culture by culturing in a cell shake flask (125 mL), the selection of the high antigen-expressing cell line was performed by E2 protein-specific sandwich ELISA and protein electrophoresis analysis. was further carried out by using
E2 단백질에 특이적인 ELISA에 사용된 포획된 항체는 WH303 모노클로날 항체(APHA, UK)이고; 표지된 검출 항체는 토끼 항-c-myc 항체이고; 사용된 착색제는 TMB 기질 용액이다. 450 nm에서 ELISA 판독기로 각 웰의 흡광도를 측정한다. ELISA 및 단백질 전기영동 결과에 따라 항원 발현이 높은 세포주를 선별하였다.The captured antibody used in the ELISA specific for the E2 protein was the WH303 monoclonal antibody (APHA, UK); the labeled detection antibody is a rabbit anti-c-myc antibody; The colorant used is a TMB substrate solution. Measure the absorbance of each well with an ELISA reader at 450 nm. Cell lines with high antigen expression were selected according to the results of ELISA and protein electrophoresis.
그 후, 선별된 세포주를 ClonaCell™-CHO ACF 반고체 배지에서 배양하고, 상기 스크리닝 단계를 5회 반복하였다.Then, the selected cell line was cultured in ClonaCell™-CHO ACF semi-solid medium, and the above screening step was repeated 5 times.
스크리닝 후 수득된 고 항원 발현 세포주를 CELLBANKER 2(Nippon Zenyaku Kogyo, Japan) 무혈청 세포 동결보존 용액과 혼합한 후 동결 보존하였다.The high antigen-expressing cell line obtained after screening was mixed with CELLBANKER 2 (Nippon Zenyaku Kogyo, Japan) serum-free cell cryopreservation solution and then cryopreserved.
2. 실험 결과2. Experimental results
실험 결과가 도 2에 도시된다. C5-1 세포주는 최고의 발현 수준을 가지며 세포 성장 상태가 안정적이다. 따라서, 본 실험에서, C5-1 세포주를 본 발명의 재조합 단백질의 후속 생산을 위한 종자 세포로 선택하고, 이를 이용하여 종자 세포 은행을 설립하였다.The experimental results are shown in FIG. 2 . The C5-1 cell line has the highest expression level and the cell growth state is stable. Therefore, in this experiment, the C5-1 cell line was selected as a seed cell for the subsequent production of the recombinant protein of the present invention, and a seed cell bank was established using this.
실험 2: 재조합 항원의 정제 및 나노입자 구조 분석Experiment 2: Purification of Recombinant Antigen and Nanoparticle Structure Analysis
1. 재료 및 방법1. Materials and Methods
종자 세포 은행으로부터의 CHO 세포를 5L의 배지와 함께 플라스크 배양을 진탕하기 위해 사용하였다. 11일 동안 배양한 후, 세포 배양액을 20,000 x g에서 2시간 동안 원심분리하여 상층액을 모았다. 상층액을 0.22μm 필터 막으로 여과하였다. 고정화된 금속 이온 친화성 수지인 Ni Sepharose excel(GE Healthcare, Sweden)을 사용하여 재조합 단백질을 정제하였다. 동적 광산란 장비 ZetaSizer ZEN 3600(Malvern, USA)과 투과 전자 현미경 JEM-2100F(JEOL, Japan)를 사용하여 나노 입자를 형성하는 재조합 단백질의 능력을 분석하였다.CHO cells from the seed cell bank were used to shake flask cultures with 5 L of medium. After culturing for 11 days, the cell culture was centrifuged at 20,000 x g for 2 hours to collect the supernatant. The supernatant was filtered through a 0.22 μm filter membrane. Recombinant protein was purified using Ni Sepharose excel (GE Healthcare, Sweden), which is an immobilized metal ion affinity resin. The ability of the recombinant protein to form nanoparticles was analyzed using a dynamic light scattering equipment ZetaSizer ZEN 3600 (Malvern, USA) and a transmission electron microscope JEM-2100F (JEOL, Japan).
2. 실험 결과2. Experimental results
단백질 전기영동 결과, C5-1 세포주가 재조합 단백질을 안정적으로 분비 및 발현할 수 있음을 확인하였다(도 3). 또한, 세포외 재조합 단백질은 고정된 금속 이온 친화성 수지를 사용하여 정제할 수 있다. 정제된 재조합 단백질을 다이티오트레이톨(DTT)로 처리하여 단백질 분자 사이의 이황화 결합을 끊었다. 모노머 단백질의 분자량은 약 70kDa였다. DTT 처리 없이 정제된 재조합 단백질 분자 사이에 멀티머를 형성하였다(도 4).As a result of protein electrophoresis, it was confirmed that the C5-1 cell line could stably secrete and express the recombinant protein (FIG. 3). In addition, the extracellular recombinant protein can be purified using an immobilized metal ion affinity resin. The purified recombinant protein was treated with dithiothreitol (DTT) to break disulfide bonds between protein molecules. The molecular weight of the monomeric protein was about 70 kDa. Multimers were formed between purified recombinant protein molecules without DTT treatment (FIG. 4).
한편, 동적 광산란 분석의 결과, 본 실험에서 재조합 단백질은 실제로 자가 조립되어 평균 수화된 입자 크기가 약 37 nm인 나노입자를 형성할 수 있음을 나타내었다(도 5). 투과전자현미경을 사용하여 나노입자의 형태를 추가로 관찰한 결과, 이 실험에서 재조합 단백질이 나노입자를 형성할 수 있고 입자 크기가 약 20-50 nm임을 알 수 있었다(도 6).Meanwhile, as a result of dynamic light scattering analysis, it was shown that the recombinant protein in this experiment could actually self-assemble to form nanoparticles with an average hydrated particle size of about 37 nm (FIG. 5). As a result of further observation of the nanoparticle morphology using a transmission electron microscope, it was found that the recombinant protein could form nanoparticles in this experiment and the particle size was about 20-50 nm (FIG. 6).
실험 3: 백신 제조 및 돼지 면역 챌린지 연구Experiment 3: Vaccine Preparation and Swine Immune Challenge Study
1. 재료 및 방법1. Materials and Methods
1.1 백신 제조:1.1 Vaccine Manufacturing:
실험 2에서 정제하여 얻은 재조합 단백질 용액을 특정 농도로 조절하고 MontanideTM ISA 201 VG 보조제(SEPPIC, France)와 1:1(w/w)의 비율로 혼합하여 5종의 백신, V-1311, V-1331, V-1332, V-1333 및 V-1334(표 2)을 제조하였다. 또한, 0.01% 티오머살(w/v)을 함유하는 생리 식염수를 ISA 201 VG 보조제와 혼합하여 무항원 대조군 V-1335를 제조하였다. 백신은 나중에 사용하기 위해 4℃의 냉장고에 보관되었다.The recombinant protein solution purified in Experiment 2 was adjusted to a specific concentration and mixed with Montanide TM ISA 201 VG adjuvant (SEPPIC, France) at a ratio of 1:1 (w/w) to 5 vaccines, V-1311, V -1331, V-1332, V-1333 and V-1334 (Table 2) were prepared. In addition, an antigen-free control V-1335 was prepared by mixing physiological saline containing 0.01% thiomersal (w/v) with ISA 201 VG adjuvant. The vaccine was stored in a refrigerator at 4°C for later use.
1.2 돼지 면역 챌린지 연구:1.2 Pig Immune Challenge Study:
이 실험은 행정원 농업위원회 동물건강실험실 동물약물시험과의 유전자 변형 유기체(GMO) 동물 사육장에서 수행하였다. 돼지열병 바이러스 항체 음성 판정을 받은 9주령의 SPF(특이 병원체 무함유) 돼지 총 20마리를 선택하여 무작위로 그룹 A 내지 F로 나눴다. 각 그룹의 돼지 수는 2 내지 4마리이었고; 그룹 A 내지 E는 실험 그룹이었고, 그룹 F는 대조 그룹이다. 돼지는 9주령에 근육주사로 1회 면역하였고, 예방접종 용량은 2mL이었다. 돼지 테스트 그룹은 표 2에 나열된다.This experiment was conducted in a genetically modified organism (GMO) animal kennel of the Animal Health Laboratory, Animal Drug Testing Division, of the Agricultural Committee of the Administration. A total of 20 9-week-old SPF (specific pathogen-free) pigs tested negative for swine fever virus antibody were randomly divided into groups A to F. The number of pigs in each group was 2-4; Groups A to E were the experimental group, and group F was the control group. Pigs were immunized once by intramuscular injection at the age of 9 weeks, and the vaccination dose was 2 mL. Pig test groups are listed in Table 2.
접종 전(9주령), 접종 후 1주(10주령), 접종 후 2주(11주령), 및 접종 후 3주(12주령), 3~5mL의 혈액을 목 정맥에서 채취하고 근섬유소분리 혈액을 준비하였고, -80℃의 냉장고에 보관하였다. 12주령(면역 접종 후 3주)에, 각 그룹의 돼지는 챌린지 연구를 위해 고독성 돼지열병 바이러스 균주 ALD(2mL)를 근육내 주사하였다. 챌린지 후, 돼지의 임상 증상 및 체온 변화를 매일 관찰하여 생존율을 계산하였다. 14주령(챌린지 후 2주)에 모든 돼지를 희생시키고 해부학적 병리학적 검사를 받았다.Before inoculation (9 weeks old), 1 week after inoculation (10 weeks old), 2 weeks after inoculation (11 weeks old), and 3 weeks (12 weeks old) after inoculation, 3-5mL of blood is collected from the neck vein and myofibrillar separated blood was prepared and stored in a refrigerator at -80°C. At 12 weeks of age (3 weeks post immunization), pigs in each group were injected intramuscularly with the highly virulent swine fever virus strain ALD (2 mL) for the challenge study. After challenge, the pig's clinical symptoms and changes in body temperature were observed daily to calculate the survival rate. All pigs were sacrificed at 14 weeks of age (2 weeks post-challenge) and underwent anatomical and pathological examination.
2. 실험 결과2. Experimental results
본 실험에서 각 그룹의 돼지 주사 부위는 발적, 부종, 궤양 등의 이상반응이 없었고, 동물의 정신, 운동성 및 식욕은 정상이었고, 이는 백신의 안전성이 양호함을 의미한다. 시판 돼지열병 ELISA 항체 검출 키트(BioChek, UK)를 사용하여 실험 돼지의 혈청을 분석하였다. 그 결과 면역 접종 전(9주령) 각 그룹 돼지의 항-돼지열 바이러스 항체가 모두 음성으로 나타났는데, 이는 실험 돼지가 실험 전 실제로 감염되지 않았음을 의미한다. 항-돼지열병 바이러스 항체는 본 발명의 조성물이 투여된 돼지의 면역화 3주(12주령) 후 수집된 혈청에서 상승하는 것을 볼 수 있으며; 그 중에서, E2 항원에 대한 면역 용량이 60, 30, 15㎍/dose인 그룹이 더 나은 결과를 보였다(도 7).In this experiment, there were no adverse reactions such as redness, edema, and ulcer at the injection site of pigs in each group, and the animals' mind, motility, and appetite were normal, which means that the safety of the vaccine is good. Serum from experimental pigs was analyzed using a commercially available swine fever ELISA antibody detection kit (BioChek, UK). As a result, all of the anti-swine fever virus antibodies of each group of pigs before immunization (9 weeks of age) were negative, indicating that the experimental pigs were not actually infected before the experiment. Anti-swine fever virus antibody can be seen to rise in serum collected after 3 weeks (12 weeks of age) immunization of pigs administered with the composition of the present invention; Among them, the group having an immunization dose of 60, 30, and 15 μg/dose for the E2 antigen showed better results ( FIG. 7 ).
실험 돼지의 생존율을 기록하였고(도 8), 본 발명의 조성물을 투여한 돼지는 E2 항원에 대해 특히 60, 30 및 15㎍/용량의 면역 용량을 갖는 그룹에서 생존율이 개선되었음을 나타내었다. 모든 돼지는 챌린지 된 후 살아남을 수 있다. 이 실험의 결과는 7.5 및 3.75μg/용량이 돼지열병 바이러스에 대해 효과가 없다고 해석해서는 안 되는데, 이는 이 실험은 고독성 돼지열병 바이러스 균주 ALD를 사용하여 수행되었으며 면역주사를 한 번만 수행했기 때문이다. 또한, 실험에서는 여전히 개인차가 있다. 따라서, 실험 결과는 포괄적인 관점에서 해석되어야 하며, 이는 본 발명의 조성물이 모든 실험 용량에서 항 돼지열병 바이러스 효과를 나타낸다는 것을 의미한다. 상기 시험 결과에 따르면, 본 발명의 조성물은 안전성이 우수하고, 15㎍/용량 초과의 면역 용량은 1회만 투여하면 되므로 돼지에게 돼지 열병 바이러스 감염에 대한 저항 효과를 제공할 수 있음을 알 수 있다.The survival rates of experimental pigs were recorded ( FIG. 8 ), and pigs administered the composition of the present invention showed improved survival rates against the E2 antigen, particularly in the groups with immune doses of 60, 30 and 15 μg/dose. All pigs can survive after being challenged. The results of this experiment should not be interpreted that the 7.5 and 3.75 μg/dose were ineffective against swine fever virus, as this experiment was performed using the highly virulent swine fever virus strain ALD and only one immunization was performed. In addition, there are still individual differences in the experiment. Therefore, the experimental results should be interpreted in a comprehensive view, which means that the composition of the present invention exhibits anti-swine fever virus effects at all experimental doses. According to the test results, it can be seen that the composition of the present invention has excellent safety and can provide resistance to swine fever virus infection in pigs because an immune dose exceeding 15 μg/dose is administered only once.
Claims (29)
페리틴 모이어티를 포함하는 재조합 단백질an antigenic moiety having the amino acid sequence of SEQ ID NO: 01; and
Recombinant protein comprising a ferritin moiety
항원 모이어티가 SEQ ID NO: 03에 의해 암호화되는 것인 재조합 단백질.The method of claim 1,
A recombinant protein, wherein the antigenic moiety is encoded by SEQ ID NO: 03.
페리틴 모이어티는 헬리코박터 파일로리(Helicobacter pylori)로부터 유래되는 것인 재조합 단백질.The method of claim 1,
wherein the ferritin moiety is derived from Helicobacter pylori.
페리틴 모이어티는 SEQ ID NO: 02의 아미노산 서열을 갖는 것인 재조합 단백질.The method of claim 1,
and the ferritin moiety has the amino acid sequence of SEQ ID NO: 02.
페리틴 모이어티는 SEQ ID NO: 04에 의해 암호화되는 것인 재조합 단백질.5. The method of claim 4,
wherein the ferritin moiety is encoded by SEQ ID NO: 04.
항원 모이어티와 비혈액 단백질 모이어티를 연결하는 링커를 포함하고; 여기서 링커는 SEQ ID NO: 05의 아미노산 서열을 갖는 것인 재조합 단백질.The method of claim 1,
a linker linking the antigenic moiety and the non-blood protein moiety; wherein the linker has the amino acid sequence of SEQ ID NO: 05.
재조합 단백질은 SEQ ID NO: 06의 아미노산 서열을 갖는 것인 재조합 단백질.The method of claim 1,
The recombinant protein has the amino acid sequence of SEQ ID NO: 06.
재조합 단백질은 SEQ ID NO: 07에 의해 암호화되는 것인 재조합 단백질.The method of claim 1,
The recombinant protein is encoded by SEQ ID NO: 07.
재조합 단백질의 농도는 조성물 총 부피를 기준으로 1 내지 60㎍/mL인 것인 조성물.10. The method of claim 9,
The composition of claim 1, wherein the concentration of the recombinant protein is 1 to 60 μg/mL based on the total volume of the composition.
재조합 단백질의 농도는 조성물 총 부피를 기준으로 7.5 내지 30㎍/mL인 조성물.11. The method of claim 10,
A composition wherein the concentration of the recombinant protein is 7.5 to 30 μg/mL based on the total volume of the composition.
재조합 단백질의 농도는 조성물 총 부피를 기준으로 7.5 내지 15㎍/mL인 조성물.11. The method of claim 10,
A composition wherein the concentration of the recombinant protein is 7.5 to 15 μg/mL based on the total volume of the composition.
보조제를 추가로 포함하는 것인 조성물.10. The method of claim 9,
The composition further comprising an adjuvant.
보조제는 프로인트 완전 보조제, 프로인트 불완전 보조제, 알루미늄, 계면활성제, 음이온성 폴리머, 펩타이드, 오일 에멀젼 또는 이들의 조합을 포함하는 것인 조성물.14. The method of claim 13,
wherein the adjuvant comprises Freund's complete adjuvant, Freund's incomplete adjuvant, aluminum, surfactant, anionic polymer, peptide, oil emulsion, or a combination thereof.
약학적으로 허용 가능한 담체는 물, 인산염 완충 식염수, 알코올, 글리세린, 키틴, 알기네이트, 콘드로이틴, 비타민 E, 미네랄, 또는 이들의 조합인 조성물.10. The method of claim 9,
The pharmaceutically acceptable carrier is water, phosphate buffered saline, alcohol, glycerin, chitin, alginate, chondroitin, vitamin E, a mineral, or a combination thereof.
발현 요소에 작동 가능하게 연결된 제 1 폴리뉴클레오타이드 및 제 2 폴리뉴클레오타이드를 포함하며; 여기서 제 1 폴리뉴클레오티드는 SEQ ID NO: 01로 암호화되고, 제 2 폴리뉴클레오티드는 페리틴으로 암호화되는 것인 발현 카세트.expression elements including promoters; and
a first polynucleotide and a second polynucleotide operably linked to an expression element; wherein the first polynucleotide is encoded by SEQ ID NO: 01 and the second polynucleotide is encoded by ferritin.
제 2 폴리뉴클레오타이드는 SEQ ID NO: 02로서 암호화되는 것인 발현 카세트.17. The method of claim 16,
wherein the second polynucleotide is encoded as SEQ ID NO: 02.
제 1 폴리뉴클레오타이드는 SEQ ID NO: 03이고, 제 2 폴리뉴클레오타이드는 SEQ ID NO: 04인 발현 카세트.17. The method of claim 16,
wherein the first polynucleotide is SEQ ID NO: 03 and the second polynucleotide is SEQ ID NO: 04.
발현 카세트는 제 1 항 내지 제 8 항 중 어느 한 항의 재조합 단백질을 발현하는 것인 발현 카세트.17. The method of claim 16,
The expression cassette expresses the recombinant protein of any one of claims 1 to 8.
재조합 단백질은 SEQ ID NO: 06의 아미노산 서열을 갖는 것인 발현 카세트.20. The method of claim 19,
wherein the recombinant protein has the amino acid sequence of SEQ ID NO: 06.
발현 카세트는 SEQ ID NO: 08인 발현 카세트.17. The method of claim 16,
The expression cassette is SEQ ID NO: 08.
발현 벡터는 포유동물 세포 발현 시스템에서 사용되는 것인 발현 벡터.23. The method of claim 22,
The expression vector is an expression vector for use in mammalian cell expression systems.
제 22 항 또는 제 23 항의 발현 벡터를 갖는 것인 포유동물 세포.25. The method of claim 24,
24. A mammalian cell having the expression vector of claim 22 or 23.
차이니즈 햄스터 난소 세포인 포유동물 세포.25. The method of claim 24,
Mammalian cells that are Chinese hamster ovary cells.
숙주 세포는 제 24 항 내지 제 26 항 중 어느 한 항의 포유동물 세포인 방법.28. The method of claim 27,
27. The method of any one of claims 24-26, wherein the host cell is a mammalian cell.
발현 카세트를 발현시킨 후 재조합 단백질을 정제하는 과정을 추가로 포함하는 것인 방법.28. The method of claim 27,
The method further comprising the step of purifying the recombinant protein after expressing the expression cassette.
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| PCT/CN2019/084194 WO2020215266A1 (en) | 2019-04-25 | 2019-04-25 | Recombinant protein for preventing swine fever virus infection and composition and cell containing the same |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| KR20210149121A true KR20210149121A (en) | 2021-12-08 |
Family
ID=72941248
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| KR1020217035663A KR20210149121A (en) | 2019-04-25 | 2019-04-25 | Recombinant protein for preventing swine fever virus infection and composition and cell containing same |
Country Status (4)
| Country | Link |
|---|---|
| JP (1) | JP7391997B2 (en) |
| KR (1) | KR20210149121A (en) |
| CN (1) | CN113728011A (en) |
| WO (1) | WO2020215266A1 (en) |
Family Cites Families (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US7097841B2 (en) * | 2002-05-10 | 2006-08-29 | New Century Pharmaceuticals, Inc. | Ferritin fusion proteins for use in vaccines and other applications |
| CU23544A1 (en) * | 2006-02-28 | 2010-06-17 | Ct Ingenieria Genetica Biotech | CHEMICAL VACCINAL ANTIGENS AGAINST THE CLASSICAL SWINE VIRUS VIRUS |
| CN106755087B (en) * | 2016-09-09 | 2019-02-26 | 北京博尔柯生物科技有限公司 | Stablize the expression recombinant cell lines of CSFV E 2 protein, preparation method, using and swine fever virus subunit vaccine |
-
2019
- 2019-04-25 JP JP2021562905A patent/JP7391997B2/en active Active
- 2019-04-25 WO PCT/CN2019/084194 patent/WO2020215266A1/en active Application Filing
- 2019-04-25 CN CN201980095762.5A patent/CN113728011A/en active Pending
- 2019-04-25 KR KR1020217035663A patent/KR20210149121A/en unknown
Also Published As
| Publication number | Publication date |
|---|---|
| JP7391997B2 (en) | 2023-12-05 |
| CN113728011A (en) | 2021-11-30 |
| JP2022531560A (en) | 2022-07-07 |
| WO2020215266A1 (en) | 2020-10-29 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12005115B2 (en) | Epstein-barr virus vaccines | |
| US20080248068A1 (en) | Use of Flagellin as an Adjuvant for Vaccine | |
| CN109843323B (en) | Compositions and methods for flavivirus vaccination | |
| CN112472801A (en) | DNA vaccine and subunit vaccine of African swine fever p30, p54, p72 and B602L, and preparation method and application thereof | |
| CN115246874A (en) | Recombinant novel coronavirus S-RBD trimer protein, preparation method and application thereof | |
| WO2018201017A1 (en) | Dendritic cell targeted adenovirus for vaccination | |
| WO2022071513A1 (en) | IMPROVED DNA VACCINE FOR SARS-CoV-2 | |
| KR20190119391A (en) | WHOLE PROTEIN GENE OF MERS-CoV NUCLEOPROTEIN AND VACCINE COMPOSITION FOR PREVENTING INFECTION OF MERS-CoV COMPRISING THE SAME | |
| Duan et al. | SjHSP70, a recombinant Schistosoma japonicum heat shock protein 70, is immunostimulatory and induces protective immunity against cercarial challenge in mice | |
| US9701724B2 (en) | Vaccine for preventing porcine edema disease | |
| Toledo et al. | Highly protective E2–CSFV vaccine candidate produced in the mammary gland of adenoviral transduced goats | |
| JPH06502069A (en) | Vaccinia vector, vaccinia gene and its expression product | |
| Kebriaei et al. | Construction and immunogenicity of a new Fc-based subunit vaccine candidate against Mycobacterium tuberculosis | |
| Yenkoidiok-Douti et al. | In vivo characterization of Plasmodium berghei P47 (Pbs47) as a malaria transmission-blocking vaccine target | |
| CN108503696B (en) | Zika virus subunit vaccine expressed by yeast cells | |
| Bernardes et al. | Sm16, a Schistosoma mansoni immunomodulatory protein, fails to elicit a protective immune response and does not have an essential role in parasite survival in the definitive host | |
| KR20210149121A (en) | Recombinant protein for preventing swine fever virus infection and composition and cell containing same | |
| TWI776048B (en) | Recombinant protein for preventing swine fever virus infection and composition and cell comprising the same. | |
| CN114717205A (en) | Coronavirus RBDdm variant and application thereof | |
| Zhang et al. | SjTat-TPI facilitates adaptive T-cell responses and reduces hepatic pathology during Schistosoma japonicum infection in BALB/c mice | |
| KR101667987B1 (en) | A expression vector system comprising a codon-optimized vaccinia virus tL1 polynucleotide, a transgenic cell transformed with the vector, and a preparation method of tL1 protein using the same | |
| KR101526886B1 (en) | Recombinant Protein Comprising Epitope of Fowl Adenovirus fiber 2 Protein and Antibody thereto | |
| Solanki et al. | Isolation and Characterization of OMPs and OMVs of Brucella abortus S19 and Brucella abortus S19 per | |
| JP2008500802A5 (en) | ||
| CN114230671B (en) | Zika virus recombinant protein vaccine and preparation method thereof |