CN114230671B - Zika virus recombinant protein vaccine and preparation method thereof - Google Patents
Zika virus recombinant protein vaccine and preparation method thereof Download PDFInfo
- Publication number
- CN114230671B CN114230671B CN202111374523.9A CN202111374523A CN114230671B CN 114230671 B CN114230671 B CN 114230671B CN 202111374523 A CN202111374523 A CN 202111374523A CN 114230671 B CN114230671 B CN 114230671B
- Authority
- CN
- China
- Prior art keywords
- zika virus
- recombinant protein
- zediii
- rhf
- protein
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Active
Links
- 241000907316 Zika virus Species 0.000 title claims abstract description 66
- 238000002360 preparation method Methods 0.000 title claims abstract description 21
- 229940126583 recombinant protein vaccine Drugs 0.000 title claims abstract description 15
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 claims abstract description 53
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 claims abstract description 53
- 239000002105 nanoparticle Substances 0.000 claims abstract description 34
- 108050000784 Ferritin Proteins 0.000 claims abstract description 27
- 108090000623 proteins and genes Proteins 0.000 claims abstract description 27
- 102000008857 Ferritin Human genes 0.000 claims abstract description 26
- 238000008416 Ferritin Methods 0.000 claims abstract description 25
- 125000003275 alpha amino acid group Chemical group 0.000 claims abstract 2
- 101710204837 Envelope small membrane protein Proteins 0.000 claims description 17
- 101710145006 Lysis protein Proteins 0.000 claims description 17
- 102000004169 proteins and genes Human genes 0.000 claims description 17
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 14
- 238000000034 method Methods 0.000 claims description 11
- 241000588724 Escherichia coli Species 0.000 claims description 10
- 239000013604 expression vector Substances 0.000 claims description 8
- 239000013612 plasmid Substances 0.000 claims description 7
- PXHVJJICTQNCMI-UHFFFAOYSA-N Nickel Chemical compound [Ni] PXHVJJICTQNCMI-UHFFFAOYSA-N 0.000 claims description 6
- 239000013613 expression plasmid Substances 0.000 claims description 6
- 239000002773 nucleotide Substances 0.000 claims description 6
- 125000003729 nucleotide group Chemical group 0.000 claims description 6
- 230000002441 reversible effect Effects 0.000 claims description 6
- 238000000746 purification Methods 0.000 claims description 5
- 230000009465 prokaryotic expression Effects 0.000 claims description 4
- 238000010276 construction Methods 0.000 claims description 3
- 239000002808 molecular sieve Substances 0.000 claims description 3
- 229910052759 nickel Inorganic materials 0.000 claims description 3
- URGAHOPLAPQHLN-UHFFFAOYSA-N sodium aluminosilicate Chemical compound [Na+].[Al+3].[O-][Si]([O-])=O.[O-][Si]([O-])=O URGAHOPLAPQHLN-UHFFFAOYSA-N 0.000 claims description 3
- 229940001442 combination vaccine Drugs 0.000 claims 1
- 241000699670 Mus sp. Species 0.000 abstract description 33
- 229960005486 vaccine Drugs 0.000 abstract description 27
- 241000700605 Viruses Species 0.000 abstract description 24
- 238000011161 development Methods 0.000 abstract description 4
- 230000007969 cellular immunity Effects 0.000 abstract description 3
- 231100000636 lethal dose Toxicity 0.000 abstract description 3
- 230000004727 humoral immunity Effects 0.000 abstract description 2
- 238000011031 large-scale manufacturing process Methods 0.000 abstract description 2
- 101710091045 Envelope protein Proteins 0.000 abstract 1
- 101710188315 Protein X Proteins 0.000 abstract 1
- 102100021696 Syncytin-1 Human genes 0.000 abstract 1
- 238000012360 testing method Methods 0.000 description 17
- 210000004698 lymphocyte Anatomy 0.000 description 16
- 210000000952 spleen Anatomy 0.000 description 15
- 210000001744 T-lymphocyte Anatomy 0.000 description 13
- 239000000427 antigen Substances 0.000 description 11
- 102000036639 antigens Human genes 0.000 description 11
- 108091007433 antigens Proteins 0.000 description 11
- 238000001514 detection method Methods 0.000 description 9
- 210000004027 cell Anatomy 0.000 description 8
- 230000014509 gene expression Effects 0.000 description 8
- 230000003053 immunization Effects 0.000 description 8
- 208000020329 Zika virus infectious disease Diseases 0.000 description 7
- 238000002649 immunization Methods 0.000 description 7
- 208000015181 infectious disease Diseases 0.000 description 7
- 210000001519 tissue Anatomy 0.000 description 7
- 102100037850 Interferon gamma Human genes 0.000 description 6
- 239000002671 adjuvant Substances 0.000 description 6
- 108010074328 Interferon-gamma Proteins 0.000 description 5
- 230000001900 immune effect Effects 0.000 description 5
- 230000001939 inductive effect Effects 0.000 description 5
- 241000699666 Mus <mouse, genus> Species 0.000 description 4
- 241001052560 Thallis Species 0.000 description 4
- 150000001413 amino acids Chemical group 0.000 description 4
- 230000002238 attenuated effect Effects 0.000 description 4
- 210000003719 b-lymphocyte Anatomy 0.000 description 4
- 239000002091 nanocage Substances 0.000 description 4
- 230000003472 neutralizing effect Effects 0.000 description 4
- 239000000047 product Substances 0.000 description 4
- 238000001338 self-assembly Methods 0.000 description 4
- 210000002966 serum Anatomy 0.000 description 4
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 4
- 239000000243 solution Substances 0.000 description 4
- 230000009870 specific binding Effects 0.000 description 4
- 238000001262 western blot Methods 0.000 description 4
- YBAFDPFAUTYYRW-UHFFFAOYSA-N N-L-alpha-glutamyl-L-leucine Natural products CC(C)CC(C(O)=O)NC(=O)C(N)CCC(O)=O YBAFDPFAUTYYRW-UHFFFAOYSA-N 0.000 description 3
- 238000011529 RT qPCR Methods 0.000 description 3
- 229940124743 Zika virus vaccine Drugs 0.000 description 3
- 230000003321 amplification Effects 0.000 description 3
- 230000008859 change Effects 0.000 description 3
- 238000012512 characterization method Methods 0.000 description 3
- 238000006243 chemical reaction Methods 0.000 description 3
- 230000001419 dependent effect Effects 0.000 description 3
- 230000002349 favourable effect Effects 0.000 description 3
- 230000005847 immunogenicity Effects 0.000 description 3
- 238000003199 nucleic acid amplification method Methods 0.000 description 3
- 229920001184 polypeptide Polymers 0.000 description 3
- 230000008569 process Effects 0.000 description 3
- 102000004196 processed proteins & peptides Human genes 0.000 description 3
- 238000011160 research Methods 0.000 description 3
- 230000003248 secreting effect Effects 0.000 description 3
- 230000004083 survival effect Effects 0.000 description 3
- 241001678559 COVID-19 virus Species 0.000 description 2
- 102000004190 Enzymes Human genes 0.000 description 2
- 108090000790 Enzymes Proteins 0.000 description 2
- 241000710781 Flaviviridae Species 0.000 description 2
- 108090000978 Interleukin-4 Proteins 0.000 description 2
- 241001465754 Metazoa Species 0.000 description 2
- 108700001237 Nucleic Acid-Based Vaccines Proteins 0.000 description 2
- 238000012408 PCR amplification Methods 0.000 description 2
- 102000002067 Protein Subunits Human genes 0.000 description 2
- 108010001267 Protein Subunits Proteins 0.000 description 2
- 108010003533 Viral Envelope Proteins Proteins 0.000 description 2
- 208000001455 Zika Virus Infection Diseases 0.000 description 2
- 208000035332 Zika virus disease Diseases 0.000 description 2
- 108010092854 aspartyllysine Proteins 0.000 description 2
- 238000003556 assay Methods 0.000 description 2
- 230000009286 beneficial effect Effects 0.000 description 2
- 230000027455 binding Effects 0.000 description 2
- 230000005540 biological transmission Effects 0.000 description 2
- 210000004369 blood Anatomy 0.000 description 2
- 239000008280 blood Substances 0.000 description 2
- 230000037396 body weight Effects 0.000 description 2
- 230000007423 decrease Effects 0.000 description 2
- 238000010586 diagram Methods 0.000 description 2
- 229940088598 enzyme Drugs 0.000 description 2
- 102000037865 fusion proteins Human genes 0.000 description 2
- 108020001507 fusion proteins Proteins 0.000 description 2
- 108010050848 glycylleucine Proteins 0.000 description 2
- 210000002865 immune cell Anatomy 0.000 description 2
- 229940031551 inactivated vaccine Drugs 0.000 description 2
- 230000004048 modification Effects 0.000 description 2
- 238000012986 modification Methods 0.000 description 2
- 229940023146 nucleic acid vaccine Drugs 0.000 description 2
- 230000001717 pathogenic effect Effects 0.000 description 2
- 229920000642 polymer Polymers 0.000 description 2
- 238000003757 reverse transcription PCR Methods 0.000 description 2
- 238000000926 separation method Methods 0.000 description 2
- 238000003860 storage Methods 0.000 description 2
- 238000011282 treatment Methods 0.000 description 2
- 230000009385 viral infection Effects 0.000 description 2
- 238000005406 washing Methods 0.000 description 2
- FYGDTMLNYKFZSV-URKRLVJHSA-N (2s,3r,4s,5s,6r)-2-[(2r,4r,5r,6s)-4,5-dihydroxy-2-(hydroxymethyl)-6-[(2r,4r,5r,6s)-4,5,6-trihydroxy-2-(hydroxymethyl)oxan-3-yl]oxyoxan-3-yl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1OC1[C@@H](CO)O[C@@H](OC2[C@H](O[C@H](O)[C@H](O)[C@H]2O)CO)[C@H](O)[C@H]1O FYGDTMLNYKFZSV-URKRLVJHSA-N 0.000 description 1
- CRWFEKLFPVRPBV-CIUDSAMLSA-N Ala-Gln-Met Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCSC)C(O)=O CRWFEKLFPVRPBV-CIUDSAMLSA-N 0.000 description 1
- HMRWQTHUDVXMGH-GUBZILKMSA-N Ala-Glu-Lys Chemical compound C[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@H](C(O)=O)CCCCN HMRWQTHUDVXMGH-GUBZILKMSA-N 0.000 description 1
- ROLXPVQSRCPVGK-XDTLVQLUSA-N Ala-Glu-Tyr Chemical compound N[C@@H](C)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)O ROLXPVQSRCPVGK-XDTLVQLUSA-N 0.000 description 1
- OBVSBEYOMDWLRJ-BFHQHQDPSA-N Ala-Gly-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)CNC(=O)[C@H](C)N OBVSBEYOMDWLRJ-BFHQHQDPSA-N 0.000 description 1
- IFKQPMZRDQZSHI-GHCJXIJMSA-N Ala-Ile-Asn Chemical compound [H]N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(N)=O)C(O)=O IFKQPMZRDQZSHI-GHCJXIJMSA-N 0.000 description 1
- AWZKCUCQJNTBAD-SRVKXCTJSA-N Ala-Leu-Lys Chemical compound C[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(O)=O)CCCCN AWZKCUCQJNTBAD-SRVKXCTJSA-N 0.000 description 1
- CYBJZLQSUJEMAS-LFSVMHDDSA-N Ala-Phe-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](CC1=CC=CC=C1)NC(=O)[C@H](C)N)O CYBJZLQSUJEMAS-LFSVMHDDSA-N 0.000 description 1
- YNOCMHZSWJMGBB-GCJQMDKQSA-N Ala-Thr-Asp Chemical compound [H]N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(O)=O YNOCMHZSWJMGBB-GCJQMDKQSA-N 0.000 description 1
- BVLPIIBTWIYOML-ZKWXMUAHSA-N Ala-Val-Asp Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(O)=O)C(O)=O BVLPIIBTWIYOML-ZKWXMUAHSA-N 0.000 description 1
- 206010002198 Anaphylactic reaction Diseases 0.000 description 1
- SNBHMYQRNCJSOJ-CIUDSAMLSA-N Arg-Gln-Asn Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(N)=O)C(O)=O SNBHMYQRNCJSOJ-CIUDSAMLSA-N 0.000 description 1
- JCAISGGAOQXEHJ-ZPFDUUQYSA-N Arg-Gln-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H](CCC(=O)N)NC(=O)[C@H](CCCN=C(N)N)N JCAISGGAOQXEHJ-ZPFDUUQYSA-N 0.000 description 1
- QAXCZGMLVICQKS-SRVKXCTJSA-N Arg-Glu-His Chemical compound C1=C(NC=N1)C[C@@H](C(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCCN=C(N)N)N QAXCZGMLVICQKS-SRVKXCTJSA-N 0.000 description 1
- CYXCAHZVPFREJD-LURJTMIESA-N Arg-Gly-Gly Chemical compound NC(=N)NCCC[C@H](N)C(=O)NCC(=O)NCC(O)=O CYXCAHZVPFREJD-LURJTMIESA-N 0.000 description 1
- OFIYLHVAAJYRBC-HJWJTTGWSA-N Arg-Ile-Phe Chemical compound CC[C@H](C)[C@H](NC(=O)[C@@H](N)CCCNC(N)=N)C(=O)N[C@@H](Cc1ccccc1)C(O)=O OFIYLHVAAJYRBC-HJWJTTGWSA-N 0.000 description 1
- UZGFHWIJWPUPOH-IHRRRGAJSA-N Arg-Leu-Lys Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CCCN=C(N)N)N UZGFHWIJWPUPOH-IHRRRGAJSA-N 0.000 description 1
- MTYLORHAQXVQOW-AVGNSLFASA-N Arg-Lys-Met Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCSC)C(O)=O MTYLORHAQXVQOW-AVGNSLFASA-N 0.000 description 1
- ORXCYAFUCSTQGY-FXQIFTODSA-N Asn-Ala-Met Chemical compound C[C@@H](C(=O)N[C@@H](CCSC)C(=O)O)NC(=O)[C@H](CC(=O)N)N ORXCYAFUCSTQGY-FXQIFTODSA-N 0.000 description 1
- KUYKVGODHGHFDI-ACZMJKKPSA-N Asn-Gln-Ser Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CO)C(O)=O KUYKVGODHGHFDI-ACZMJKKPSA-N 0.000 description 1
- HDHZCEDPLTVHFZ-GUBZILKMSA-N Asn-Leu-Glu Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(O)=O HDHZCEDPLTVHFZ-GUBZILKMSA-N 0.000 description 1
- CDGHMJJJHYKMPA-DLOVCJGASA-N Asn-Phe-Ala Chemical compound C[C@@H](C(=O)O)NC(=O)[C@H](CC1=CC=CC=C1)NC(=O)[C@H](CC(=O)N)N CDGHMJJJHYKMPA-DLOVCJGASA-N 0.000 description 1
- VHQSGALUSWIYOD-QXEWZRGKSA-N Asn-Pro-Val Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C(C)C)C(O)=O VHQSGALUSWIYOD-QXEWZRGKSA-N 0.000 description 1
- UGXYFDQFLVCDFC-CIUDSAMLSA-N Asn-Ser-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC(N)=O UGXYFDQFLVCDFC-CIUDSAMLSA-N 0.000 description 1
- PXLNPFOJZQMXAT-BYULHYEWSA-N Asp-Asp-Val Chemical compound CC(C)[C@@H](C(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](N)CC(O)=O PXLNPFOJZQMXAT-BYULHYEWSA-N 0.000 description 1
- MJKBOVWWADWLHV-ZLUOBGJFSA-N Asp-Cys-Asp Chemical compound C([C@@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CC(=O)O)C(=O)O)N)C(=O)O MJKBOVWWADWLHV-ZLUOBGJFSA-N 0.000 description 1
- POTCZYQVVNXUIG-BQBZGAKWSA-N Asp-Gly-Pro Chemical compound OC(=O)C[C@H](N)C(=O)NCC(=O)N1CCC[C@H]1C(O)=O POTCZYQVVNXUIG-BQBZGAKWSA-N 0.000 description 1
- YRBGRUOSJROZEI-NHCYSSNCSA-N Asp-His-Val Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](C(C)C)C(O)=O YRBGRUOSJROZEI-NHCYSSNCSA-N 0.000 description 1
- BRRPVTUFESPTCP-ACZMJKKPSA-N Asp-Ser-Glu Chemical compound OC(=O)C[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CCC(O)=O BRRPVTUFESPTCP-ACZMJKKPSA-N 0.000 description 1
- XYPJXLLXNSAWHZ-SRVKXCTJSA-N Asp-Ser-Tyr Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O XYPJXLLXNSAWHZ-SRVKXCTJSA-N 0.000 description 1
- MRYDJCIIVRXVGG-QEJZJMRPSA-N Asp-Trp-Glu Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CCC(O)=O)C(O)=O MRYDJCIIVRXVGG-QEJZJMRPSA-N 0.000 description 1
- 108090001008 Avidin Proteins 0.000 description 1
- 238000009020 BCA Protein Assay Kit Methods 0.000 description 1
- 229920002498 Beta-glucan Polymers 0.000 description 1
- 210000001266 CD8-positive T-lymphocyte Anatomy 0.000 description 1
- 108090000565 Capsid Proteins Proteins 0.000 description 1
- 102100023321 Ceruloplasmin Human genes 0.000 description 1
- 206010010356 Congenital anomaly Diseases 0.000 description 1
- NOCCABSVTRONIN-CIUDSAMLSA-N Cys-Ala-Leu Chemical compound C[C@@H](C(=O)N[C@@H](CC(C)C)C(=O)O)NC(=O)[C@H](CS)N NOCCABSVTRONIN-CIUDSAMLSA-N 0.000 description 1
- IIGHQOPGMGKDMT-SRVKXCTJSA-N Cys-Asp-Phe Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CS)N IIGHQOPGMGKDMT-SRVKXCTJSA-N 0.000 description 1
- ZXCAQANTQWBICD-DCAQKATOSA-N Cys-Lys-Val Chemical compound CC(C)[C@@H](C(=O)O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CS)N ZXCAQANTQWBICD-DCAQKATOSA-N 0.000 description 1
- NRVQLLDIJJEIIZ-VZFHVOOUSA-N Cys-Thr-Ala Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](C)C(=O)O)NC(=O)[C@H](CS)N)O NRVQLLDIJJEIIZ-VZFHVOOUSA-N 0.000 description 1
- 108090000695 Cytokines Proteins 0.000 description 1
- 102000004127 Cytokines Human genes 0.000 description 1
- 241000255925 Diptera Species 0.000 description 1
- 208000035240 Disease Resistance Diseases 0.000 description 1
- 238000002965 ELISA Methods 0.000 description 1
- 101800001632 Envelope protein E Proteins 0.000 description 1
- 206010015548 Euthanasia Diseases 0.000 description 1
- TWHDOEYLXXQYOZ-FXQIFTODSA-N Gln-Asn-Gln Chemical compound C(CC(=O)N)[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CCC(=O)N)C(=O)O)N TWHDOEYLXXQYOZ-FXQIFTODSA-N 0.000 description 1
- HTTSBEBKVNEDFE-AUTRQRHGSA-N Glu-Gln-Val Chemical compound CC(C)[C@@H](C(=O)O)NC(=O)[C@H](CCC(=O)N)NC(=O)[C@H](CCC(=O)O)N HTTSBEBKVNEDFE-AUTRQRHGSA-N 0.000 description 1
- DCBSZJJHOTXMHY-DCAQKATOSA-N Glu-Pro-Pro Chemical compound OC(=O)CC[C@H](N)C(=O)N1CCC[C@H]1C(=O)N1[C@H](C(O)=O)CCC1 DCBSZJJHOTXMHY-DCAQKATOSA-N 0.000 description 1
- RFTVTKBHDXCEEX-WDSKDSINSA-N Glu-Ser-Gly Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(=O)NCC(O)=O RFTVTKBHDXCEEX-WDSKDSINSA-N 0.000 description 1
- DDXZHOHEABQXSE-NKIYYHGXSA-N Glu-Thr-His Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)NC(=O)[C@H](CCC(=O)O)N)O DDXZHOHEABQXSE-NKIYYHGXSA-N 0.000 description 1
- YQAQQKPWFOBSMU-WDCWCFNPSA-N Glu-Thr-Leu Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(O)=O YQAQQKPWFOBSMU-WDCWCFNPSA-N 0.000 description 1
- QXPRJQPCFXMCIY-NKWVEPMBSA-N Gly-Ala-Pro Chemical compound C[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)CN QXPRJQPCFXMCIY-NKWVEPMBSA-N 0.000 description 1
- SBVMXEZQJVUARN-XPUUQOCRSA-N Gly-Val-Ser Chemical compound NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CO)C(O)=O SBVMXEZQJVUARN-XPUUQOCRSA-N 0.000 description 1
- 206010061199 Head deformity Diseases 0.000 description 1
- DVHGLDYMGWTYKW-GUBZILKMSA-N His-Gln-Ser Chemical compound [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CO)C(O)=O DVHGLDYMGWTYKW-GUBZILKMSA-N 0.000 description 1
- TXLQHACKRLWYCM-DCAQKATOSA-N His-Glu-Glu Chemical compound [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O TXLQHACKRLWYCM-DCAQKATOSA-N 0.000 description 1
- BDFCIKANUNMFGB-PMVVWTBXSA-N His-Gly-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)CNC(=O)[C@@H](N)CC1=CN=CN1 BDFCIKANUNMFGB-PMVVWTBXSA-N 0.000 description 1
- OQDLKDUVMTUPPG-AVGNSLFASA-N His-Leu-Glu Chemical compound [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(O)=O OQDLKDUVMTUPPG-AVGNSLFASA-N 0.000 description 1
- UXSATKFPUVZVDK-KKUMJFAQSA-N His-Lys-Leu Chemical compound CC(C)C[C@@H](C(=O)O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC1=CN=CN1)N UXSATKFPUVZVDK-KKUMJFAQSA-N 0.000 description 1
- XLXPYSDGMXTTNQ-UHFFFAOYSA-N Ile-Phe-Leu Natural products CCC(C)C(N)C(=O)NC(C(=O)NC(CC(C)C)C(O)=O)CC1=CC=CC=C1 XLXPYSDGMXTTNQ-UHFFFAOYSA-N 0.000 description 1
- IITVUURPOYGCTD-NAKRPEOUSA-N Ile-Pro-Ala Chemical compound CC[C@H](C)[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C)C(O)=O IITVUURPOYGCTD-NAKRPEOUSA-N 0.000 description 1
- CNMOKANDJMLAIF-CIQUZCHMSA-N Ile-Thr-Ala Chemical compound CC[C@H](C)[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C)C(O)=O CNMOKANDJMLAIF-CIQUZCHMSA-N 0.000 description 1
- COWHUQXTSYTKQC-RWRJDSDZSA-N Ile-Thr-Glu Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(=O)O)C(=O)O)N COWHUQXTSYTKQC-RWRJDSDZSA-N 0.000 description 1
- DLEBSGAVWRPTIX-PEDHHIEDSA-N Ile-Val-Ile Chemical compound CC[C@H](C)[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@H](C(O)=O)[C@@H](C)CC DLEBSGAVWRPTIX-PEDHHIEDSA-N 0.000 description 1
- 108010063738 Interleukins Proteins 0.000 description 1
- 102000015696 Interleukins Human genes 0.000 description 1
- MMEDVBWCMGRKKC-GARJFASQSA-N Leu-Asp-Pro Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)N1CCC[C@@H]1C(=O)O)N MMEDVBWCMGRKKC-GARJFASQSA-N 0.000 description 1
- ZYLJULGXQDNXDK-GUBZILKMSA-N Leu-Gln-Asp Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(O)=O ZYLJULGXQDNXDK-GUBZILKMSA-N 0.000 description 1
- LAPSXOAUPNOINL-YUMQZZPRSA-N Leu-Gly-Asp Chemical compound CC(C)C[C@H](N)C(=O)NCC(=O)N[C@H](C(O)=O)CC(O)=O LAPSXOAUPNOINL-YUMQZZPRSA-N 0.000 description 1
- QNBVTHNJGCOVFA-AVGNSLFASA-N Leu-Leu-Glu Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(O)=O)CCC(O)=O QNBVTHNJGCOVFA-AVGNSLFASA-N 0.000 description 1
- ZAVCJRJOQKIOJW-KKUMJFAQSA-N Leu-Phe-Asp Chemical compound CC(C)C[C@H](N)C(=O)N[C@H](C(=O)N[C@@H](CC(O)=O)C(O)=O)CC1=CC=CC=C1 ZAVCJRJOQKIOJW-KKUMJFAQSA-N 0.000 description 1
- KLSUAWUZBMAZCL-RHYQMDGZSA-N Leu-Thr-Pro Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N1CCC[C@H]1C(O)=O KLSUAWUZBMAZCL-RHYQMDGZSA-N 0.000 description 1
- RIHIGSWBLHSGLV-CQDKDKBSSA-N Leu-Tyr-Ala Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](C)C(O)=O RIHIGSWBLHSGLV-CQDKDKBSSA-N 0.000 description 1
- NFLFJGGKOHYZJF-BJDJZHNGSA-N Lys-Ala-Ile Chemical compound CC[C@H](C)[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CCCCN NFLFJGGKOHYZJF-BJDJZHNGSA-N 0.000 description 1
- BYPMOIFBQPEWOH-CIUDSAMLSA-N Lys-Asn-Asp Chemical compound C(CCN)C[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CC(=O)O)C(=O)O)N BYPMOIFBQPEWOH-CIUDSAMLSA-N 0.000 description 1
- LZWNAOIMTLNMDW-NHCYSSNCSA-N Lys-Asn-Val Chemical compound CC(C)[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)N)NC(=O)[C@H](CCCCN)N LZWNAOIMTLNMDW-NHCYSSNCSA-N 0.000 description 1
- DCRWPTBMWMGADO-AVGNSLFASA-N Lys-Glu-Leu Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(O)=O DCRWPTBMWMGADO-AVGNSLFASA-N 0.000 description 1
- HQXSFFSLXFHWOX-IXOXFDKPSA-N Lys-His-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](CC1=CN=CN1)NC(=O)[C@H](CCCCN)N)O HQXSFFSLXFHWOX-IXOXFDKPSA-N 0.000 description 1
- GAHJXEMYXKLZRQ-AJNGGQMLSA-N Lys-Lys-Ile Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O GAHJXEMYXKLZRQ-AJNGGQMLSA-N 0.000 description 1
- YXPJCVNIDDKGOE-MELADBBJSA-N Lys-Lys-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)N)C(=O)O YXPJCVNIDDKGOE-MELADBBJSA-N 0.000 description 1
- 101710085938 Matrix protein Proteins 0.000 description 1
- 101710127721 Membrane protein Proteins 0.000 description 1
- WGBMNLCRYKSWAR-DCAQKATOSA-N Met-Asp-Lys Chemical compound CSCC[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@H](C(O)=O)CCCCN WGBMNLCRYKSWAR-DCAQKATOSA-N 0.000 description 1
- HHCOOFPGNXKFGR-HJGDQZAQSA-N Met-Gln-Thr Chemical compound [H]N[C@@H](CCSC)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O HHCOOFPGNXKFGR-HJGDQZAQSA-N 0.000 description 1
- HGAJNEWOUHDUMZ-SRVKXCTJSA-N Met-Leu-Glu Chemical compound CSCC[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(O)=O)CCC(O)=O HGAJNEWOUHDUMZ-SRVKXCTJSA-N 0.000 description 1
- HSJIGJRZYUADSS-IHRRRGAJSA-N Met-Lys-Leu Chemical compound [H]N[C@@H](CCSC)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(O)=O HSJIGJRZYUADSS-IHRRRGAJSA-N 0.000 description 1
- 101001044384 Mus musculus Interferon gamma Proteins 0.000 description 1
- 101001002703 Mus musculus Interleukin-4 Proteins 0.000 description 1
- SITLTJHOQZFJGG-UHFFFAOYSA-N N-L-alpha-glutamyl-L-valine Natural products CC(C)C(C(O)=O)NC(=O)C(N)CCC(O)=O SITLTJHOQZFJGG-UHFFFAOYSA-N 0.000 description 1
- 101800001030 Non-structural protein 2A Proteins 0.000 description 1
- 101800001020 Non-structural protein 4A Proteins 0.000 description 1
- 101800001019 Non-structural protein 4B Proteins 0.000 description 1
- XMPUYNHKEPFERE-IHRRRGAJSA-N Phe-Asp-Arg Chemical compound NC(N)=NCCC[C@@H](C(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](N)CC1=CC=CC=C1 XMPUYNHKEPFERE-IHRRRGAJSA-N 0.000 description 1
- PTDAGKJHZBGDKD-OEAJRASXSA-N Phe-Thr-Lys Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CC1=CC=CC=C1)N)O PTDAGKJHZBGDKD-OEAJRASXSA-N 0.000 description 1
- STASJMBVVHNWCG-IHRRRGAJSA-N Pro-His-Leu Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)C([O-])=O)NC(=O)[C@H]1[NH2+]CCC1)C1=CN=CN1 STASJMBVVHNWCG-IHRRRGAJSA-N 0.000 description 1
- QGLFRQCECIWXFA-RCWTZXSCSA-N Pro-Met-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](CCSC)NC(=O)[C@@H]1CCCN1)O QGLFRQCECIWXFA-RCWTZXSCSA-N 0.000 description 1
- AJBQTGZIZQXBLT-STQMWFEESA-N Pro-Phe-Gly Chemical compound C([C@@H](C(=O)NCC(=O)O)NC(=O)[C@H]1NCCC1)C1=CC=CC=C1 AJBQTGZIZQXBLT-STQMWFEESA-N 0.000 description 1
- RFWXYTJSVDUBBZ-DCAQKATOSA-N Pro-Pro-Glu Chemical compound OC(=O)CC[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H]1NCCC1 RFWXYTJSVDUBBZ-DCAQKATOSA-N 0.000 description 1
- SBVPYBFMIGDIDX-SRVKXCTJSA-N Pro-Pro-Pro Chemical compound OC(=O)[C@@H]1CCCN1C(=O)[C@H]1N(C(=O)[C@H]2NCCC2)CCC1 SBVPYBFMIGDIDX-SRVKXCTJSA-N 0.000 description 1
- 101800004937 Protein C Proteins 0.000 description 1
- 101800001127 Protein prM Proteins 0.000 description 1
- 238000010802 RNA extraction kit Methods 0.000 description 1
- 101800001700 Saposin-D Proteins 0.000 description 1
- 102400000827 Saposin-D Human genes 0.000 description 1
- OHKLFYXEOGGGCK-ZLUOBGJFSA-N Ser-Asp-Asn Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(N)=O)C(O)=O OHKLFYXEOGGGCK-ZLUOBGJFSA-N 0.000 description 1
- HVKMTOIAYDOJPL-NRPADANISA-N Ser-Gln-Val Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C(C)C)C(O)=O HVKMTOIAYDOJPL-NRPADANISA-N 0.000 description 1
- GZFAWAQTEYDKII-YUMQZZPRSA-N Ser-Gly-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)CNC(=O)[C@@H](N)CO GZFAWAQTEYDKII-YUMQZZPRSA-N 0.000 description 1
- UIGMAMGZOJVTDN-WHFBIAKZSA-N Ser-Gly-Ser Chemical compound OC[C@H](N)C(=O)NCC(=O)N[C@@H](CO)C(O)=O UIGMAMGZOJVTDN-WHFBIAKZSA-N 0.000 description 1
- KKKVOZNCLALMPV-XKBZYTNZSA-N Ser-Thr-Glu Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(O)=O)C(O)=O KKKVOZNCLALMPV-XKBZYTNZSA-N 0.000 description 1
- OSFZCEQJLWCIBG-BZSNNMDCSA-N Ser-Tyr-Tyr Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O OSFZCEQJLWCIBG-BZSNNMDCSA-N 0.000 description 1
- HAYADTTXNZFUDM-IHRRRGAJSA-N Ser-Tyr-Val Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](C(C)C)C(O)=O HAYADTTXNZFUDM-IHRRRGAJSA-N 0.000 description 1
- 101710172711 Structural protein Proteins 0.000 description 1
- 108010008038 Synthetic Vaccines Proteins 0.000 description 1
- 230000024932 T cell mediated immunity Effects 0.000 description 1
- 238000003917 TEM image Methods 0.000 description 1
- DWYAUVCQDTZIJI-VZFHVOOUSA-N Thr-Ala-Ser Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(O)=O DWYAUVCQDTZIJI-VZFHVOOUSA-N 0.000 description 1
- SKHPKKYKDYULDH-HJGDQZAQSA-N Thr-Asn-Leu Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(O)=O SKHPKKYKDYULDH-HJGDQZAQSA-N 0.000 description 1
- XSTGOZBBXFKGHA-YJRXYDGGSA-N Thr-His-His Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC1=CN=CN1)C(=O)N[C@@H](CC2=CN=CN2)C(=O)O)N)O XSTGOZBBXFKGHA-YJRXYDGGSA-N 0.000 description 1
- KPMIQCXJDVKWKO-IFFSRLJSSA-N Thr-Val-Glu Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(O)=O)C(O)=O KPMIQCXJDVKWKO-IFFSRLJSSA-N 0.000 description 1
- YHRCLOURJWJABF-WDSOQIARSA-N Trp-His-Arg Chemical compound C1=CC=C2C(=C1)C(=CN2)C[C@@H](C(=O)N[C@@H](CC3=CN=CN3)C(=O)N[C@@H](CCCN=C(N)N)C(=O)O)N YHRCLOURJWJABF-WDSOQIARSA-N 0.000 description 1
- YYZPVPJCOGGQPC-JYJNAYRXSA-N Tyr-His-Gln Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCC(N)=O)C(O)=O YYZPVPJCOGGQPC-JYJNAYRXSA-N 0.000 description 1
- MVFQLSPDMMFCMW-KKUMJFAQSA-N Tyr-Leu-Asn Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(O)=O MVFQLSPDMMFCMW-KKUMJFAQSA-N 0.000 description 1
- NSGZILIDHCIZAM-KKUMJFAQSA-N Tyr-Leu-Ser Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CO)C(=O)O)NC(=O)[C@H](CC1=CC=C(C=C1)O)N NSGZILIDHCIZAM-KKUMJFAQSA-N 0.000 description 1
- SCZJKZLFSSPJDP-ACRUOGEOSA-N Tyr-Phe-Leu Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC(C)C)C(O)=O SCZJKZLFSSPJDP-ACRUOGEOSA-N 0.000 description 1
- MQGGXGKQSVEQHR-KKUMJFAQSA-N Tyr-Ser-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 MQGGXGKQSVEQHR-KKUMJFAQSA-N 0.000 description 1
- AAOPYWQQBXHINJ-DZKIICNBSA-N Val-Gln-Tyr Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)O)N AAOPYWQQBXHINJ-DZKIICNBSA-N 0.000 description 1
- JTWIMNMUYLQNPI-WPRPVWTQSA-N Val-Gly-Arg Chemical compound CC(C)[C@H](N)C(=O)NCC(=O)N[C@H](C(O)=O)CCCNC(N)=N JTWIMNMUYLQNPI-WPRPVWTQSA-N 0.000 description 1
- WFENBJPLZMPVAX-XVKPBYJWSA-N Val-Gly-Glu Chemical compound CC(C)[C@H](N)C(=O)NCC(=O)N[C@H](C(O)=O)CCC(O)=O WFENBJPLZMPVAX-XVKPBYJWSA-N 0.000 description 1
- 108020000999 Viral RNA Proteins 0.000 description 1
- 239000004480 active ingredient Substances 0.000 description 1
- 108010005233 alanylglutamic acid Proteins 0.000 description 1
- 208000003455 anaphylaxis Diseases 0.000 description 1
- 238000000137 annealing Methods 0.000 description 1
- 230000005875 antibody response Effects 0.000 description 1
- 108010040443 aspartyl-aspartic acid Proteins 0.000 description 1
- 108010093581 aspartyl-proline Proteins 0.000 description 1
- 230000001363 autoimmune Effects 0.000 description 1
- 210000004556 brain Anatomy 0.000 description 1
- 239000000872 buffer Substances 0.000 description 1
- 239000007853 buffer solution Substances 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 238000007405 data analysis Methods 0.000 description 1
- 230000007547 defect Effects 0.000 description 1
- 239000008367 deionised water Substances 0.000 description 1
- 229910021641 deionized water Inorganic materials 0.000 description 1
- 238000004925 denaturation Methods 0.000 description 1
- 230000036425 denaturation Effects 0.000 description 1
- 238000000502 dialysis Methods 0.000 description 1
- 239000003814 drug Substances 0.000 description 1
- 241001493065 dsRNA viruses Species 0.000 description 1
- 230000000694 effects Effects 0.000 description 1
- 238000001962 electrophoresis Methods 0.000 description 1
- 239000002158 endotoxin Substances 0.000 description 1
- 238000001976 enzyme digestion Methods 0.000 description 1
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 1
- 230000004927 fusion Effects 0.000 description 1
- 238000010362 genome editing Methods 0.000 description 1
- 108010049041 glutamylalanine Proteins 0.000 description 1
- 108010062266 glycyl-glycyl-argininal Proteins 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 108010040030 histidinoalanine Proteins 0.000 description 1
- 230000028996 humoral immune response Effects 0.000 description 1
- 230000028993 immune response Effects 0.000 description 1
- 230000036039 immunity Effects 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 230000002779 inactivation Effects 0.000 description 1
- 210000003000 inclusion body Anatomy 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000010255 intramuscular injection Methods 0.000 description 1
- 239000007927 intramuscular injection Substances 0.000 description 1
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 1
- 210000003734 kidney Anatomy 0.000 description 1
- 210000004185 liver Anatomy 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 108010056582 methionylglutamic acid Proteins 0.000 description 1
- 108010005942 methionylglycine Proteins 0.000 description 1
- 239000002539 nanocarrier Substances 0.000 description 1
- 230000000926 neurological effect Effects 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 244000052769 pathogen Species 0.000 description 1
- 230000035515 penetration Effects 0.000 description 1
- 108010074082 phenylalanyl-alanyl-lysine Proteins 0.000 description 1
- 230000004962 physiological condition Effects 0.000 description 1
- 230000002516 postimmunization Effects 0.000 description 1
- 230000002028 premature Effects 0.000 description 1
- 238000004321 preservation Methods 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 108010077112 prolyl-proline Proteins 0.000 description 1
- 108010053725 prolylvaline Proteins 0.000 description 1
- 230000001681 protective effect Effects 0.000 description 1
- 229960000856 protein c Drugs 0.000 description 1
- 230000012743 protein tagging Effects 0.000 description 1
- 230000005180 public health Effects 0.000 description 1
- 239000002994 raw material Substances 0.000 description 1
- 229940124551 recombinant vaccine Drugs 0.000 description 1
- 238000004153 renaturation Methods 0.000 description 1
- 238000012827 research and development Methods 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 108010048818 seryl-histidine Proteins 0.000 description 1
- 108010071207 serylmethionine Proteins 0.000 description 1
- 238000001179 sorption measurement Methods 0.000 description 1
- 238000007619 statistical method Methods 0.000 description 1
- 239000006228 supernatant Substances 0.000 description 1
- 208000011580 syndromic disease Diseases 0.000 description 1
- 210000001550 testis Anatomy 0.000 description 1
- 230000001052 transient effect Effects 0.000 description 1
- 238000004627 transmission electron microscopy Methods 0.000 description 1
- 108010005834 tyrosyl-alanyl-glycine Proteins 0.000 description 1
- 108010077037 tyrosyl-tyrosyl-phenylalanine Proteins 0.000 description 1
- 108010073969 valyllysine Proteins 0.000 description 1
- 108010009962 valyltyrosine Proteins 0.000 description 1
- 239000013598 vector Substances 0.000 description 1
- 229940126580 vector vaccine Drugs 0.000 description 1
- 229940023147 viral vector vaccine Drugs 0.000 description 1
- 230000009278 visceral effect Effects 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Chemical compound O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
- 230000004580 weight loss Effects 0.000 description 1
- 239000012224 working solution Substances 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/385—Haptens or antigens, bound to carriers
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/39—Medicinal preparations containing antigens or antibodies characterised by the immunostimulating additives, e.g. chemical adjuvants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B82—NANOTECHNOLOGY
- B82Y—SPECIFIC USES OR APPLICATIONS OF NANOSTRUCTURES; MEASUREMENT OR ANALYSIS OF NANOSTRUCTURES; MANUFACTURE OR TREATMENT OF NANOSTRUCTURES
- B82Y40/00—Manufacture or treatment of nanostructures
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B82—NANOTECHNOLOGY
- B82Y—SPECIFIC USES OR APPLICATIONS OF NANOSTRUCTURES; MEASUREMENT OR ANALYSIS OF NANOSTRUCTURES; MANUFACTURE OR TREATMENT OF NANOSTRUCTURES
- B82Y5/00—Nanobiotechnology or nanomedicine, e.g. protein engineering or drug delivery
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/70—Vectors or expression systems specially adapted for E. coli
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55511—Organic adjuvants
- A61K2039/55516—Proteins; Peptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/57—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/57—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
- A61K2039/575—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2 humoral response
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/70—Multivalent vaccine
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
- C12N2770/00011—Details
- C12N2770/24011—Flaviviridae
- C12N2770/24111—Flavivirus, e.g. yellow fever virus, dengue, JEV
- C12N2770/24122—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
- C12N2770/00011—Details
- C12N2770/24011—Flaviviridae
- C12N2770/24111—Flavivirus, e.g. yellow fever virus, dengue, JEV
- C12N2770/24134—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Engineering & Computer Science (AREA)
- General Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Pharmacology & Pharmacy (AREA)
- Biophysics (AREA)
- Animal Behavior & Ethology (AREA)
- Virology (AREA)
- Veterinary Medicine (AREA)
- Microbiology (AREA)
- Public Health (AREA)
- Nanotechnology (AREA)
- Zoology (AREA)
- Biotechnology (AREA)
- General Engineering & Computer Science (AREA)
- Epidemiology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Mycology (AREA)
- Biochemistry (AREA)
- Immunology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Gastroenterology & Hepatology (AREA)
- Wood Science & Technology (AREA)
- Biomedical Technology (AREA)
- Physics & Mathematics (AREA)
- Crystallography & Structural Chemistry (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Oncology (AREA)
- Communicable Diseases (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Medical Informatics (AREA)
- Toxicology (AREA)
- Plant Pathology (AREA)
- Condensed Matter Physics & Semiconductors (AREA)
Abstract
The invention discloses a Zika virus recombinant protein vaccine and a preparation method thereof, the constructed Zika virus recombinant protein vaccine is zEDIII-rHF recombinant protein with an amino acid sequence shown as SEQ ID NO.2, and the gene sequence is shown as SEQ ID NO. 1. The third domain (zEDIII) of the envelope protein (envelop) of the Zika virus is displayed on the surface of a cage structure of recombinant human heavy chain ferritin (rHF). The zEDIII-rHF recombinant protein nanoparticle provided by the invention can induce high-strength humoral immunity and cellular immunity in mice, protect the mice from being infected by the lethal dose of Zika virus, has simple preparation process, does not involve live virus culture, has good safety and high product yield, is suitable for large-scale production, and provides a new technical means and technical strategy for the development of Zika virus vaccines.
Description
Technical Field
The invention relates to the technical field of vaccines, in particular to a recombinant protein specifically induced to Zika virus, and a coding gene, an expression vector and a preparation method thereof.
Background
Zika Virus belongs to the Flaviviridae, genus Flaviviridae, a arbovirus transmitted by mosquitoes. Reported studies indicate that zika virus infection can lead to neurological and autoimmune system complications and is associated with neonatal small head deformity.
Zika virus was first found in Uganda Zika jungle in 1947, and subsequently has been reported in Africa, american, asia and Pacific areas. In 2013 and 2015, the farnesian brinesian and brazil outbreaks, respectively, caused about 44-150 ten thousand infections in total. So far, more than 80 countries and regions worldwide have been reported with the Zika virus cases. Zika virus has become a pathogen that seriously jeopardizes human health and poses a significant threat to global public health.
At present, no effective vaccine against the Zika virus exists, and no specific medicine can prevent and treat the Zika virus infection. The research and development of Zika virus vaccine is mainly in preclinical and clinical experimental research stage. The Zhai Ka virus candidate vaccine types mainly comprise full-inactivated vaccine, attenuated live vaccine, nucleic acid vaccine and virus vector vaccine, and the organism is protected from Zhai Ka virus infection mainly by inducing the organism to generate Zhai Ka virus specific neutralizing antibodies.
However, the existing Zika virus candidate vaccine still has a plurality of defects, such as the need of large-scale culture of highly pathogenic viruses in the preparation process of inactivated vaccines and attenuated live vaccines, high preparation environment requirements and potential infection risks; attenuated live vaccines cause transient hypoviremia, and it is reported in the literature that congenital village-card syndrome is thought to occur even in asymptomatic infected pregnant women with hypoviremia, so the safety of attenuated live vaccines needs to be carefully assessed before they can be used in women of childbearing age; the nucleic acid vaccine and the viral vector vaccine have complicated preparation process and high technological requirements, and have strict requirements on transportation and storage conditions of products. If the Zhai Ka virus epidemic outbreaks are encountered, it is difficult to timely produce sufficient vaccine to cope with epidemic spread.
In addition, patent document CN111514286a discloses a "zhai ka virus E protein combined vaccine and a preparation method thereof", which adopts the technical route that beta-glucan and zhai ka virus E protein are covalently combined through a connecting bridge, and the treatment through chemical reaction is needed, so that the process is relatively complex.
Disclosure of Invention
The invention provides a Zika virus recombinant vaccine and a preparation method thereof, which utilize the third structural domain (zEDIII) of Zika virus envelope protein (envelop) to display on the surface of the cage structure of recombinant human heavy chain ferritin (rHF), and can effectively interact with human lymphocytes such as B cells and CD4 + T lymphocytes, CD8 + The rHF specific binding site on the surface of the T lymphocyte is identified, a virus vector or a virus inactivation mode is not utilized, the safety is good, the preparation process requirement is low, and the transportation and the preservation of recombinant proteins are convenient.
The invention provides the following technical scheme:
the invention provides a Zika virus recombinant protein vaccine, wherein the recombinant protein is the peptide of a third structural domain of Zika virus E protein and is displayed on the surface of recombinant human heavy chain ferritin.
Further, the protein is a zEDIII peptide segment of a third structural domain of a recombinant human heavy chain ferritin protein E protein which is connected in series at the amino terminus, and the zEDIII peptide segment of the third structural domain of the Zika virus E protein is expressed on the surface of the recombinant human heavy chain ferritin protein in a linear mode; the Zika virus recombinant protein vaccine specifically induces and generates IgG antibodies to the zEDIII antigen of the third structural domain of the Zika virus E protein.
Further, the recombinant protein self-assembles into a cage-shaped hollow protein nanoparticle structure; further, the cage-shaped hollow protein nano-particles have an outer diameter of 12nm and an inner diameter of 6-8 nm.
Further, the amino acid sequence of the protein is shown as SEQ ID NO. 2.
The nucleotide sequence of the gene for encoding the Zika virus recombinant protein vaccine is shown as SEQ ID NO. 1.
An expression vector comprising the gene encoding the recombinant protein vaccine of the Zika virus as described above.
Further, the construction method adopts a forward primer sequence shown as SEQ ID NO.3 and a reverse primer sequence shown as SEQ ID NO. 4:
SEQ ID NO.3:5'-CGCGGATCCATGGATAAACTTAGATTGAAGGG-3';
SEQ ID NO.4:5'-CCCAAGCTTTTAGCTTTCATTATCACTGTCTCC-3'。
further, the expression vector skeleton is pET28a escherichia coli expression plasmid.
The invention also provides a preparation method of the recombinant protein specifically induced to the Zika virus, which comprises the following steps:
1) Inserting a nucleotide sequence shown in SEQ ID NO.1 into an escherichia coli expression plasmid to obtain a recombinant plasmid pET28a/zEDIII-rHF;
2) Expressing the recombinant plasmid pET28a/zEDIII-rHF in an escherichia coli prokaryotic expression system to obtain the recombinant protein which is specifically induced to be directed against the Zika virus, namely the Zika virus nano vaccine containing zEDIII-rHF recombinant protein nano particles.
Furthermore, the recombinant plasmid pET28a/zEDIII-rHF in the step 2) is expressed in a prokaryotic expression system of escherichia coli, and is subjected to first purification by a nickel column and then second purification by a molecular sieve.
The invention also provides a combined vaccine containing the Zika virus recombinant protein vaccine, which comprises the preparation of the Zika virus vaccine by combining the zEDIII-rHF recombinant protein vaccine, namely the zEDIII-rHF recombinant protein nanoparticle and other adjuvants, or the preparation of the multi-linked vaccine by combining the zEDIII-rHF recombinant protein nanoparticle and other active ingredients.
The beneficial effects of the invention are as follows:
1. compared with the traditional method for preparing the vaccine by using cell amplified virus, the method for preparing the vaccine by using the escherichia coli prokaryotic system has the advantages of simple operation and low cost, is suitable for large-scale production and culture without involving live virus, has high overall operation safety and does not have potential infection risk.
2. The recombinant human heavy chain ferritin is selected as an antigen display carrier, has low self-immunogenicity and good biocompatibility, and the ferritin nanocage display mode greatly increases the display quantity of antigen epitopes, thereby being beneficial to inducing and generating strong T cell dependent antibody reaction. In addition, the ferritin has the function of an adjuvant, so that the immunogenicity of the zEDIII antigen is obviously improved, and no additional adjuvant is needed in the immunization process, thereby simplifying the vaccine preparation process and reducing the risk of anaphylactic reaction caused by the adjuvant.
3. Under physiological conditions, the zEDIII-rHF recombinant protein nanoparticle provided by the invention can induce high-strength humoral immunity and cellular immunity by immunizing mice through an intramuscular injection way, and protect the mice from being infected by lethal dose of Zika virus. The invention adopts the expression of the zEDIII peptide segment of the third structural domain of the Zika virus E protein in a linear mode and displays the zEDIII peptide segment on the surface of the recombinant human heavy chain ferritin, and can effectively interact with human lymphocytes such as B cells and CD4 + T lymphocytes, CD8 + The rHF specific binding site on the surface of the T lymphocyte is identified, self-assembled ferritin is adopted to display conservative antigen peptide, and a new technical means and a new technical strategy are provided for the development of Zika virus vaccines.
Drawings
The invention will be described in more detail hereinafter on the basis of embodiments and with reference to the accompanying drawings. Wherein:
FIG. 1 is a schematic diagram of the construction of the expression sequence of the zEDIII-rHF recombinant protein in example 1;
FIG. 2 is a schematic diagram of the assembly of zEDIII-rHF recombinant protein nanoparticles in example 1;
FIG. 3 is a SDS-PAGE electrophoresis of the purified zEDIII-rHF recombinant protein of test example 1;
FIG. 4 is a western blot identification chart of the purified zEDIII-rHF recombinant protein of test example 1;
FIG. 5 is a graph showing transmission electron microscopy characterization of zEDIII-rHF assembled nanoparticles and rHF nanoparticles of test example 1;
FIG. 6 is a graph showing the statistics of the change in the titers of the zEDIII-specific IgG antibodies in the immune serum of test example 2;
FIG. 7 is a statistical plot of the percentage of CD4+ and CD8+ T cells in spleens of mice post immunization in test example 2;
FIG. 8 is a statistical plot of the number of lymphocytes secreted by IL-4-and IFN-gamma in the spleen of mice after immunization in test example 2;
FIG. 9 is a chart showing statistics of virus titers in various tissues after infection with Zika virus (SZ-WIV 01) in test example 3;
FIG. 10 is a statistical graph showing the weight change of mice infected with Zika virus (SZ-WIV 01) in test example 4;
FIG. 11 is a statistical plot of survival of mice infected with Zika virus (SZ-WIV 01) in test example 4.
Detailed Description
The following description of the embodiments of the present invention will be made clearly and completely with reference to the accompanying drawings, in which it is apparent that the embodiments described are only some embodiments of the present invention, but not all embodiments. All other embodiments, which can be made by those skilled in the art based on the embodiments of the invention without making any inventive effort, are intended to be within the scope of the invention.
In the examples of the present invention, all raw material components are commercially available products well known to those skilled in the art unless specified otherwise; in the embodiments of the present invention, unless specifically indicated, all technical means used are conventional means well known to those skilled in the art.
Example 1
The embodiment provides a preparation method of zEDIII-rHF recombinant protein nano-particles serving as a Zika virus nano-vaccine, wherein the zEDIII-rHF recombinant protein nano-particles can also be called as zEDIII-rHF nano-vaccine, are recombinant proteins specifically induced to the Zika virus, and comprise the following steps:
1) Constructing zEDIII-rHF recombinant protein expression plasmid pET28a/zEDIII-rHF;
PCR amplification rHF (Gene ID: 2495) sequence: plasmid pET-rHF (offered by Dr Paolo Santambrogio (Milan, italy)) encoding the H chain sequence of human ferritin (rHF) was used as template (nanoscales, 2012,4,188)
sense primer:5'C GAGCCACCCCCTCCTGAGCCACCCCCTCCTATGACGACCGCGTCCACCTC C 3',reverse primer:5'CCCAAGCTTTTAGCTTTCATTATCACTGTCTCC 3';
PCR amplification of the zEDIII sequence: the nucleotide sequence of zEDIII was found in NCBI (Gene ID: KU 963796.1), and the complete genome of the Zika virus was extracted from the strain deposited with the Wuhan Virus research Virus Bank of China department (SZ-WIV 01). Using the extracted whole genome sequence as a template, sense primer:5'CGCGGATCCATGGATAAACTTAGATTGAAGGG 3', reverse primer:5'AGGAGGGGGTGGCTCAGGAGGGGGTGGCTCGGTGCTGCCACTCCTGTGCC 3'.
The amino acid sequence of zEDIII is: DKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAGTDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVGEKKITHHWHRSGST, and the amino acid sequence of the zEDIII is identical with that of a virus strain of a virus library (SZ-WIV) of the Wuhan virus of China academy of sciences.
2) The primer of zEDIII-rHF is amplified by using PCR products rHF and zEDIII as templates, as shown in figure 1, and by using overlay-PCR: 5'CGCGGATCCATGGATAAACTTAGATTGAAGGG 3', reverse primer:5 'CCCAAGCTTTTTAGCTTTATTATCATGTCTCC 3' to obtain the zEDIII-rHF nucleotide sequence shown in SEQ ID No. 1.
SEQ ID NO.1:
ATGGATAAACTTAGATTGAAGGGCGTGTCATACTCCTTGTGTACCGCAGCGTTCACATTCACCAAGATCCCGGCTGAAACACTGCACGGGACAGTCACAGTGGAGGTACAGTACGCAGGGACAGATGGACCTTGCAAGGTTCCAGCTCAGATGGCGGTGGACATGCAAACTCTGACCCCAGTTGGGAGGCTGATAACCGCTAACCCCGTAATCACTGAAAGCACTGAGAACTCCAAGATGATGCTGGAACTTGATCCACCATTTGGGGACTCTTACATTGTCATAGGAGTCGGGGAGAAGAAGATCACCCACCACTGGCACAGGAGTGGCAGCACCGAGCCACCCCCTCCTGAGCCACCCCCTCCTATGACGACCGCGTCCACCTCGCAGGTGCGCCAGAACTACCACCAGGACTCAGAGGCCGCCATCAACCGCCAGATCAACCTGGAGCTCTACGCCTCCTACGTTTACCTGTCCATGTCTTACTACTTTGACCGCGATGATGTGGCTTTGAAGAACTTTGCCAAATACTTTCTTCACCAATCTCATGAGGAGAGGGAACATGCTGAGAAACTGATGAAGCTGCAGAACCAACGAGGTGGCCGAATCTTCCTTCAGGATATCAAGAAACCAGACTGTGATGACTGGGAGAGCGGGCTGAATGCAATGGAGTGTGCATTACATTTGGAAAAAAATGTGAATCAGTCACTACTGGAACTGCACAAACTGGCCACTGACAAAAATGACCCCCATTTGTGTGACTTCATTGAGACACATTACCTGAATGAGCAGGTGAAAGCCATCAAAGAATTGGGTGACCACGTGACCAACTTGCGCAAGATGGGAGCGCCCGAATCTGGCTTGGCGGAATATCTCTTTGACAAGCACACCCTGGGAGACAGTGATAATGAAAGCTAA。
The amplification conditions were: denaturation at 98℃for 30s, annealing at 60℃for 30s, extension at 72℃for 30s, amplification for 30 cycles, and storage at 16 ℃. The amplified product is subjected to BamHI and HindIII double enzyme digestion, and then the zEDIII-rHF sequence is inserted into an expression vector pET28a, so that a zEDIII-rHF recombinant protein expression plasmid pET28a/zEDIII-rHF is constructed. The sequence of the target gene is verified to be correct by sequencing.
3) pET28a/zEDIII-rHF is constructed in E.coli BL21 (lambda DE 3) expression system to express zEDIII-rHF recombinant protein. As shown in FIG. 2, the assembly of the zEDIII-rHF recombinant protein nanoparticle is schematically shown.
Culture conditions: volume percentage 1:100 is inoculated into thalli, LB culture is carried out for 4-6 hours until OD600 is between 0.4 and 0.6 based on 37 ℃, then the thalli is placed at 20 ℃ and is further induced for 18 hours by using IPTG with the final concentration of 1mM, and then the thalli are centrifugally collected and crushed under high pressure. The inclusion bodies were subjected to renaturation dialysis using 8M urea-denatured neutral buffer. The first purification step was performed using a nickel column that can bind a 6-his tag, and Superose 6 molecular sieve column SEC (GE Healthcare, uppsala, sweden) was further purified. The purified protein was quantified using BCA protein assay kit (Beyotime, china) and endotoxin concentrations were measured using ToxinSensor Single Tests kit (GenScript, US).
The amino acid sequence of the zEDIII-rHF recombinant protein (specifically inducing recombinant protein aiming at Zika virus) is shown as SEQ ID NO. 2. After induction purification, 1L of the thalli can be purified to obtain 0.5mg of zEDIII-rHF recombinant protein.
SEQ ID NO.2:
MDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAGTDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVGEKKITHHWHRSGSTEPPPPEPPPPMTTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTLGDSDNES。
Zika virus is a single-stranded positive-strand RNA virus, whose genome is about 11kb in length, and encodes 3 structural proteins (capsid protein capsidp protein-C, membrane protein-M or precursor Membrane protein prM, envelope protein-E) and 7 nonstructural proteins (NSl, NS2A, NS2B, NS, NS4A, NS4B, NS). Current research on the zhai card virus vaccine is mainly focused on the E protein region. The E protein is used as a main epitope region, contains a plurality of neutralizing epitopes and specific epitopes, and participates in a plurality of life processes such as virus adsorption, penetration, pathopoiesia and the like. The E protein contains 3 recognizable binding domains (DI, DII, DIII), wherein the third binding domain (zEDIII) of the E protein is regarded as a main neutralizing epitope, has high sequence conservation and good immunogenicity, can induce generation of specific neutralizing antibodies of the Zika virus, and therefore, becomes a potential target for developing the Zika vaccine with high protective efficacy.
The ferritin nanocages are 24-polymer symmetrical protein cage structures formed by self-assembly of 8 ferritin 3 polymers, and can resist changes caused by temperature, PH and chemical reagents in a certain range. The ferritin nano-cage is about 12nm in size, a cavity of 6-8nm is formed in the inner part, and the N end of the encoded ferritin sequence is positioned on the outer surface of the nano-cage, so that gene editing, protein fusion expression and polypeptide modification can be facilitated. The fusion expression of ferritin and other proteins does not affect the self-assembly and assembly properties of ferritin and other proteins, and the zEDIII-rHF recombinant protein nanoparticle serving as the Zika virus nano vaccine provided by the embodiment is characterized in that the N-terminal of ferritin is connected in series with a protein sequence to be expressed, and after the protein is expressed, the zEDIII peptide of the third structural domain of Zika virus E protein in the fusion protein obtained after the self-assembly is displayed on the outer surface of a ferritin cage in a linear mode at intervals of about 5-10nm. The expression mode greatly increases the display quantity of the antigen epitope, and is favorable for inducing the generation of strong T cell dependent antibody response. In addition, ferritin itself may act as an adjuvant and be effective against human lymphocytes such as B cells, CD4 + T lymphocytes, CD8 + The rHF specific binding site on the surface of T lymphocytes recognizes, facilitating recognition of the displayed antigen by immune cells.
The zEDIII-rHF recombinant protein nanoparticle serving as the Zika virus nano vaccine provided by the invention has the advantages that ferritin is used as an antigen presenting nano carrier with excellent properties, the third structural domain (zEDIII) peptide of the Zika virus E protein is displayed on the surface of the recombinant human heavy chain ferritin cage structure, the immunogenicity of the zEDIII is greatly improved, the Zika virus nano vaccine with high protection efficacy is prepared, the Zika virus nano vaccine has the potential of being a novel Zika virus vaccine, and a novel preparation thought, a preparation way, a realization technical means and a method are provided for the preparation of the Zika virus immune vaccine.
Test example 1 recombinant protein expression results detection
The size, purity and specificity of the recombinant zEDIII-rHF recombinant protein were detected by SDS-PAGE and Western Blot.
SDS-PAGE of the purified zEDIII-rHF recombinant protein is shown in FIG. 3, and the single band of the zEDIII-rHF protein can be seen at 35-45 kDa by SDS-PAGE.
The antibody used in Western Blot detection is anti-Zika virus envelope protein domain III antibody (Sino Biological Cat: 40543-R101), the Western Blot identification chart of the purified zEDIII-rHF recombinant protein is shown in figure 4, and the result shows that the purified zEDIII-rHF recombinant protein retains the special domain of E protein domainIII.
As shown in fig. 5, transmission Electron Microscope (TEM) characterization was performed on rHF nanoparticles and zEDIII-rHF recombinant protein nanoparticles obtained by self-assembly. As can be seen from the transmission electron microscope characterization, rHF protein subunits can self-assemble in ferritin assembly buffer solution to form a hollow protein cage structure with an outer diameter of 12nm and an inner diameter of 8nm, TEM images show that EDI-rHF protein is the same as rHF protein subunits, and can self-assemble to form a protein cage structure, and the assembled nano particles have better dispersibility (figure 5). The zEDIII peptide of the third structural domain of the Zika virus E protein in the fusion protein is displayed on the outer surface of a ferritin cage in a linear mode, and the expression mode greatly increases the display quantity of antigen epitopes, is favorable for inducing and generating strong T cell dependent antibody reaction, and can effectively induce the generation of antibody proteins. In addition, ferritin itself may act as an adjuvant and be effective against lymphocytes such as B cells, CD4 + T lymphocytes, CD8 + The rHF specific binding site on the surface of the T lymphocyte is recognized, which is favorable for the recognition of the displayed antigen by immune cells and further enhances the immune response.
Test example 2 detection of immune antibody to immune Effect
The test example tests the immune effect of the zEDIII-rHF recombinant protein nanoparticle Zika vaccine prepared in the embodiment 1, and the immune effect is verified in a mouse body, and the method comprises the following steps:
(1) A129 (B6.129S2-Ifnar 1tm1 Agt) mice 6-8 weeks old were randomly grouped, immunized with 10. Mu.g of the zEDIII-rHF recombinant protein nanoparticle, 3.75. Mu.g of the zEDIII polypeptide (containing equimolar amounts of zEDIII as compared to the zEDIII-rHF recombinant protein nanoparticle), 6.25. Mu.g of rHF nanoparticle (containing equimolar amounts of rHF as compared to the zEDIII-rHF recombinant protein nanoparticle), and PBS, respectively, by the leg intramuscular route, the A129 mice were immunized three times with a total of 100 ul/time immunization application volume for the mice, with a 14 day interval between adjacent two immunizations. Mouse serum was collected 7 days after each immunization and stored at-20 ℃ and ELISA was used to detect ediii-specific IgG antibodies.
The antibody detection results show that no zEDIII specific IgG antibodies are detected in serum of mice immunized by the rHF nano-particles and PBS control mice after three times of immunization, the low-titer zEDIII specific antibodies can be detected by the zEDIII polypeptide group immunized mice, and as shown in FIG. 6, a large amount of zEDIII specific IgG antibodies are induced by the zEDIII-rHF recombinant protein nano-particles, so that strong humoral immune response is proved to be induced by the zEDIII-rHF recombinant protein nano-particles.
(2) After three times of immunization, the spleen of the mouse is taken, and the spleen is aseptically treated for in vitro spleen lymphocyte culture. The spleen is ground to separate single cells, the mouse lymphocyte separation medium is adopted for centrifugation at 800rpm for 30min, the middle layer cloud-like cells are collected, and the spleen lymphocytes are obtained through separation. Detection of CD4 in spleen lymphocytes using LSRFortessa flow cytometer + And CD8 + T positive cells, positive cells were labeled with fluorescently labeled antibodies, including anti-CD 3 (APC/Cy 7), anti-CD 4 (FITC) and anti-CD 8 (PerCP). Data analysis using Flow Jo software, data CD3 + /CD4 + Or CD3 + /CD8 + Double positive loop gate selection to finally obtain CD4 + And CD8 + Percentage of T positive cells, 3 replicates per sample.
As shown in FIG. 7, CD4 in spleen of immunized mice + CD8 + T cell percentage statistical plot, CD4 of zEDIII-rHF group + And CD8 + The T cell percentage was significantly higher than the other groups. CD4 in mice immunized by zEDIII-rHF recombinant protein nano-particles prepared in real-time example 1 + And CD8 + The T positive cells are obviously increased, so that the antigen recognition effect of the third domain of the Zika virus E protein is obviously improvedSpecific antibodies are effectively generated, and the immunity of the immunized mice to the Zika virus is improved.
IL-4 and IFN-gamma secreting cell numbers in spleen lymphocytes were detected using the cytokine enzyme-linked immunospot (ELISPOT) method, and pre-coated mouse IL-4 and IFN-gamma ELISPOT kits were purchased from Daidae as Bio Inc. 1-3×10 of each well is added to the well plate 5 The spleen lymphocytes were stimulated by adding 1. Mu.g of zEDIII, and incubated in an incubator at 37℃for 16-24 hours. Pouring cell culture solution in the hole, adding ice-cold deionized water, standing in a refrigerator at 4 ℃ for 10min, repeatedly washing, adding diluted enzyme-labeled avidin working solution at 37 ℃ for incubation for 1h, standing in a dark place at room temperature for 30min after washing, stopping color development by using the AEC color development solution, and performing spot statistical analysis after airing.
ELISPOT test further evaluates the lymphocyte number of zEDIII specific interleukin in spleen as shown in figure 8, which is a statistical chart of lymphocyte numbers secreted by IL-4-and IFN-gamma in spleen of immunized mice, and the lymphocyte numbers secreted by IL-4-and IFN-gamma in spleen of mice immunized with zEDIII-rHF recombinant protein nanoparticle prepared by the invention in real-time example 1 are obviously increased, and rHF, zEDIII group and PBS group have no obvious difference. In the zEDIII-rHF group, the number of IFN-gamma secreting lymphocytes was much higher than the number of IL-4 secreting lymphocytes. The result shows that the zEDIII-rHF recombinant protein nano-particles induce strong cellular immune response, and the immune type is mainly Th1 type cellular immunity. Therefore, the mice immunized by the zEDIII-rHF recombinant protein nano particles provided by the embodiment 1 of the invention are proved to have improved disease resistance to the Zika virus.
Test example 3 Virus titre detection of immune Effect
Mice were infected with Zika virus SZ-WIV01, serum from 5 mice was collected on days 3 and 10 after virus infection, and samples of visceral tissue (brain, liver, spleen, kidney, testis) from mice were collected 7 days after infection for virus titer detection. Tissue virus titer was determined using a real-time quantitative PCR (qRT-PCR) method. The tissue was homogenized and centrifuged at 5000rpm for 5min to collect the supernatant. Total RNA was extracted using an RNA extraction kit (Magen Cat: R4173-03).
ZIKV RNA was amplified using a pair of universal primers (sense primer:5'AGGATCATAGGTGATGAAGAAAAGT 3' and reverse primer:5'CCTGACAACACTAAGATTGGTGC 3'). All real-time quantitative PCR was performed for sample processing using One step TB Green PrimeScriptTM PLUS RT-PCR kit (TaKaRa Code No. RR096A). RT-PCR assays were all performed on a CFX96 Touchreal-time PCR detection system (Bio-Rad).
The result of the viral RNA assay shown in FIG. 9 shows that the virus titer in blood and tissues of mice of an immunized group adopting the zEDIII-rHF recombinant protein nanoparticles is obviously reduced, and the virus titer in blood and tissues of other groups is not obviously different from that in PBS group, thus the result shows that the zEDIII-rHF recombinant protein nanoparticles effectively inhibit the amplification of various tissues of Zika virus in animal bodies.
Test example 4 survival detection of immune Effect
Mice were infected with Zika virus SZ-WIV01 and immunized three times for 14 days with 20 μl 10LD 50 Zika virus strain (SZ-WIV 01) infected mice, the mice were observed for 21 days, and the weight change and survival rate of the mice were counted. Mice with weight loss of more than 20% were considered dead. Euthanasia treatments were performed according to animal ethics. After Zika infection, zEDIII-rHF immunized mice begin to recover after undergoing a premature decline in body weight, with a maximum percent weight decline of no more than 20%, and eventually all survives.
As shown in fig. 10 and 11, the body weight of other immunized mice was continuously reduced, and finally all the mice died, indicating that the zEDIII-rHF recombinant protein nanoparticles can protect the mice from the infection of the lethal dose of the zika virus.
It should be noted that the above examples are only for further illustrating and describing the technical solution of the present invention, and are not intended to limit the technical solution of the present invention, and the method of the present invention is only a preferred embodiment and is not intended to limit the scope of the present invention. Any modification, equivalent replacement, improvement, etc. made within the spirit and principle of the present invention should be included in the protection scope of the present invention.
Sequence listing
<110> institute of martial arts virus of national academy of sciences
<120> Zika virus recombinant protein vaccine and preparation method thereof
<160> 4
<170> SIPOSequenceListing 1.0
<210> 1
<211> 918
<212> DNA
<213> Artificial sequence (Artificial Sequence)
<400> 1
atggataaac ttagattgaa gggcgtgtca tactccttgt gtaccgcagc gttcacattc 60
accaagatcc cggctgaaac actgcacggg acagtcacag tggaggtaca gtacgcaggg 120
acagatggac cttgcaaggt tccagctcag atggcggtgg acatgcaaac tctgacccca 180
gttgggaggc tgataaccgc taaccccgta atcactgaaa gcactgagaa ctccaagatg 240
atgctggaac ttgatccacc atttggggac tcttacattg tcataggagt cggggagaag 300
aagatcaccc accactggca caggagtggc agcaccgagc caccccctcc tgagccaccc 360
cctcctatga cgaccgcgtc cacctcgcag gtgcgccaga actaccacca ggactcagag 420
gccgccatca accgccagat caacctggag ctctacgcct cctacgttta cctgtccatg 480
tcttactact ttgaccgcga tgatgtggct ttgaagaact ttgccaaata ctttcttcac 540
caatctcatg aggagaggga acatgctgag aaactgatga agctgcagaa ccaacgaggt 600
ggccgaatct tccttcagga tatcaagaaa ccagactgtg atgactggga gagcgggctg 660
aatgcaatgg agtgtgcatt acatttggaa aaaaatgtga atcagtcact actggaactg 720
cacaaactgg ccactgacaa aaatgacccc catttgtgtg acttcattga gacacattac 780
ctgaatgagc aggtgaaagc catcaaagaa ttgggtgacc acgtgaccaa cttgcgcaag 840
atgggagcgc ccgaatctgg cttggcggaa tatctctttg acaagcacac cctgggagac 900
agtgataatg aaagctaa 918
<210> 2
<211> 305
<212> PRT
<213> Artificial sequence (Artificial Sequence)
<400> 2
Met Asp Lys Leu Arg Leu Lys Gly Val Ser Tyr Ser Leu Cys Thr Ala
1 5 10 15
Ala Phe Thr Phe Thr Lys Ile Pro Ala Glu Thr Leu His Gly Thr Val
20 25 30
Thr Val Glu Val Gln Tyr Ala Gly Thr Asp Gly Pro Cys Lys Val Pro
35 40 45
Ala Gln Met Ala Val Asp Met Gln Thr Leu Thr Pro Val Gly Arg Leu
50 55 60
Ile Thr Ala Asn Pro Val Ile Thr Glu Ser Thr Glu Asn Ser Lys Met
65 70 75 80
Met Leu Glu Leu Asp Pro Pro Phe Gly Asp Ser Tyr Ile Val Ile Gly
85 90 95
Val Gly Glu Lys Lys Ile Thr His His Trp His Arg Ser Gly Ser Thr
100 105 110
Glu Pro Pro Pro Pro Glu Pro Pro Pro Pro Met Thr Thr Ala Ser Thr
115 120 125
Ser Gln Val Arg Gln Asn Tyr His Gln Asp Ser Glu Ala Ala Ile Asn
130 135 140
Arg Gln Ile Asn Leu Glu Leu Tyr Ala Ser Tyr Val Tyr Leu Ser Met
145 150 155 160
Ser Tyr Tyr Phe Asp Arg Asp Asp Val Ala Leu Lys Asn Phe Ala Lys
165 170 175
Tyr Phe Leu His Gln Ser His Glu Glu Arg Glu His Ala Glu Lys Leu
180 185 190
Met Lys Leu Gln Asn Gln Arg Gly Gly Arg Ile Phe Leu Gln Asp Ile
195 200 205
Lys Lys Pro Asp Cys Asp Asp Trp Glu Ser Gly Leu Asn Ala Met Glu
210 215 220
Cys Ala Leu His Leu Glu Lys Asn Val Asn Gln Ser Leu Leu Glu Leu
225 230 235 240
His Lys Leu Ala Thr Asp Lys Asn Asp Pro His Leu Cys Asp Phe Ile
245 250 255
Glu Thr His Tyr Leu Asn Glu Gln Val Lys Ala Ile Lys Glu Leu Gly
260 265 270
Asp His Val Thr Asn Leu Arg Lys Met Gly Ala Pro Glu Ser Gly Leu
275 280 285
Ala Glu Tyr Leu Phe Asp Lys His Thr Leu Gly Asp Ser Asp Asn Glu
290 295 300
Ser
305
<210> 3
<211> 32
<212> DNA
<213> Artificial sequence (Artificial Sequence)
<400> 3
cgcggatcca tggataaact tagattgaag gg 32
<210> 4
<211> 33
<212> DNA
<213> Artificial sequence (Artificial Sequence)
<400> 4
cccaagcttt tagctttcat tatcactgtc tcc 33
Claims (8)
1. The Zika virus recombinant protein vaccine is characterized in that the recombinant protein is a third structural domain peptide of Zika virus E protein and is displayed on the surface of recombinant human heavy chain ferritin;
the recombinant protein self-assembles into a cage-shaped hollow protein nanoparticle structure;
the amino acid sequence of the recombinant protein is shown as SEQ ID NO. 2.
2. A gene encoding the recombinant protein vaccine of zika virus according to claim 1, wherein the nucleotide sequence of the gene is shown in SEQ ID No. 1.
3. An expression vector comprising the gene encoding the recombinant protein vaccine of zika virus of claim 2.
4. The expression vector of claim 3, wherein the construction method comprises the use of a forward primer sequence as set forth in SEQ ID NO.3 and a reverse primer sequence as set forth in SEQ ID NO. 4:
SEQ ID NO.3:5'-CGCGGATCCATGGATAAACTTAGATTGAAGGG-3';
SEQ ID NO.4:5'-CCCAAGCTTTTAGCTTTCATTATCACTGTCTCC-3'。
5. the expression vector of claim 3 or 4, wherein the expression vector backbone is pET28a escherichia coli expression plasmid.
6. The preparation method of the Zika virus recombinant protein is characterized by comprising the following steps:
1) Inserting a nucleotide sequence shown in SEQ ID NO.1 into an escherichia coli expression plasmid to obtain a recombinant plasmid pET28a/zEDIII-rHF;
2) Expressing the recombinant plasmid pET28a/zEDIII-rHF in an escherichia coli prokaryotic expression system, and separating and purifying to obtain the Zika virus recombinant protein containing the Zika virus E protein third structural domain peptide and the human heavy chain ferritin.
7. The method for preparing the recombinant protein of Zika virus according to claim 6, wherein in the step 2), the recombinant plasmid pET28a/zEDIII-rHF is purified for the second time by a molecular sieve after being expressed in a prokaryotic expression system of escherichia coli and being subjected to the first purification by a nickel column.
8. A combination vaccine comprising the zika virus recombinant protein vaccine of claim 1.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202111374523.9A CN114230671B (en) | 2021-11-18 | 2021-11-18 | Zika virus recombinant protein vaccine and preparation method thereof |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202111374523.9A CN114230671B (en) | 2021-11-18 | 2021-11-18 | Zika virus recombinant protein vaccine and preparation method thereof |
Publications (2)
Publication Number | Publication Date |
---|---|
CN114230671A CN114230671A (en) | 2022-03-25 |
CN114230671B true CN114230671B (en) | 2023-12-01 |
Family
ID=80750116
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN202111374523.9A Active CN114230671B (en) | 2021-11-18 | 2021-11-18 | Zika virus recombinant protein vaccine and preparation method thereof |
Country Status (1)
Country | Link |
---|---|
CN (1) | CN114230671B (en) |
Citations (7)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN108699561A (en) * | 2015-11-19 | 2018-10-23 | 创嘉生物科技有限公司 | Recombinant lactic acid bacteria and its purposes in oral universal influenza vaccine |
CN109081868A (en) * | 2017-06-14 | 2018-12-25 | 中国科学院上海巴斯德研究所 | Target the monoclonal antibody and its application of zika virus envelope protein conserved epitope |
CN111328346A (en) * | 2017-11-06 | 2020-06-23 | 西纳生物技术有限公司 | Fusion proteins based on human ferritin and protease cleavable peptides and their use as chemotherapeutic carriers |
CN112321718A (en) * | 2019-08-05 | 2021-02-05 | 中国农业科学院生物技术研究所 | Self-assembly ferritin-based nano antigen particle, peste des petits ruminants vaccine and preparation method and application thereof |
CN112876570A (en) * | 2021-02-09 | 2021-06-01 | 中国农业科学院生物技术研究所 | African swine fever virus vaccine and preparation method thereof |
KR20210082306A (en) * | 2019-12-24 | 2021-07-05 | 강원대학교산학협력단 | Development of recombinant subunit Zika virus vaccine and preparing method thereof |
CN113121704A (en) * | 2020-03-25 | 2021-07-16 | 昆山新蕴达生物科技有限公司 | Nanoparticle-based coronavirus vaccines |
Family Cites Families (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2017132210A1 (en) * | 2016-01-25 | 2017-08-03 | Iogenetics, Llc | Interventions for flavivirus infections |
US10961283B2 (en) * | 2016-06-27 | 2021-03-30 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Self-assembling insect ferritin nanoparticles for display of co-assembled trimeric antigens |
-
2021
- 2021-11-18 CN CN202111374523.9A patent/CN114230671B/en active Active
Patent Citations (7)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN108699561A (en) * | 2015-11-19 | 2018-10-23 | 创嘉生物科技有限公司 | Recombinant lactic acid bacteria and its purposes in oral universal influenza vaccine |
CN109081868A (en) * | 2017-06-14 | 2018-12-25 | 中国科学院上海巴斯德研究所 | Target the monoclonal antibody and its application of zika virus envelope protein conserved epitope |
CN111328346A (en) * | 2017-11-06 | 2020-06-23 | 西纳生物技术有限公司 | Fusion proteins based on human ferritin and protease cleavable peptides and their use as chemotherapeutic carriers |
CN112321718A (en) * | 2019-08-05 | 2021-02-05 | 中国农业科学院生物技术研究所 | Self-assembly ferritin-based nano antigen particle, peste des petits ruminants vaccine and preparation method and application thereof |
KR20210082306A (en) * | 2019-12-24 | 2021-07-05 | 강원대학교산학협력단 | Development of recombinant subunit Zika virus vaccine and preparing method thereof |
CN113121704A (en) * | 2020-03-25 | 2021-07-16 | 昆山新蕴达生物科技有限公司 | Nanoparticle-based coronavirus vaccines |
CN112876570A (en) * | 2021-02-09 | 2021-06-01 | 中国农业科学院生物技术研究所 | African swine fever virus vaccine and preparation method thereof |
Non-Patent Citations (1)
Title |
---|
"铁蛋白纳米载体及其在生物医学领域的应用潜力";苏恺等;《畜牧兽医学报》;第52卷(第4期);第909-919页 * |
Also Published As
Publication number | Publication date |
---|---|
CN114230671A (en) | 2022-03-25 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
CN113292640B (en) | Novel recombinant coronavirus RBD trimer protein vaccine capable of generating broad-spectrum cross-neutralization activity, and preparation method and application thereof | |
JP4448281B2 (en) | Nucleic acid vaccine for prevention of flavivirus infection | |
CN113512096B (en) | Weever rhabdovirus recombinant G2 protein and application thereof | |
CN108912215A (en) | Method and composition for dengue virus epitope | |
US11638750B2 (en) | Methods for generating a Zikv immune response utilizing a recombinant modified vaccina Ankara vector encoding the NS1 protein | |
CN111620952A (en) | Novel coronavirus vaccine based on chimeric virus-like particles | |
CN112979826B (en) | Encephalitis B virus nanoparticle vaccine and preparation method and application thereof | |
CN113461787A (en) | Recombinant novel coronavirus S-RBD trimer protein, and preparation method and application thereof | |
CN113121704B (en) | Nanoparticle-based coronavirus vaccines | |
CN111132692A (en) | Virus-like particles comprising Zika virus antigen | |
CN114478718B (en) | Recombinant novel coronavirus protein vaccine, preparation method and application thereof | |
CN114315989A (en) | Recombinant novel coronavirus protein vaccine, preparation method and application thereof | |
EP2428221B1 (en) | Dengue vaccine, pharmaceutical composition comprising the same, nucleotide molecule and antibody composition | |
Rong et al. | Self-assembling nanovaccine confers complete protection against zika virus without causing antibody-dependent enhancement | |
CN114230671B (en) | Zika virus recombinant protein vaccine and preparation method thereof | |
CN117447589A (en) | Heavy chain antibody variable region sequence, recombinant nano antibody for resisting gene VI type newcastle disease virus, and preparation method and application thereof | |
CN117045782A (en) | Novel self-assembled porcine coronavirus nanoparticle vaccine and application thereof | |
CN108503696A (en) | A kind of zika virus subunit vaccine of yeast cell to express | |
CN109082435B (en) | Oral vaccine for preventing Zika virus infection and preparation method thereof | |
CN114805599B (en) | VLPs based on ADDOmer chimeric porcine O-type foot-and-mouth disease virus epitope and application | |
CN114409742B (en) | African swine fever virus p49 protein epitope and application thereof | |
CN112724205B (en) | Method for preparing virus-like particles from C hepatitis E virus 239 protein and application thereof | |
KR102365464B1 (en) | Development of recombinant subunit Zika virus vaccine and preparing method thereof | |
CN112661818A (en) | Canine and cat parvovirus VP2350-420Protein and preparation method and application thereof | |
WO2020208434A1 (en) | Zika virus subunit vaccine |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PB01 | Publication | ||
PB01 | Publication | ||
SE01 | Entry into force of request for substantive examination | ||
SE01 | Entry into force of request for substantive examination | ||
GR01 | Patent grant | ||
GR01 | Patent grant |