KR20170138861A - 펩타이드-키토산 개질 나노입자 및 이를 포함하는 약물 전달체 - Google Patents

펩타이드-키토산 개질 나노입자 및 이를 포함하는 약물 전달체 Download PDF

Info

Publication number
KR20170138861A
KR20170138861A KR1020160071237A KR20160071237A KR20170138861A KR 20170138861 A KR20170138861 A KR 20170138861A KR 1020160071237 A KR1020160071237 A KR 1020160071237A KR 20160071237 A KR20160071237 A KR 20160071237A KR 20170138861 A KR20170138861 A KR 20170138861A
Authority
KR
South Korea
Prior art keywords
peptide
chitosan
drug
group
functional group
Prior art date
Application number
KR1020160071237A
Other languages
English (en)
Other versions
KR101924519B1 (ko
Inventor
태기융
이종현
Original Assignee
광주과학기술원
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 광주과학기술원 filed Critical 광주과학기술원
Priority to KR1020160071237A priority Critical patent/KR101924519B1/ko
Publication of KR20170138861A publication Critical patent/KR20170138861A/ko
Application granted granted Critical
Publication of KR101924519B1 publication Critical patent/KR101924519B1/ko

Links

Images

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/69—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the conjugate being characterised by physical or galenical forms, e.g. emulsion, particle, inclusion complex, stent or kit
    • A61K47/6921—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the conjugate being characterised by physical or galenical forms, e.g. emulsion, particle, inclusion complex, stent or kit the form being a particulate, a powder, an adsorbate, a bead or a sphere
    • A61K47/6927—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the conjugate being characterised by physical or galenical forms, e.g. emulsion, particle, inclusion complex, stent or kit the form being a particulate, a powder, an adsorbate, a bead or a sphere the form being a solid microparticle having no hollow or gas-filled cores
    • A61K47/6929—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the conjugate being characterised by physical or galenical forms, e.g. emulsion, particle, inclusion complex, stent or kit the form being a particulate, a powder, an adsorbate, a bead or a sphere the form being a solid microparticle having no hollow or gas-filled cores the form being a nanoparticle, e.g. an immuno-nanoparticle
    • A61K47/6931—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the conjugate being characterised by physical or galenical forms, e.g. emulsion, particle, inclusion complex, stent or kit the form being a particulate, a powder, an adsorbate, a bead or a sphere the form being a solid microparticle having no hollow or gas-filled cores the form being a nanoparticle, e.g. an immuno-nanoparticle the material constituting the nanoparticle being a polymer
    • A61K47/6939—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the conjugate being characterised by physical or galenical forms, e.g. emulsion, particle, inclusion complex, stent or kit the form being a particulate, a powder, an adsorbate, a bead or a sphere the form being a solid microparticle having no hollow or gas-filled cores the form being a nanoparticle, e.g. an immuno-nanoparticle the material constituting the nanoparticle being a polymer the polymer being a polysaccharide, e.g. starch, chitosan, chitin, cellulose or pectin
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/22—Hormones
    • A61K38/28—Insulins
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/06—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
    • A61K47/08—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite containing oxygen, e.g. ethers, acetals, ketones, quinones, aldehydes, peroxides
    • A61K47/10—Alcohols; Phenols; Salts thereof, e.g. glycerol; Polyethylene glycols [PEG]; Poloxamers; PEG/POE alkyl ethers
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/56—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule
    • A61K47/61—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule the organic macromolecular compound being a polysaccharide or a derivative thereof
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00—Medicinal preparations characterised by special physical form
    • A61K9/0012—Galenical forms characterised by the site of application
    • A61K9/0053—Mouth and digestive tract, i.e. intraoral and peroral administration
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
    • C07K7/04—Linear peptides containing only normal peptide links
    • C07K7/08—Linear peptides containing only normal peptide links having 12 to 20 amino acids

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Epidemiology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Organic Chemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Molecular Biology (AREA)
  • Genetics & Genomics (AREA)
  • Nanotechnology (AREA)
  • Biophysics (AREA)
  • Zoology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Immunology (AREA)
  • Biochemistry (AREA)
  • Endocrinology (AREA)
  • Oil, Petroleum & Natural Gas (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Toxicology (AREA)
  • Nutrition Science (AREA)
  • Physiology (AREA)
  • Diabetes (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicinal Preparation (AREA)

Abstract

본 발명은 펩타이드-키토산 개질 나노입자 및 이를 포함하는 약물 전달체에 관한 것이다. 본 발명에 따라, 단백질 약물과 펩타이드 약물의 높은 경구 생체이용율을 보일 수 있는 나노입자 및 이의 약물 전달체로서의 용도가 제공된다.

Description

펩타이드-키토산 개질 나노입자 및 이를 포함하는 약물 전달체{Peptide-chitosan modified nanoparticle and drug carrier comprising the same}
본 발명은 펩타이드-키토산 개질 나노입자 및 이를 포함하는 약물 전달체에 관한 것이다.
단백질 약물과 펩타이드 약물은 통상 1% 미만의 낮은 경구 생체이용율을 보인다. 따라서, 단백질 약물과 펩타이드 약물의 낮은 경구 생체이용율을 높일 수 있는 기술 개발이 필요하다.
1. D. Christiane et al, Oral delivery of insulin associated to polymeric nanoparticles in diabetic rats, Journal of Controlled Release, 2007, 117, 163??170. 2. Z. Yan et al, pH-sensitive thiolated nanoparticles facilitate the oral delivery of insulin in vitro and in vivo, J. Nanopart Res, 2015, 17, 103-116. 3. L. Xiuying et al, Intestinal mucosa permeability following oral insulin delivery using core shell corona nanolipoparticles, Biomaterials, 2013, 34, 9678-9687. 4. C. Gerardo P et al, Oral insulin delivery, Advanced Drug Delivery Reviews, 1999, 35, 249-257. 5. C. Mei-Chin et al, A review of the prospects for polymeric nanoparticle platform in oral insulin delivery, Biomaterials, 2011, 32, 9826-9838. 6. M. Garcia-Fuentes et al, Chitosan-based drug nanocarriers: Where do we stand?, Journal of Controlled Release, 2012, 161, 496-504. 7. S. R. Hwang et al, Advances in oral macromolecular drug delivery, Expert Opinion on Drug Delivery, molecular pharmaceutics, 2014, 11, 1955-1967. 8. M. Foyez et al, Absorption Mechanism of a physical complex of monomeric insulin and deoxycholyl-L-lysyl-methylester in the small intestine, 2015, 12, 1911-1920. 9. Y. Fei et al, Entric-coated capsules filled with mono-disperse micro-particles containing PLGA-lipid-PEG nanoparticles for oral delivery of insulin, International Journal of Pharmaceutics, 2015, 484, 181-191. 10. D. Maria A., Potential use of tight junction modulators to reversibly open membranous barriers and improve drug delivery, Biochimica et Biophysica Acta, 2009, 1788, 892-910. 11. P. Mariarosaria Di et al, Zonula occludens toxin structure-function analysis, The journal of biological chemistry, 2001, 276, 19160-19165. 12. G. Shobha et al, Mechanism of action of ZOT-derived peptide AT-1002, a tight junction regulator and absorption enhancer, International Journal of Pharmaceutics, 2009, 365, 121-130. 13. Choi. W. I et al, One pot, single phase synthesis of thermos-sensitive nano-carriers by photo-crosslinking of a diacrylated pluronic, Journal of Materials Chemistry, 2008, 18, 2769-2774. 14. Choi. W. I et al, Controlled release of proteins from pluronic-based nano-carrier, Macromolecular Research, 2011, 19, 639-642. 15. Kim. J. Y et al, In-vivo tumor targeting of pluronic-based nano-carriers, Journal of Controlled Release, 2010, 147, 109-117. 16. Kim. J. Y et al, Brain-targeted delivery of protein using chitosan- and RVG peptide-conjugated, pluronic-based nano-carrier, Biomaterials, 2013, 34, 1170-1178. 17. Choi. W. I et al, Trgeted antitumor efficacy and imaging via multifunctional nano-carrier conjugated with anti-HER2 trastuzumab, Nanomedicine, 2015, 11, 359-368. 18. Lee. J. H et al, Synergistic effect of folate and RGD dual ligand of nanographene oxide on tumor targeting and photothermal therapy in vivo, Nanoscale, 2015, 7, 18584-18594. 19. Shan. W et al, Overcoming the diffusion barrier of mucus and absorption barrier of epithelium by self-assembled nanoparticles for oral delivery of insulin, ACS nano, 2015, 9, 2345-2356. 20. Hus. L. W et al, Effect of pH on molecular mechanisms of chitosan-integrin interactions and resulting tight-junction disruptions, Biomaterials, 2013, 34, 784-793. 21. Hus. L. W et al, Elucidating the signaling mechanism of an epithelial tight-junction opening induced by chitosan, Biomaterials, 2012, 33, 6254-62. 22. Ahn. S et al, Oral delivery of an anti-diabetic peptide drug via conjugation and complexation with low molecular weight chitosan, Journal of Controlled Release, 2013, 170, 226-232. 23. Goldblum. S. E et al, The active zot domain (aa 288-293) increases zo-1 and myosin 1C serine/threonine phosphorylation, alters interaction between zo-1 and its binding partners, and induces tight junction disassembly through proteinase activated receptor 2 activation, The FACEB Journal, 2011, 25, 144-158.
단백질 약물과 펩타이드 약물의 높은 경구 생체이용율을 보일 수 있는 나노입자 및 이의 약물 전달체로서의 용도를 제공하고자 한다.
본 발명의 일 측면은 (a) 플루로닉 고분자, (b) 상기 플루로닉 고분자와 제1 결합되어 있는 키토산, (c) 상기 키토산과 제2 결합되어 있는 링커, (d) 상기 링커와 제3 결합되어 있는 펩타이드를 포함하는 펩타이드-키토산 개질 나노입자로서; 상기 플루로닉 고분자는 플루로닉 중합 가능 관능기를 2개 이상 포함하고, 상기 키토산은 키토산 관능기를 포함하며, 상기 제1 결합은 상기 플루로닉 중합 가능 관능기와 상기 키토산 관능기 사이의 결합이고; 상기 링커는 양 말단이 각각 제1 링커 관능기 및 제2 링커 관능기이고, 상기 제2 결합은 상기 키토산의 아민기와 상기 제1 링커 관능기 사이의 결합이며; 상기 제3 결합은 상기 제2 링커 관능기와 상기 펩타이드의 시스테인 사이의 결합인 것을 특징으로 하는 펩타이드-키토산 개질 나노입자에 관한 것이다.
본 발명의 다른 측면은 본 발명의 여러 구현예에 따른 나노입자 및 (B) 상기 나노입자 내부에 포함되어 있는 약물을 포함하는 약물 운반체에 관한 것이다.
본 발명의 다른 측면은 본 발명의 여러 구현예에 따른 약물 운반체를 포함하는 약학 조성물에 관한 것이다.
본 발명의 또 다른 측면은 본 발명의 여러 구현예에 따른 나노입자 및 약물을 포함하는 용액을 수득하는 단계를 포함하는 약물 운반체 제조방법에 관한 것이다.
본 발명에 따라, 단백질 약물과 펩타이드 약물의 높은 경구 생체이용율을 보일 수 있는 나노입자 및 이의 약물 전달체로서의 용도가 제공된다.
도 1은 본 발명의 아민-개질 나노운반체와 키토산-개질 나노운반체의 제조에 관한 모식도이다.
도 2는 본 발명의 펩타이드-개질 나노운반체와 펩타이드-키토산-개질 나노운반체의 제조에 관한 모식도이다.
도 3a는 본 발명에서 사용한 모든 나노운반체의 크기에 대한 측정 결과이다.
도 3b는 본 발명에서 사용한 모든 나노운반체의 표면 전하에 대한 측정 결과이다.
도 4a는 다양한 나노운반체를 처리한 후 caco-2 세포 단층막의 TEER 변화율 측정 결과이다.
도 4b는 다양한 나노운반체 안에 담지된 인슐린의 세포 단층막 투과도 측정 결과이다.
도 5는 caco-2 세포 단층막에 다양한 나노운반체를 처리한 후, 세포 밀집 연접의 변화를 형광 이미징을 통해 간접적으로 측정한 결과이다.
도 6a는 당뇨가 유발된 쥐에 다양한 나노운반체에 담지된 인슐린의 영향에 의한 혈당의 변화를 관찰한 결과이다.
도 6b는 당뇨가 유발된 쥐에 다양한 나노운반체에 담지된 인슐린의 영향에 의한 혈액에서의 인슐린 농도의 변화를 관찰한 결과이다.
도 7은 당뇨가 유발된 쥐에 형광 염료가 부착된 인슐린과 다양한 나노운반체 (FITC-insulin, Cy-5.5-나노운반체)의 소장막 분포 형광 이미지이다.
이하에서, 본 발명의 여러 측면 및 다양한 구현예에 대해 더욱 구체적으로 살펴보도록 한다.
본 발명의 일 측면은 (a) 플루로닉 고분자, (b) 상기 플루로닉 고분자와 제1 결합되어 있는 키토산, (c) 상기 키토산과 제2 결합되어 있는 링커, (d) 상기 링커와 제3 결합되어 있는 펩타이드를 포함하는 펩타이드-키토산 개질 나노입자로서; 상기 플루로닉 고분자는 플루로닉 중합 가능 관능기를 2개 이상 포함하고, 상기 키토산은 키토산 관능기를 포함하며, 상기 제1 결합은 상기 플루로닉 중합 가능 관능기와 상기 키토산 관능기 사이의 아실화 반응을 통한 결합이고; 상기 링커는 양 말단이 각각 제1 링커 관능기 및 제2 링커 관능기이고, 상기 제2 결합은 상기 키토산의 아민기와 상기 제1 링커 관능기 사이의 결합이며; 상기 제3 결합은 상기 제2 링커 관능기와 상기 펩타이드의 시스테인 사이의 결합인 것을 특징으로 하는 펩타이드-키토산 개질 나노입자에 관한 것이다.
본 발명에 따른 펩타이드-키토산으로 이중 개질되어 있는 나노입자뿐만 아니라, 펩타이드만으로 개질되어 있는 나노입자나 키토산만으로 개질된 나노입자도 밀착연접(tight junction)의 개방성을 조절할 수 있다. 그러나, 펩타이드만으로 개질되어 있는 나노입자나 키토산만으로 개질된 나노입자에 비해 본 발명에 따른 펩타이드-키토산으로 이중 개질되어 있는 나노입자가 인슐린과 같은 약물의의 세포 단일막 투과를 더욱 증가시킬 수 있다. 또한, 펩타이드만으로 개질되어 있는 나노입자나 키토산만으로 개질된 나노입자와 달리 본 발명에 따른 펩타이드-키토산으로 이중 개질되어 있는 나노입자만이 약물을 함유한 후 경구 투여되는 경우, 인슐린과 같은 약물의 혈장 내 농도를 증가시킬 수 있고, 혈당반응(glycemic response) 조절 가능 시간이 증가한다는 점을 확인하였다.
일 구현예에 따르면, 상기 플루로닉 중합 가능 관능기는 아크릴기, 다이아크릴기, 올리고아크릴기, 메타아크릴기, 올리고메타아크릴기, 쿠마린기, 타이민기, 시나메이트기 중에서 선택될 수 있다. 또한, 상기 키토산 관능기는 글리이실 메타아크릴기, 올리고 글리이실 메타아크릴기 중에서 선택될 수 있다. 또한, 상기 제1 링커 관능기는 NHS 등 아민과 반응이 용이한 관능기 중에서 선택될 수 있다. 또한, 상기 제2 링커 관능기는 MAL 등 싸이올과 반응이 용이한 관능기 중에서 선택될 수 있다. 본 발명에 있어서, NHS는 N-하이드로숙신이미드 에스테르를 의미하고, MAL은 말레이미드를 의미한다.
다른 구현예에 따르면, 상기 펩타이드는 밀착연접 개방성 펩타이드(tight junction opening peptide)이다. 본 발명에 있어서, 밀착연접 개방성 펩타이드는 세포연접의 한 종류인 밀착연접을 개방시킬 수 있는 펩타이드를 의미하며, 특히 Trans Epithelial Electric Resistance (TEER) 분석법으로 분석하였을 때 상피세포의 밀착연접이 개방되어 저항값이 감소하는 결과를 보일 수 있는 펩타이드를 의미한다.
또 다른 구현예에 따르면, 상기 펩타이는 ZOT 유래 펩타이드, Occludin 유래 펩타이드, Claudin-4 유래 펩타이드 중에 선택될 수 있다. 본 발명에 있어서, ZOT란 밀착결합독소 또는 폐쇄띠독소(zonula occludens toxin)를 의미한다.
또 다른 구현예에 따르면, 상기 펩타이드는 하기 서열 중에서 선택될 수 있다.
[서열번호 1]
YTWMPENPRPGTPCDIFTNSRGKRASNGGGGGGC
[서열번호 2]
FDFWITPGGGGGC
[서열번호 3]
CLYHYCGGGGGC
[서열번호 4]
SHAVSSGGGGGC
[서열번호 5]
ADTPPVGGGGGC
[서열번호 6]
FCIGRLGGGGGC
또 다른 구현예에 따르면, 상기 링커는 MAL-PEG-NHS로, 아민과 싸이올기와 반응이 용이한 다른 관능기를 갖는 링커들도 선택될 수 있다. 본 발명에 있어서, PEG는 폴리에틸렌글리콜을 의미하며, 바람직하게는 500 내지 1,000 Da의 분자량을 갖는다.
본 발명의 다른 측면은 본 발명의 여러 구현예에 따른 나노입자 및 (B) 상기 나노입자 내부에 포함되어 있는 약물을 포함하는 약물 운반체에 관한 것이다.
본 발명에 있어서, 상기 약물은 순환계를 통한 전신투여가 필요한 1종 이상의 약물로서, 특히 생활성을 지닌 단백질, ??타이드, 핵산류 약물이 적합하며, 현재 경구 약물로 사용되고 있는 인슐린, 설포유닐리아계, 메글리티나이드계, 비구아나이드계 등의 약물도 포함하지만, 이에 국한되지 않는다.
일 구현예에 따르면, 상기 약물은 인슐린, 설포유닐리아계 약물, 메글리티나이드계 약물, 비구아나이드계 약물 중에서 선택될 수 있으며, 특히 인슐린이 당뇨병에 의해 유발되는 혈중 고혈당을 정상 혈당으로 효과적으로 낮추기 때문에 가장 바람직하다.
본 발명의 다른 측면은 본 발명의 여러 구현예에 따른 약물 운반체를 포함하는 약학 조성물에 관한 것이다.
일 구현예에 따르면, 상기 약물 조성물은 경구 투여용이다. 특히, 위에서 언급한 바와 같이 경구 투여하는 경우 전달 특성이 향상되고 체내에 머무르는 시간도 연장됨을 확인하였다.
본 발명의 다른 측면은 본 발명의 여러 구현예에 따른 나노입자 및 약물을 포함하는 용액을 수득하는 단계를 포함하는 약물 운반체 제조방법에 관한 것이다. 이렇게 수득된 용액을 예를 들어 실온에서 천천히 교반하거나 방치함으로써 팽윤된 나노입자의 내부로 약물이 담지시킬 수 있다.
일 구현예에 따르면, 상기 (A) 단계 후에 (B) 담지 되지 않은 약물을 제거하는 단계를 포함할 수 있다.
이하에서 실시예 등을 통해 본 발명을 더욱 상세히 설명하고자 하며, 다만 이하에 실시예 등에 의해 본 발명의 범위와 내용이 축소되거나 제한되어 해석될 수 없다. 또한, 이하의 실시예를 포함한 본 발명의 개시 내용에 기초한다면, 구체적으로 실험 결과가 제시되지 않은 본 발명을 통상의 기술자가 용이하게 실시할 수 있음은 명백한 것이며, 이러한 변형 및 수정이 첨부된 특허청구범위에 속하는 것도 당연하다.
또한 이하에서 제시되는 실험 결과는 상기 실시예 및 비교예의 대표적인 실험 결과만을 기재한 것이며, 아래에서 명시적으로 제시하지 않은 본 발명의 여러 구현예의 각각의 효과는 해당 부분에서 구체적으로 기재하도록 한다.
실시예
이하, 실시예를 통하여 본 발명을 더욱 상세히 설명하고자 한다. 이들 실시예는 오로지 본 발명을 보다 구체적으로 설명하기 위한 것으로, 본 발명의 요지에 따라 본 발명의 범위가 이들 실시예에 의해 제한되지 않는다는 것은 당업계에서 통상의 지식을 가진 자에 있어서 자명할 것이다.
실험 재료
Pluronic F-68 (PEO82 PPO31 PEO82, MW6,800)을 BASF Corp. (Seoul, Korea)로부터 입수하였다. 시스테아민, 아크릴로일 클로라이드, 트리에틸 아민 및 무수 톨루엔은 Aldrich (Milwaukee, WI, USA)로부터 구입하였다. 4-(2-하이드록시에톡시) 페닐-(2-하이드록시-2-프로필) 케톤 (Irgacure 2959)은 Ciba Specialty Chemicals Inc.(Basel, Switzerland)로부터 구입하였다. 키토산 (chitooligosaccharide, 디아세틸레이션=85%, MW5,000 ~ 10,000)은 Kittolife Co., Ltd. (Seoul, Korea)에서 구입하였다. Peptide (AT-1002-Cyspeptide , sequence: FCIGRLGGGGGC)는 AnyGen, Inc. (Gwangju, Korea)에서 구입하였다. 헤테로바이펑셔널폴리에틸렌글라이콜 (α-maleimide-ω-N-hydroxy-succinimide ester polyethylene glycol, MAL-PEG-NHS, Mw 2,100)은 Creative PEGWorks (Winston-Salem, NC, USA)에서 구입하였다. NanosepTM 원심분리 장치는 (MWCO 300 000)는 Pall Life Sciences (Ann Arbor, MI, USA)로부터 구입하였다. 투과막[셀룰로오스 에스테르(CE), MWCO 300,000 with a nominal pore size of 35 nm]은 Spectrum (Houston, TX, USA)의 제품이다. 0.2 μm 셀룰로오스 멸균 시린지 필터는 Whatman (Florham Park, New Jersey, USA)으로부터 구입한 것이다.
실시예 1: 키토산-개질 나노운반체 및 아민-개질 나노운반체의 제조
도 1에서 도식적으로 나타낸 바와 같은 방법에 따라 본 연구실에 의해 종전에 보고되었던 방법에 따라 키토산-개질 및 아민-개질 나노운반체를 제조하였다. 이는 다이아크릴레이트화 플루로닉 (DA-Pluronic) 및 아클리레이트화 키토산을 광-중합 하여, 플루로닉 기반 나노운반체의 bare 형 (NC(PF 68)) 및 키토산-개질 형 (Chi-NC (PF 68))을 제조하였다. 간략하게 설명하면, bare 형의 경우, 다이 아크릴레이트화 플루로닉 용액 (0.5 중량%)의 희석된 수용액을 광 개시제[0.05 중량%, Irgacure 2959, 4-(2-하이드록시에톡시) 페닐- (2-하이드록시-2-프로필) 케톤]와 부드럽게 믹싱하고, 언필더 자외선 램프(VL- 4.LC, 8 W, Vilber Lourmat, France)을 이용하여 15분간 1.3 mW/cm2 강도에서 UV-조사시켰다. 키토산-개질 형의 경우, 수용성 글라이시딜-메타아크릴레이트(GMA)-결합 키토산 (2.0 mg)을 탈이온수에 용해시키고, 다이아크릴레이트화 플루로닉 용액에 첨가하여 0.5 중량%의 다이아크릴레이트화 플루로닉을 제조하였다. 상기 bare 형에 이용되는 조건과 동일한 조건에서 상기 혼합물을 광-중합하여 GMA-결합 키토산의 비닐기를 가교결합 나노운반체 내로 결합시켰다. 미반응 물질들을 제거하기 위해, 전체 용액을 투석 주머니(cellulose ester, MWCO, 300 kDa)를 이용하여 투석 하되 처음은 0.1 M NaCl에서 투석하고, 이어 탈이온수에서 투석하였다. 또한, 표면에 아민-개질 나노운반체 (Amine-NC (PF 68))를 제조하였다. 간략히 설명하자면, 시스테아민 (0.35 mg)을 탈이온수에 용해시키고, 다이아크릴레이트화 플루로닉 용액에 첨가하여 0.5 중량%의 다이아크릴레이트화 플루로닉을 제조하였다. 상기 bare 형에 이용되는 조건과 동일한 조건에서 상기 혼합물을 광-중합하여 시스테아민의 싸이올 그룹과 다이아크릴레이트화 플루로닉의 비닐기를 결합시켰다. 이 또한 미반응 물질들을 제거하기 위해, 전체 용액을 투석 주머니(cellulose ester, MWCO, 300 kDa)를 이용하여 투석 하되 처음은 0.1 M NaCl에서 투석하고, 이어 탈이온수에서 투석하였다.
실시예 2: 펩타이드 또는 펩타이드-키토산 개질 나노운반체의 제조
도 2에 기재된 방법에 따라 플루로닉 기반 나노운반체의 펩타이드 개질형(Pep-NC (PF 68)) 또는 펩타이드-키토산 개질형(Pep-Chi-NC (PF 68))을 제조하였다. 간략하게 설명하자면, 실시예 1에서 제조된 나노운반체(Amine-NC, Chi-NC, 1.6mg)에 헤테로바이펑셔널폴리에틸렌글라이콜(α-maleimide-ω-N-hydroxy-succinimide ester polyethylene glycol, MAL-PEG-NHS, Mw 2,100, 0.35mg)을 혼합하여 나노운반체의 아민 그룹과 폴리에틸렌글라이콜의 NHS그룹간의 반응을 유도하였다. 반응 후, 미반응 물질들을 투석 주머니(cellulose ester, MWCO, 300 kDa)를 이용하여 투석하였다. 다음으로 말레이미드 그룹이 개질된 나노운반체에 펩타이드 (AT-1002-Cyspeptide , sequence: FCIGRLGGGGGC, 0.25mg)를 단순 혼합하고, 나노운반체의 말레이미드 그룹과 펩타이드의 시스테인과의 반응을 유도하여 펩타이드가 치환된 나노운반체를 제조하였다. 마찬가지로, 반응 후, 미반응 물질들은 투석 주머니(cellulose ester, MWCO, 300 kDa)를 이용여 투석하였다. 그 이후, 나노운반체들의 크기 및 표면 전하를 레이저 다이오드 광(638 nm) 및 광전자 증폭 튜브 검출기(165ㅀ scattering angle)가 장착된 전기영동 광 산란 측정기(ELS-Z2, Otsuka Electronics Co., Japan)를 이용하여 분석하였다. 도 3 a, b에서 보는 바와 같이 두 가지의 리간드 또는 한 가지의 리간드로 개질 된 나노운반체의 크기와 표면전하가 bare 나노운반체와 비교해 보았을 때, 온도 감응성 특성은 그대로 유지되면서 표면만 개질된 것을 확인하였다. 키토산-개질 형의경우, 키토산 결합 양은 12 중량%이었고, 이는 Ninhydrin 분석을 이용하여 측정하였다. 펩타이드-개질 형의 경우, 펩타이드 결합 양은 8 중량%이었고, 이는 형광 분석을 이용하여 측정하였다.
실시예 3: 펩타이드-키토산 개질 나노운반체의 세포 단층막 투과도의 분석 (FITC-Insulin 이용)
상기 실시예에서 제조한 펩타이드-키토산 개질 나노운반체를 이용하여 모델 단백질인 FITC-Insulin(Fluorescein isothiocyanate-labelled insulin)을 담지시켰다. 펩타이드-키토산 개질 나노운반체 용액에 모델 단백질인 FITC-Insulin을 첨가하고, 4℃에서 12시간 동안 방치하면서, 모델 단백질이 자발적으로 팽창된 나노운반체 안으로 담지 되도록 하였다. 담지 되지 않은 모델 단백질들은 상온에서 스핀필터를 사용하여 제거하였다. 펩타이드-키토산 개질 나노운반체의 FITC-Insulin 포집 효율 및 함유 양은, 실온에서 14,000 rpm으로 10분 동안 스킨 여과한 다음 F. Q. Li, et al., Int. J. Pharm., 2008, 349, 274에 기재된 방법에 따라 계산 하였다.
FITC-Insulin-담지된 나노운반체의 장막 투과도는 우선 셀지스콥을 이용하여 각 나노운반체를 처리 후 장막의 TEER(Trans Epithelial Electrical Resistance) 변화율을 측정하였고, 모델 단백질의 투과율은 형광분석을 통하여 측정하였다. 실험군은 Only 펩타이드 (4mg, 250 ug) + FITC-Insulin (30ug), NC(F68, 1mg) + FITC-Insulin, Chi-NC(F68) + FITC-Insulin, Pep-NC(F68) + FITC-Insulin, Pep-Chi-NC(F68) + FITC-Insulin이다. 실험 조건은 다음과 같다: Trans-well(12 well)의 insert 부분에 caco-2 cell이 단층막의 형태가 되도록 3주간 배양 후, cellZscope에 옮겨 caco-2 cell의 초기 단층막의 TEER값을 측정한다. 그리고 1-6 groups in MEM media (750 μL, 10% FBS, 1% Abs, pH 6.5); Receptor part: MEM media (1.5 mL, 10% FBS, 1% Abs, pH 6.5); Time point: 24 hrs; Sampling: 750uL at given time. 형광 세기는 형광 스펙트로포토미터를 이용하여 측정하였고, 형광 이미지는 형광 현미경으로 얻었다.
도 4 a에서 확인할 수 있듯이, 본 발명의 펩타이드-키토산-개질 나노운반체는 각 리간드가 하나씩 컨쥬게이션 된 [Chi-NC(F 68), Pep-NC(F 68)] 또는 컨쥬게이션되지 않은 나노운반체 [NC(F68)] 와 비교하여 TEER 값이 확실하게 떨어졌다. 이는 펩타이드와 키토산의 시너지 효과에 의해 caco-2 세포의 밀착연접의 기능이 저해되기 때문이다. 또한, 도 4 b에서 확인 할 수 있듯이 펩타이드와 키토산으로 개질된 나노운반체는 다른 나노운반체에 비해 FITC-insulin의 우수한 세포 단층막 투과도를 나타내었다. 또한, 본 발명의 펩타이드-키토산-개질 나노운반체에 붙어있는 펩타이드 양과 동일한 양의 펩타이드만을 사용한 경우와 비교하여도 매우 우수한 장막 투과도를 나타내었다. 이는 나노운반체의 표면에 개질된 펩타이드가 펩타이드만을 사용한 경우에 비해 표면 밀도가 상대적으로 증가하여 펩타이드의 효력이 발휘되는 것이다. 도 5는 펩타이드-키토산-개질 나노운반체를 처리한 경우 Caco-2 cell의 밀착연접의 기능이 저해되고, 저해된 밀착면접을 모델 단백질이 나노운반체의 두 리간드 영향에 의해 투과 효율이 상승한다는 것을 간접적으로 보여주는 형광 이미지이다.
실시예 4. 펩타이드-키토산-개질 나노운반체를 이용한 당뇨 유발 생쥐 (in vivo)의 치료 효과
본 발명의 펩타이드-키토산-개질 나노운반체에 담지된 인슐린의 당뇨 유발 생쥐에 대한 치료효과에 대해 평가하였다. 실험군은 Only 인슐린 (5IU, 경피 투여), Only 인슐린 (75IU, 경구 투여), NC(F68) + 인슐린 (75IU, 경구 투여), Chi-NC(F68, 경구 투여) + 인슐린 (75IU, 경구 투여), Pep-NC(F68) + 인슐린 (75IU, 경구 투여), Pep-Chi-NC(F68) + 인슐린 (75IU, 경구 투여)이다.
실험 조건은 다음과 같다: 우선, 스트렙토조토신 (streptozotocin)을 생쥐의 복강에 투여한 후, 일주일 후 생쥐의 혈당을 측정한다. 이때 생쥐의 공복 혈당이 250mg/dL이상일 경우 당뇨가 유발되었다고 간주한다. 당뇨가 유발된 생쥐의 경피에 그룹 1을 인슐린 주사기를 사용하여, 그룹 2-6은 경구용 주사기를 사용하여 경구에 투여한다. Time point(1, 3, 6, 9, 12, and 24hr); Blood Sampling: 400uL at given time. 혈당은 혈당 측정기(SD Biosensor, Inc., Suwon, Korea)로, 혈중 인슐린 농도는 insulin ELISA kit (R&D Systems, Inc., Minneapolis, MN, USA)을 사용하여 얻었다. 도 6 a, b에서 확인 할 수 있듯이, only 인슐린은 경피 투여하였을 경우, 혈당은 3시간 만에 내려갔고, 혈중 인슐린 농도 역시 3시간 만에 최대치를 보였다. 하지만 실험 후 6시간 이내에 빠르게 원래의 상태로 회복되었다. 또한 only 인슐린과 인슐린이 담지된 bare 나노운반체를 경구로 투여하였을 경우, 혈당과 혈중 인슐린 농도 모두 효과가 없는 것을 확인 할 수 있었다. 한 가지의 리간드가 개질된 나노운반체(Chi-NC, Pep-NC)를 사용한 경우, 주입 9시간까지 혈당은 떨어지고, 혈중 인슐린 농도는 증가하였지만, 치료의 효과까지 감소하지 않았다. 하지만, 두 가지의 리간드가 개질된 나노운반체(Pep-Chi-NC)를 사용한 경우, 주입 12시간까지 인슐린의 효과에 의해 혈당인 치료 효과까지 감소하였으며, 혈중 인슐린 농도 역시 치료 임계 농도 이상으로 유지되었다. 이는 펩타이드-키토산-개질 나노운반체를 사용하여 인슐린을 경구 투여 하였을 경우, 나노운반체의 표면에 개질된 두 가지의 리간드 영향에 의해 보다 연장된 혈중 인슐린 농도 및 혈당을 유지하는 효과를 가지고 있음을 보여주는 것이다.
실시예 5. 펩타이드 -키토산-개질 나노운반체를 이용한 장막 투과 이미징
FITC 형광물질이 컨쥬게이션 된 인슐린이 담지된 Cy 5.5 형광물질이 컨쥬게이션 된 본 발명의 펩타이드-키토산-개질 나노운반체의 소장막에서의 생체 (in vivo) 편제율에 대한 영상을 확인하였다. 우선, 실시예 4에서의 실험군 2-6을 동일한 방법을 사용하여 당뇨가 유발된 생쥐에 주입하였다. 12시간 후, 생쥐의 소장을 적출하여 인슐린과 나노입자의 소장막 편제율을 형광 현미경을 사용하여 조사하였다. 도 7에서 확인할 수 있듯이, Only 인슐린과 bare 나노입자를 사용한 경우, 경구 투여 12시간이 지난 시점에서 소장막에 어떠한 인슐린이나 나노운반체가 존재하지 않음을 형광 이미징을 통해 확인하였다. 한 가지의 리간드만 개질된 나노운반체(Chi-NC, Pep-NC)의 경우, 12시간이 지난 시점에서 소장막에 인슐린과 나노운반체가 소량 존재하는 것을 형광 이미징을 통해 확인하였다. 하지만 두 가지의 리간드가 모두 개질된 나노운반체(Pep-Chi-NC)의 경우, 12시간이 지난 시점에서 소장막의 모든 부분에서 인슐린과 나노운반체가 다량 존재하는 것을 형광 이미징을 통해 확인 하였다. 24시간이 지난 시점에서는 인슐린과 나노운반체의 모든 형광 이미징이 존재하지 않는 것을 보아 인슐린과 나노운반체가 모든 부위의 소장막에서 빠져 나갔음을 확인 할 수 있었고, 이는 펩타이드-키토산-개질 나노운반체를 사용한 경우 12시간까지 소장막을 통해 인슐린이 혈류로 효과적으로 전달되면서 약효가 유지됨을 간접적으로 확인하였다.

Claims (13)

  1. (a) 플루로닉 고분자, (b) 상기 플루로닉 고분자와 제1 결합되어 있는 키토산, (c) 상기 키토산과 제2 결합되어 있는 링커, (d) 상기 링커와 제3 결합되어 있는 펩타이드를 포함하는 펩타이드-키토산 개질 나노입자로서;
    상기 플루로닉 고분자는 플루로닉 중합 가능 관능기를 2개 이상 포함하고, 상기 키토산은 키토산 관능기를 포함하며, 상기 제1 결합은 상기 플루로닉 중합 가능 관능기와 상기 키토산 관능기 사이의 결합이고;
    상기 링커는 양 말단이 각각 제1 링커 관능기 및 제2 링커 관능기이고, 상기 제2 결합은 상기 키토산의 아민기와 상기 제1 링커 관능기 사이의 결합이며;
    상기 제3 결합은 상기 제2 링커 관능기와 상기 펩타이드의 시스테인 사이의 결합인 것을 특징으로 하는 펩타이드-키토산 개질 나노입자.
  2. 제1항에 있어서, 상기 플루로닉 중합 가능 관능기는 아크릴기, 다이아크릴기, 올리고아크릴기, 메타아크릴기, 올리고메타아크릴기, 쿠마린기, 타이민기, 시나메이트기 중에서 선택되고,
    상기 키토산 관능기는 글리이실 메타아크릴기, 올리고 글리이실 메타아크릴기 중에서 선택되며,
    상기 제1 링커 관능기는 아민과 반응 가능한 관능기이고,
    상기 제2 링커 관능기는 싸이올과 반응 가능한 관능기인 것을 특징으로 하는 펩타이드-키토산 개질 나노입자.
  3. 제1항에 있어서, 상기 펩타이드는 밀착연접 개방성 펩타이드(tight junction opending peptide)인 것을 특징으로 하는 펩타이드-키토산 개질 나노입자.
  4. 제1항에 있어서, 상기 펩타이드는 ZOT 유래 펩타이드, Occludin 유래 펩타이드, Claudin-4 유래 펩타이드 중에 선택된 1종 이상인 것을 특징으로 하는 펩타이드-키토산 개질 나노입자.
  5. 제1항에 있어서, 상기 펩타이드는 하기 서열 중에서 선택된 1종 이상인 것을 특징으로 하는 펩타이드-키토산 개질 나노입자.
    [서열번호 1]
    YTWMPENPRPGTPCDIFTNSRGKRASNGGGGGGC
    [서열번호 2]
    FDFWITPGGGGGC
    [서열번호 3]
    CLYHYCGGGGGC
    [서열번호 4]
    SHAVSSGGGGGC
    [서열번호 5]
    ADTPPVGGGGGC
    [서열번호 6]
    FCIGRLGGGGGC
  6. 제1항에 있어서, 상기 제1 링커 관능기는 NHS이고, 상기 제2 링커 관능기는 MAL이며, 상기 링커는 MAL-PEG-NHS인 것을 특징으로 하는 펩타이드-키토산 개질 나노입자.
  7. (A) 제1항 내지 제6항 중 어느 한 항에 따른 나노입자 및 (B) 상기 나노입자 내부에 포함되어 있는 약물을 포함하는 약물 운반체.
  8. 제7항에 있어서, 상기 약물은 인슐린, 설포유닐리아계 약물, 메글리티나이드계 약물, 비구아나이드계 약물 중에서 선택된 1종 이상인 것을 특징으로 하는 약물 운반체.
  9. 제7항에 따른 약물 운반체를 포함하는 약학 조성물.
  10. 제7항에 있어서, 상기 약물은 인슐린, 설포유닐리아계 약물, 메글리티나이드계 약물, 비구아나이드계 약물 중에서 선택된 1종 이상인 것을 특징으로 하는 약학 조성물.
  11. 제10항에 있어서, 상기 약물 조성물은 경구 투여용인 것을 특징으로 하는 약학 조성물.
  12. (A) 제1항 내지 제6항 중 어느 한 항에 따른 나노입자 및 약물을 포함하는 용액을 수득하는 단계를 포함하는 약물 운반체 제조방법.
  13. 제12항에 있어서, 상기 (A) 단계 후에 (B) 담지 되지 않은 약물을 제거하는 단계를 포함하는 것을 특징으로 하는 약물 운반체 제조방법.
KR1020160071237A 2016-06-08 2016-06-08 펩타이드-키토산 개질 나노입자 및 이를 포함하는 약물 전달체 KR101924519B1 (ko)

Priority Applications (1)

Application Number Priority Date Filing Date Title
KR1020160071237A KR101924519B1 (ko) 2016-06-08 2016-06-08 펩타이드-키토산 개질 나노입자 및 이를 포함하는 약물 전달체

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
KR1020160071237A KR101924519B1 (ko) 2016-06-08 2016-06-08 펩타이드-키토산 개질 나노입자 및 이를 포함하는 약물 전달체

Publications (2)

Publication Number Publication Date
KR20170138861A true KR20170138861A (ko) 2017-12-18
KR101924519B1 KR101924519B1 (ko) 2018-12-04

Family

ID=60923101

Family Applications (1)

Application Number Title Priority Date Filing Date
KR1020160071237A KR101924519B1 (ko) 2016-06-08 2016-06-08 펩타이드-키토산 개질 나노입자 및 이를 포함하는 약물 전달체

Country Status (1)

Country Link
KR (1) KR101924519B1 (ko)

Cited By (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20180091768A (ko) 2017-02-06 2018-08-16 주식회사 레모넥스 생리활성물질 전달체
KR20190011701A (ko) 2017-07-25 2019-02-07 주식회사 레모넥스 혈관 내 생리활성물질 전달용 조성물
KR20190095088A (ko) 2018-10-19 2019-08-14 주식회사 레모넥스 생리활성물질 전달체
KR20190121614A (ko) * 2018-04-18 2019-10-28 순천대학교 산학협력단 암포테리신 b를 포함하는 약물 전달용 나노입자 및 이를 포함하는 항균용 조성물
KR20200016783A (ko) 2018-08-06 2020-02-17 주식회사 레모넥스 면역반응 물질 전달체
KR20200043944A (ko) 2018-10-19 2020-04-28 주식회사 레모넥스 생리활성물질 전달체
WO2020091535A1 (ko) * 2018-11-02 2020-05-07 순천향대학교 산학협력단 점막 투과 촉진용 펩타이드 및 이를 포함하는 조성물

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP6426288B2 (ja) 2014-07-22 2018-11-21 レモネックス インコーポレイテッドLemonex Inc. 生理活性物質又はタンパク質伝達用組成物及びその用途
US11530132B2 (en) 2017-09-05 2022-12-20 Lemonex Inc. Composition comprising porous silica particles carrying a cell fate modulating factor

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20140014579A (ko) * 2012-07-25 2014-02-06 광주과학기술원 뇌조직에 특이적으로 전달 가능한 뇌조직 표적화 펩티드와 키토산이 결합된 플루로닉 고분자를 포함하는 뇌표적 나노전달체

Patent Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20140014579A (ko) * 2012-07-25 2014-02-06 광주과학기술원 뇌조직에 특이적으로 전달 가능한 뇌조직 표적화 펩티드와 키토산이 결합된 플루로닉 고분자를 포함하는 뇌표적 나노전달체

Non-Patent Citations (3)

* Cited by examiner, † Cited by third party
Title
Biomaterials, 34, 1170-1178, 2013. *
논문1: Biomaterials *
논문2: Journal of Controlled Release *

Cited By (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20180091768A (ko) 2017-02-06 2018-08-16 주식회사 레모넥스 생리활성물질 전달체
KR20190011701A (ko) 2017-07-25 2019-02-07 주식회사 레모넥스 혈관 내 생리활성물질 전달용 조성물
KR20200085246A (ko) 2017-07-25 2020-07-14 주식회사 레모넥스 혈관 내 생리활성물질 전달용 조성물
KR20200086238A (ko) 2017-07-25 2020-07-16 주식회사 레모넥스 혈관 내 생리활성물질 전달용 조성물
KR20190121614A (ko) * 2018-04-18 2019-10-28 순천대학교 산학협력단 암포테리신 b를 포함하는 약물 전달용 나노입자 및 이를 포함하는 항균용 조성물
KR20200016783A (ko) 2018-08-06 2020-02-17 주식회사 레모넥스 면역반응 물질 전달체
KR20190095088A (ko) 2018-10-19 2019-08-14 주식회사 레모넥스 생리활성물질 전달체
KR20200043944A (ko) 2018-10-19 2020-04-28 주식회사 레모넥스 생리활성물질 전달체
WO2020091535A1 (ko) * 2018-11-02 2020-05-07 순천향대학교 산학협력단 점막 투과 촉진용 펩타이드 및 이를 포함하는 조성물
US12029804B2 (en) 2018-11-02 2024-07-09 Soonchunhyang University Industry Academy Cooperation Foundation Peptide for promoting mucous membrane permeation and composition containing same

Also Published As

Publication number Publication date
KR101924519B1 (ko) 2018-12-04

Similar Documents

Publication Publication Date Title
KR101924519B1 (ko) 펩타이드-키토산 개질 나노입자 및 이를 포함하는 약물 전달체
Lee et al. ZOT-derived peptide and chitosan functionalized nanocarrier for oral delivery of protein drug
Chen et al. Recent advances in chitosan-based nanoparticles for oral delivery of macromolecules
Wang et al. Mechanism of surface charge triggered intestinal epithelial tight junction opening upon chitosan nanoparticles for insulin oral delivery
Liu et al. Efficient mucus permeation and tight junction opening by dissociable “mucus-inert” agent coated trimethyl chitosan nanoparticles for oral insulin delivery
Davis The first targeted delivery of siRNA in humans via a self-assembling, cyclodextrin polymer-based nanoparticle: from concept to clinic
Xu et al. Smart and hyper-fast responsive polyprodrug nanoplatform for targeted cancer therapy
Xu et al. Bio-inspired supramolecular hybrid dendrimers self-assembled from low-generation peptide dendrons for highly efficient gene delivery and biological tracking
Verma et al. Vitamin B12 functionalized layer by layer calcium phosphate nanoparticles: A mucoadhesive and pH responsive carrier for improved oral delivery of insulin
Makhlof et al. Design and evaluation of novel pH-sensitive chitosan nanoparticles for oral insulin delivery
Hu et al. Cyclodextrin-based host–guest supramolecular nanoparticles for delivery: from design to applications
An et al. A sulfur dioxide polymer prodrug showing combined effect with doxorubicin in combating subcutaneous and metastatic melanoma
Li et al. Smart asymmetric vesicles with triggered availability of inner cell-penetrating shells for specific intracellular drug delivery
Yu et al. Recent advances in dendrimer research for cardiovascular diseases
BRPI0608635A2 (pt) nanopartÍculas de quitosana e polietilenoglicol como sistema de administraÇço de molÉculas biologicamente ativas
Clemente et al. Immunotherapy of experimental melanoma with ICOS-Fc loaded in biocompatible and biodegradable nanoparticles
Gao et al. Novel monodisperse PEGtide dendrons: design, fabrication, and evaluation of mannose receptor-mediated macrophage targeting
Hsieh et al. Oral gene delivery with cyclo-(D-Trp-Tyr) peptide nanotubes
Kozlu et al. An aquaporin 4 antisense oligonucleotide loaded, brain targeted nanoparticulate system design
Kulkarni et al. Peptide-chitosan engineered scaffolds for biomedical applications
Liu et al. Advances of cyclodextrin polymers for the delivery of biotech drugs
CN103110954A (zh) 胆固醇修饰的生物可降解聚阳离子载体及制备方法和用途
Qin et al. An innovative pre-targeting strategy for tumor cell specific imaging and therapy
KR20080095130A (ko) ｐＨ 민감성 블록공중합체를 이용한 약물전달체 제조 및응용
US20210093729A1 (en) Preparation and application of surface double modified human serum albumin as targeting nano drug carrier

Legal Events

Date Code Title Description
A201 Request for examination
E902 Notification of reason for refusal
E701 Decision to grant or registration of patent right
GRNT Written decision to grant