KR20090027219A - Nac 전사인자의 발현 조절로 향상된 수확량 관련 형질을갖는 식물 및 이의 제조 방법 - Google Patents
Nac 전사인자의 발현 조절로 향상된 수확량 관련 형질을갖는 식물 및 이의 제조 방법 Download PDFInfo
- Publication number
- KR20090027219A KR20090027219A KR1020087031365A KR20087031365A KR20090027219A KR 20090027219 A KR20090027219 A KR 20090027219A KR 1020087031365 A KR1020087031365 A KR 1020087031365A KR 20087031365 A KR20087031365 A KR 20087031365A KR 20090027219 A KR20090027219 A KR 20090027219A
- Authority
- KR
- South Korea
- Prior art keywords
- seq
- plant
- nucleic acid
- motif
- sequence
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Granted
Links
- 230000014509 gene expression Effects 0.000 title claims abstract description 231
- 108091023040 Transcription factor Proteins 0.000 title claims abstract description 131
- 102000040945 Transcription factor Human genes 0.000 title claims abstract description 131
- 230000001976 improved effect Effects 0.000 title claims abstract description 35
- 238000000034 method Methods 0.000 title claims description 344
- 230000001105 regulatory effect Effects 0.000 title claims description 47
- 238000002360 preparation method Methods 0.000 title description 2
- 150000007523 nucleic acids Chemical class 0.000 claims abstract description 514
- 102000039446 nucleic acids Human genes 0.000 claims abstract description 438
- 108020004707 nucleic acids Proteins 0.000 claims abstract description 438
- 125000003275 alpha amino acid group Chemical group 0.000 claims abstract description 137
- 241000196324 Embryophyta Species 0.000 claims description 732
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 243
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 240
- 229920001184 polypeptide Polymers 0.000 claims description 233
- 230000001965 increasing effect Effects 0.000 claims description 224
- 235000007164 Oryza sativa Nutrition 0.000 claims description 122
- 240000007594 Oryza sativa Species 0.000 claims description 119
- 230000009261 transgenic effect Effects 0.000 claims description 87
- 235000009566 rice Nutrition 0.000 claims description 86
- 108091028043 Nucleic acid sequence Proteins 0.000 claims description 55
- 230000009466 transformation Effects 0.000 claims description 44
- 101150104463 GOS2 gene Proteins 0.000 claims description 42
- 230000002708 enhancing effect Effects 0.000 claims description 34
- 101100132476 Oryza sativa subsp. japonica NAC068 gene Proteins 0.000 claims description 30
- 150000001413 amino acids Chemical class 0.000 claims description 26
- 230000036579 abiotic stress Effects 0.000 claims description 24
- 235000013339 cereals Nutrition 0.000 claims description 22
- 240000008042 Zea mays Species 0.000 claims description 21
- 230000004568 DNA-binding Effects 0.000 claims description 20
- 238000004519 manufacturing process Methods 0.000 claims description 20
- 238000011161 development Methods 0.000 claims description 19
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 claims description 18
- 235000002017 Zea mays subsp mays Nutrition 0.000 claims description 18
- 235000021307 Triticum Nutrition 0.000 claims description 17
- 244000075850 Avena orientalis Species 0.000 claims description 13
- 241000209094 Oryza Species 0.000 claims description 13
- 244000062793 Sorghum vulgare Species 0.000 claims description 12
- 230000001276 controlling effect Effects 0.000 claims description 12
- 241000209140 Triticum Species 0.000 claims description 11
- 235000005824 Zea mays ssp. parviglumis Nutrition 0.000 claims description 11
- 230000000295 complement effect Effects 0.000 claims description 11
- 235000005822 corn Nutrition 0.000 claims description 11
- 235000007319 Avena orientalis Nutrition 0.000 claims description 10
- 235000007238 Secale cereale Nutrition 0.000 claims description 10
- 230000004913 activation Effects 0.000 claims description 10
- 230000008635 plant growth Effects 0.000 claims description 10
- 240000005979 Hordeum vulgare Species 0.000 claims description 9
- 235000007340 Hordeum vulgare Nutrition 0.000 claims description 9
- 238000006243 chemical reaction Methods 0.000 claims description 9
- 238000002744 homologous recombination Methods 0.000 claims description 9
- 230000006801 homologous recombination Effects 0.000 claims description 9
- 235000011684 Sorghum saccharatum Nutrition 0.000 claims description 8
- 230000005030 transcription termination Effects 0.000 claims description 8
- 244000038559 crop plants Species 0.000 claims description 7
- 230000008121 plant development Effects 0.000 claims description 7
- 238000012258 culturing Methods 0.000 claims description 6
- 235000019713 millet Nutrition 0.000 claims description 6
- 241000209504 Poaceae Species 0.000 claims description 4
- 244000082988 Secale cereale Species 0.000 claims description 4
- 235000003805 Musa ABB Group Nutrition 0.000 claims 3
- 235000015266 Plantago major Nutrition 0.000 claims 3
- 240000006394 Sorghum bicolor Species 0.000 claims 3
- 238000012225 targeting induced local lesions in genomes Methods 0.000 claims 2
- 238000000844 transformation Methods 0.000 claims 1
- 238000010276 construction Methods 0.000 abstract description 9
- 108090000623 proteins and genes Proteins 0.000 description 294
- 210000004027 cell Anatomy 0.000 description 89
- 102000004169 proteins and genes Human genes 0.000 description 82
- 235000018102 proteins Nutrition 0.000 description 77
- 230000035882 stress Effects 0.000 description 70
- 239000013598 vector Substances 0.000 description 60
- 238000009396 hybridization Methods 0.000 description 56
- 230000012010 growth Effects 0.000 description 52
- 210000001519 tissue Anatomy 0.000 description 43
- 230000000694 effects Effects 0.000 description 42
- 239000003550 marker Substances 0.000 description 40
- 241000219194 Arabidopsis Species 0.000 description 39
- 108020004414 DNA Proteins 0.000 description 38
- 241000272525 Anas platyrhynchos Species 0.000 description 33
- 125000003729 nucleotide group Chemical group 0.000 description 30
- 238000013507 mapping Methods 0.000 description 29
- 239000002773 nucleotide Substances 0.000 description 29
- 241000219195 Arabidopsis thaliana Species 0.000 description 25
- 230000035897 transcription Effects 0.000 description 24
- 238000013518 transcription Methods 0.000 description 24
- 230000001488 breeding effect Effects 0.000 description 22
- 238000006467 substitution reaction Methods 0.000 description 22
- 108700019146 Transgenes Proteins 0.000 description 20
- 230000002068 genetic effect Effects 0.000 description 20
- 239000000523 sample Substances 0.000 description 20
- 244000098338 Triticum aestivum Species 0.000 description 19
- 239000002299 complementary DNA Substances 0.000 description 17
- 238000002703 mutagenesis Methods 0.000 description 16
- 231100000350 mutagenesis Toxicity 0.000 description 16
- 210000000056 organ Anatomy 0.000 description 16
- 235000010469 Glycine max Nutrition 0.000 description 15
- 244000068988 Glycine max Species 0.000 description 15
- 241000219146 Gossypium Species 0.000 description 15
- 238000009395 breeding Methods 0.000 description 15
- 238000012217 deletion Methods 0.000 description 15
- 230000037430 deletion Effects 0.000 description 15
- 230000018109 developmental process Effects 0.000 description 15
- 238000003306 harvesting Methods 0.000 description 15
- 235000015097 nutrients Nutrition 0.000 description 15
- 150000003839 salts Chemical class 0.000 description 15
- 238000012360 testing method Methods 0.000 description 15
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 14
- 239000002028 Biomass Substances 0.000 description 14
- ZHNUHDYFZUAESO-UHFFFAOYSA-N Formamide Chemical compound NC=O ZHNUHDYFZUAESO-UHFFFAOYSA-N 0.000 description 14
- 230000008569 process Effects 0.000 description 14
- 238000001134 F-test Methods 0.000 description 13
- 235000007688 Lycopersicon esculentum Nutrition 0.000 description 13
- 240000003768 Solanum lycopersicum Species 0.000 description 13
- 230000004071 biological effect Effects 0.000 description 13
- 230000036542 oxidative stress Effects 0.000 description 13
- 241000589158 Agrobacterium Species 0.000 description 12
- 235000009438 Gossypium Nutrition 0.000 description 12
- 238000000692 Student's t-test Methods 0.000 description 12
- 238000012353 t test Methods 0.000 description 12
- 235000004977 Brassica sinapistrum Nutrition 0.000 description 11
- 108091026890 Coding region Proteins 0.000 description 11
- 238000003780 insertion Methods 0.000 description 11
- 230000037431 insertion Effects 0.000 description 11
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 10
- 235000002595 Solanum tuberosum Nutrition 0.000 description 10
- 244000061456 Solanum tuberosum Species 0.000 description 10
- 210000004899 c-terminal region Anatomy 0.000 description 10
- 238000009826 distribution Methods 0.000 description 10
- 230000008641 drought stress Effects 0.000 description 10
- 238000002509 fluorescent in situ hybridization Methods 0.000 description 10
- 238000009331 sowing Methods 0.000 description 10
- 240000004160 Capsicum annuum Species 0.000 description 9
- 238000004458 analytical method Methods 0.000 description 9
- 230000000875 corresponding effect Effects 0.000 description 9
- 239000003623 enhancer Substances 0.000 description 9
- 235000019688 fish Nutrition 0.000 description 9
- 230000008723 osmotic stress Effects 0.000 description 9
- 230000002829 reductive effect Effects 0.000 description 9
- 238000011144 upstream manufacturing Methods 0.000 description 9
- 240000002791 Brassica napus Species 0.000 description 8
- XEEYBQQBJWHFJM-UHFFFAOYSA-N Iron Chemical compound [Fe] XEEYBQQBJWHFJM-UHFFFAOYSA-N 0.000 description 8
- 101150094405 NAC23 gene Proteins 0.000 description 8
- 102000004316 Oxidoreductases Human genes 0.000 description 8
- 108090000854 Oxidoreductases Proteins 0.000 description 8
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 8
- 238000011156 evaluation Methods 0.000 description 8
- 108020004999 messenger RNA Proteins 0.000 description 8
- 230000010076 replication Effects 0.000 description 8
- 230000002103 transcriptional effect Effects 0.000 description 8
- 230000014616 translation Effects 0.000 description 8
- 101100132466 Arabidopsis thaliana NAC055 gene Proteins 0.000 description 7
- 101100132468 Arabidopsis thaliana NAC59 gene Proteins 0.000 description 7
- 101100079135 Arabidopsis thaliana NAC92 gene Proteins 0.000 description 7
- 101100132479 Glycine max NAC6 gene Proteins 0.000 description 7
- 235000003222 Helianthus annuus Nutrition 0.000 description 7
- 101000958664 Homo sapiens Nucleus accumbens-associated protein 1 Proteins 0.000 description 7
- 101100420812 Homo sapiens SCN3A gene Proteins 0.000 description 7
- 101000631760 Homo sapiens Sodium channel protein type 1 subunit alpha Proteins 0.000 description 7
- 108091092195 Intron Proteins 0.000 description 7
- 101100186127 Oryza sativa subsp. japonica NAC048 gene Proteins 0.000 description 7
- 101100132474 Oryza sativa subsp. japonica NAC067 gene Proteins 0.000 description 7
- 101100079121 Oryza sativa subsp. japonica NAC076 gene Proteins 0.000 description 7
- 108700001094 Plant Genes Proteins 0.000 description 7
- 108700008625 Reporter Genes Proteins 0.000 description 7
- 102100028910 Sodium channel protein type 1 subunit alpha Human genes 0.000 description 7
- 102100023720 Sodium channel protein type 3 subunit alpha Human genes 0.000 description 7
- 235000016383 Zea mays subsp huehuetenangensis Nutrition 0.000 description 7
- 230000003321 amplification Effects 0.000 description 7
- 230000033228 biological regulation Effects 0.000 description 7
- 238000004422 calculation algorithm Methods 0.000 description 7
- 230000007613 environmental effect Effects 0.000 description 7
- 235000009973 maize Nutrition 0.000 description 7
- 229910052757 nitrogen Inorganic materials 0.000 description 7
- 238000003199 nucleic acid amplification method Methods 0.000 description 7
- 230000002018 overexpression Effects 0.000 description 7
- 230000006798 recombination Effects 0.000 description 7
- 238000005215 recombination Methods 0.000 description 7
- 238000011160 research Methods 0.000 description 7
- 239000000243 solution Substances 0.000 description 7
- 108700028369 Alleles Proteins 0.000 description 6
- 235000011331 Brassica Nutrition 0.000 description 6
- 241000219198 Brassica Species 0.000 description 6
- 235000014698 Brassica juncea var multisecta Nutrition 0.000 description 6
- 235000006008 Brassica napus var napus Nutrition 0.000 description 6
- 240000000385 Brassica napus var. napus Species 0.000 description 6
- 235000006618 Brassica rapa subsp oleifera Nutrition 0.000 description 6
- 108020004635 Complementary DNA Proteins 0.000 description 6
- 241000219823 Medicago Species 0.000 description 6
- 235000017587 Medicago sativa ssp. sativa Nutrition 0.000 description 6
- 108020004711 Nucleic Acid Probes Proteins 0.000 description 6
- 241000209056 Secale Species 0.000 description 6
- 238000002105 Southern blotting Methods 0.000 description 6
- 125000000539 amino acid group Chemical group 0.000 description 6
- 235000013399 edible fruits Nutrition 0.000 description 6
- 230000006353 environmental stress Effects 0.000 description 6
- 239000013604 expression vector Substances 0.000 description 6
- 239000000463 material Substances 0.000 description 6
- 239000000203 mixture Substances 0.000 description 6
- 239000002853 nucleic acid probe Substances 0.000 description 6
- 230000000644 propagated effect Effects 0.000 description 6
- 230000004044 response Effects 0.000 description 6
- 238000007894 restriction fragment length polymorphism technique Methods 0.000 description 6
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 5
- 235000002567 Capsicum annuum Nutrition 0.000 description 5
- 108091061403 ERF family Proteins 0.000 description 5
- 241000208818 Helianthus Species 0.000 description 5
- UPYKUZBSLRQECL-UKMVMLAPSA-N Lycopene Natural products CC(=C/C=C/C=C(C)/C=C/C=C(C)/C=C/C1C(=C)CCCC1(C)C)C=CC=C(/C)C=CC2C(=C)CCCC2(C)C UPYKUZBSLRQECL-UKMVMLAPSA-N 0.000 description 5
- JEVVKJMRZMXFBT-XWDZUXABSA-N Lycophyll Natural products OC/C(=C/CC/C(=C\C=C\C(=C/C=C/C(=C\C=C\C=C(/C=C/C=C(\C=C\C=C(/CC/C=C(/CO)\C)\C)/C)\C)/C)\C)/C)/C JEVVKJMRZMXFBT-XWDZUXABSA-N 0.000 description 5
- 240000004658 Medicago sativa Species 0.000 description 5
- 229910019142 PO4 Inorganic materials 0.000 description 5
- 108010076504 Protein Sorting Signals Proteins 0.000 description 5
- 230000002411 adverse Effects 0.000 description 5
- 238000005899 aromatization reaction Methods 0.000 description 5
- 239000011575 calcium Substances 0.000 description 5
- 229910052791 calcium Inorganic materials 0.000 description 5
- 230000008859 change Effects 0.000 description 5
- 238000001514 detection method Methods 0.000 description 5
- 239000004459 forage Substances 0.000 description 5
- 239000012634 fragment Substances 0.000 description 5
- 238000001727 in vivo Methods 0.000 description 5
- 238000011065 in-situ storage Methods 0.000 description 5
- 238000002955 isolation Methods 0.000 description 5
- OAIJSZIZWZSQBC-GYZMGTAESA-N lycopene Chemical compound CC(C)=CCC\C(C)=C\C=C\C(\C)=C\C=C\C(\C)=C\C=C\C=C(/C)\C=C\C=C(/C)\C=C\C=C(/C)CCC=C(C)C OAIJSZIZWZSQBC-GYZMGTAESA-N 0.000 description 5
- 235000012661 lycopene Nutrition 0.000 description 5
- 239000001751 lycopene Substances 0.000 description 5
- 229960004999 lycopene Drugs 0.000 description 5
- 239000011159 matrix material Substances 0.000 description 5
- 239000003921 oil Substances 0.000 description 5
- 230000037361 pathway Effects 0.000 description 5
- 235000021317 phosphate Nutrition 0.000 description 5
- 102000054765 polymorphisms of proteins Human genes 0.000 description 5
- 102000040430 polynucleotide Human genes 0.000 description 5
- 108091033319 polynucleotide Proteins 0.000 description 5
- 239000002157 polynucleotide Substances 0.000 description 5
- 235000012015 potatoes Nutrition 0.000 description 5
- 238000012545 processing Methods 0.000 description 5
- 230000009467 reduction Effects 0.000 description 5
- 102000037983 regulatory factors Human genes 0.000 description 5
- 108091008025 regulatory factors Proteins 0.000 description 5
- 108091008146 restriction endonucleases Proteins 0.000 description 5
- 239000000126 substance Substances 0.000 description 5
- ZCIHMQAPACOQHT-ZGMPDRQDSA-N trans-isorenieratene Natural products CC(=C/C=C/C=C(C)/C=C/C=C(C)/C=C/c1c(C)ccc(C)c1C)C=CC=C(/C)C=Cc2c(C)ccc(C)c2C ZCIHMQAPACOQHT-ZGMPDRQDSA-N 0.000 description 5
- 238000013519 translation Methods 0.000 description 5
- ZOXJGFHDIHLPTG-UHFFFAOYSA-N Boron Chemical compound [B] ZOXJGFHDIHLPTG-UHFFFAOYSA-N 0.000 description 4
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 4
- 241000209510 Liliopsida Species 0.000 description 4
- FYYHWMGAXLPEAU-UHFFFAOYSA-N Magnesium Chemical compound [Mg] FYYHWMGAXLPEAU-UHFFFAOYSA-N 0.000 description 4
- 240000003183 Manihot esculenta Species 0.000 description 4
- 235000010624 Medicago sativa Nutrition 0.000 description 4
- 241000219828 Medicago truncatula Species 0.000 description 4
- 235000002637 Nicotiana tabacum Nutrition 0.000 description 4
- 244000061176 Nicotiana tabacum Species 0.000 description 4
- 108700026244 Open Reading Frames Proteins 0.000 description 4
- 101001000015 Oryza sativa subsp. japonica NAC domain-containing protein 67 Proteins 0.000 description 4
- 101001128385 Oryza sativa subsp. japonica NAC domain-containing protein 76 Proteins 0.000 description 4
- 235000010627 Phaseolus vulgaris Nutrition 0.000 description 4
- 244000046052 Phaseolus vulgaris Species 0.000 description 4
- OAICVXFJPJFONN-UHFFFAOYSA-N Phosphorus Chemical compound [P] OAICVXFJPJFONN-UHFFFAOYSA-N 0.000 description 4
- ZLMJMSJWJFRBEC-UHFFFAOYSA-N Potassium Chemical compound [K] ZLMJMSJWJFRBEC-UHFFFAOYSA-N 0.000 description 4
- 241000220324 Pyrus Species 0.000 description 4
- 240000001987 Pyrus communis Species 0.000 description 4
- 235000014443 Pyrus communis Nutrition 0.000 description 4
- -1 Tag-100 epitope Proteins 0.000 description 4
- 241000700605 Viruses Species 0.000 description 4
- 238000007792 addition Methods 0.000 description 4
- 229910052796 boron Inorganic materials 0.000 description 4
- 229910052793 cadmium Inorganic materials 0.000 description 4
- BDOSMKKIYDKNTQ-UHFFFAOYSA-N cadmium atom Chemical compound [Cd] BDOSMKKIYDKNTQ-UHFFFAOYSA-N 0.000 description 4
- 239000001511 capsicum annuum Substances 0.000 description 4
- 239000001390 capsicum minimum Substances 0.000 description 4
- 239000003795 chemical substances by application Substances 0.000 description 4
- 150000001875 compounds Chemical class 0.000 description 4
- 238000004925 denaturation Methods 0.000 description 4
- 230000036425 denaturation Effects 0.000 description 4
- 230000029087 digestion Effects 0.000 description 4
- 238000011049 filling Methods 0.000 description 4
- 235000013305 food Nutrition 0.000 description 4
- 230000004927 fusion Effects 0.000 description 4
- 230000035784 germination Effects 0.000 description 4
- 230000001939 inductive effect Effects 0.000 description 4
- 230000003834 intracellular effect Effects 0.000 description 4
- 229910052742 iron Inorganic materials 0.000 description 4
- 239000011777 magnesium Substances 0.000 description 4
- 229910052749 magnesium Inorganic materials 0.000 description 4
- WPBNNNQJVZRUHP-UHFFFAOYSA-L manganese(2+);methyl n-[[2-(methoxycarbonylcarbamothioylamino)phenyl]carbamothioyl]carbamate;n-[2-(sulfidocarbothioylamino)ethyl]carbamodithioate Chemical compound [Mn+2].[S-]C(=S)NCCNC([S-])=S.COC(=O)NC(=S)NC1=CC=CC=C1NC(=S)NC(=O)OC WPBNNNQJVZRUHP-UHFFFAOYSA-L 0.000 description 4
- 230000002503 metabolic effect Effects 0.000 description 4
- 238000010369 molecular cloning Methods 0.000 description 4
- 230000035772 mutation Effects 0.000 description 4
- 235000019198 oils Nutrition 0.000 description 4
- 244000052769 pathogen Species 0.000 description 4
- 239000011574 phosphorus Substances 0.000 description 4
- 229910052698 phosphorus Inorganic materials 0.000 description 4
- 239000013612 plasmid Substances 0.000 description 4
- 210000002706 plastid Anatomy 0.000 description 4
- 239000011591 potassium Substances 0.000 description 4
- 229910052700 potassium Inorganic materials 0.000 description 4
- 239000000843 powder Substances 0.000 description 4
- 230000008929 regeneration Effects 0.000 description 4
- 238000011069 regeneration method Methods 0.000 description 4
- 230000000717 retained effect Effects 0.000 description 4
- 239000011780 sodium chloride Substances 0.000 description 4
- 239000002689 soil Substances 0.000 description 4
- 241000894007 species Species 0.000 description 4
- 108020005345 3' Untranslated Regions Proteins 0.000 description 3
- 108020003589 5' Untranslated Regions Proteins 0.000 description 3
- 229920001817 Agar Polymers 0.000 description 3
- 241000234282 Allium Species 0.000 description 3
- 235000005340 Asparagus officinalis Nutrition 0.000 description 3
- 235000005781 Avena Nutrition 0.000 description 3
- 241000894006 Bacteria Species 0.000 description 3
- 102100026189 Beta-galactosidase Human genes 0.000 description 3
- 235000011293 Brassica napus Nutrition 0.000 description 3
- 235000002566 Capsicum Nutrition 0.000 description 3
- 244000037364 Cinnamomum aromaticum Species 0.000 description 3
- 235000014489 Cinnamomum aromaticum Nutrition 0.000 description 3
- 229920000742 Cotton Polymers 0.000 description 3
- 244000127993 Elaeis melanococca Species 0.000 description 3
- 229910052693 Europium Inorganic materials 0.000 description 3
- 241000220223 Fragaria Species 0.000 description 3
- 241000233866 Fungi Species 0.000 description 3
- 102000053187 Glucuronidase Human genes 0.000 description 3
- 108010060309 Glucuronidase Proteins 0.000 description 3
- 244000299507 Gossypium hirsutum Species 0.000 description 3
- 235000009432 Gossypium hirsutum Nutrition 0.000 description 3
- 102000002812 Heat-Shock Proteins Human genes 0.000 description 3
- 108010004889 Heat-Shock Proteins Proteins 0.000 description 3
- 244000020551 Helianthus annuus Species 0.000 description 3
- 206010020649 Hyperkeratosis Diseases 0.000 description 3
- 241001465754 Metazoa Species 0.000 description 3
- 101710111451 NAC domain-containing protein 23 Proteins 0.000 description 3
- 108091034117 Oligonucleotide Proteins 0.000 description 3
- 102000015636 Oligopeptides Human genes 0.000 description 3
- 108010038807 Oligopeptides Proteins 0.000 description 3
- 101001000024 Oryza sativa subsp. japonica NAC domain-containing protein 68 Proteins 0.000 description 3
- 240000007377 Petunia x hybrida Species 0.000 description 3
- 108010029485 Protein Isoforms Proteins 0.000 description 3
- 102000001708 Protein Isoforms Human genes 0.000 description 3
- 108010003581 Ribulose-bisphosphate carboxylase Proteins 0.000 description 3
- 240000000111 Saccharum officinarum Species 0.000 description 3
- 235000007201 Saccharum officinarum Nutrition 0.000 description 3
- 235000002634 Solanum Nutrition 0.000 description 3
- 241000207763 Solanum Species 0.000 description 3
- 229920002472 Starch Polymers 0.000 description 3
- 101710172711 Structural protein Proteins 0.000 description 3
- 244000269722 Thea sinensis Species 0.000 description 3
- 235000014787 Vitis vinifera Nutrition 0.000 description 3
- 240000006365 Vitis vinifera Species 0.000 description 3
- 238000009825 accumulation Methods 0.000 description 3
- 230000006978 adaptation Effects 0.000 description 3
- 239000008272 agar Substances 0.000 description 3
- 244000193174 agave Species 0.000 description 3
- 239000003963 antioxidant agent Substances 0.000 description 3
- 230000001580 bacterial effect Effects 0.000 description 3
- 108010005774 beta-Galactosidase Proteins 0.000 description 3
- 238000004364 calculation method Methods 0.000 description 3
- 230000036755 cellular response Effects 0.000 description 3
- 230000005754 cellular signaling Effects 0.000 description 3
- 231100000045 chemical toxicity Toxicity 0.000 description 3
- 210000003763 chloroplast Anatomy 0.000 description 3
- 210000000349 chromosome Anatomy 0.000 description 3
- 238000003776 cleavage reaction Methods 0.000 description 3
- 238000010367 cloning Methods 0.000 description 3
- 238000004590 computer program Methods 0.000 description 3
- 230000007423 decrease Effects 0.000 description 3
- 230000001419 dependent effect Effects 0.000 description 3
- 235000014113 dietary fatty acids Nutrition 0.000 description 3
- 238000005516 engineering process Methods 0.000 description 3
- OGPBJKLSAFTDLK-UHFFFAOYSA-N europium atom Chemical compound [Eu] OGPBJKLSAFTDLK-UHFFFAOYSA-N 0.000 description 3
- 239000003925 fat Substances 0.000 description 3
- 235000019197 fats Nutrition 0.000 description 3
- 229930195729 fatty acid Natural products 0.000 description 3
- 239000000194 fatty acid Substances 0.000 description 3
- 150000004665 fatty acids Chemical class 0.000 description 3
- 230000008014 freezing Effects 0.000 description 3
- 238000007710 freezing Methods 0.000 description 3
- 230000006870 function Effects 0.000 description 3
- 230000005714 functional activity Effects 0.000 description 3
- BRZYSWJRSDMWLG-CAXSIQPQSA-N geneticin Chemical compound O1C[C@@](O)(C)[C@H](NC)[C@@H](O)[C@H]1O[C@@H]1[C@@H](O)[C@H](O[C@@H]2[C@@H]([C@@H](O)[C@H](O)[C@@H](C(C)O)O2)N)[C@@H](N)C[C@H]1N BRZYSWJRSDMWLG-CAXSIQPQSA-N 0.000 description 3
- 238000011331 genomic analysis Methods 0.000 description 3
- 239000004009 herbicide Substances 0.000 description 3
- 230000013632 homeostatic process Effects 0.000 description 3
- 238000010348 incorporation Methods 0.000 description 3
- 208000015181 infectious disease Diseases 0.000 description 3
- 239000000543 intermediate Substances 0.000 description 3
- 150000002500 ions Chemical class 0.000 description 3
- 238000003973 irrigation Methods 0.000 description 3
- 230000002262 irrigation Effects 0.000 description 3
- 230000003902 lesion Effects 0.000 description 3
- 210000003041 ligament Anatomy 0.000 description 3
- 238000012423 maintenance Methods 0.000 description 3
- 230000035800 maturation Effects 0.000 description 3
- 230000007246 mechanism Effects 0.000 description 3
- 230000001404 mediated effect Effects 0.000 description 3
- 239000002207 metabolite Substances 0.000 description 3
- 238000002493 microarray Methods 0.000 description 3
- 235000015816 nutrient absorption Nutrition 0.000 description 3
- 235000018343 nutrient deficiency Nutrition 0.000 description 3
- 239000008188 pellet Substances 0.000 description 3
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 3
- 150000003013 phosphoric acid derivatives Chemical class 0.000 description 3
- 238000003976 plant breeding Methods 0.000 description 3
- 230000008488 polyadenylation Effects 0.000 description 3
- 239000012474 protein marker Substances 0.000 description 3
- 230000007017 scission Effects 0.000 description 3
- 230000008117 seed development Effects 0.000 description 3
- 230000035945 sensitivity Effects 0.000 description 3
- 238000000926 separation method Methods 0.000 description 3
- 238000002864 sequence alignment Methods 0.000 description 3
- 238000012163 sequencing technique Methods 0.000 description 3
- 238000002741 site-directed mutagenesis Methods 0.000 description 3
- 239000011734 sodium Substances 0.000 description 3
- 238000005507 spraying Methods 0.000 description 3
- 230000000087 stabilizing effect Effects 0.000 description 3
- 235000019698 starch Nutrition 0.000 description 3
- 239000007858 starting material Substances 0.000 description 3
- 238000007619 statistical method Methods 0.000 description 3
- 239000000725 suspension Substances 0.000 description 3
- 238000012546 transfer Methods 0.000 description 3
- 238000011426 transformation method Methods 0.000 description 3
- 230000001052 transient effect Effects 0.000 description 3
- 230000003827 upregulation Effects 0.000 description 3
- 238000001262 western blot Methods 0.000 description 3
- 235000011624 Agave sisalana Nutrition 0.000 description 2
- 244000198134 Agave sisalana Species 0.000 description 2
- 241000524150 Albizia amara Species 0.000 description 2
- 235000002732 Allium cepa var. cepa Nutrition 0.000 description 2
- 235000003840 Amygdalus nana Nutrition 0.000 description 2
- 244000296825 Amygdalus nana Species 0.000 description 2
- 244000099147 Ananas comosus Species 0.000 description 2
- 235000007119 Ananas comosus Nutrition 0.000 description 2
- 240000007087 Apium graveolens Species 0.000 description 2
- 101100079126 Arabidopsis thaliana NAC081 gene Proteins 0.000 description 2
- 244000080767 Areca catechu Species 0.000 description 2
- 235000009393 Avena byzantina Nutrition 0.000 description 2
- 240000000372 Avena hybrida Species 0.000 description 2
- 235000009123 Avena hybrida Nutrition 0.000 description 2
- 235000010082 Averrhoa carambola Nutrition 0.000 description 2
- 240000006063 Averrhoa carambola Species 0.000 description 2
- 241000335053 Beta vulgaris Species 0.000 description 2
- 235000003932 Betula Nutrition 0.000 description 2
- 241000219429 Betula Species 0.000 description 2
- 241000283690 Bos taurus Species 0.000 description 2
- 240000007124 Brassica oleracea Species 0.000 description 2
- 235000003899 Brassica oleracea var acephala Nutrition 0.000 description 2
- 235000011299 Brassica oleracea var botrytis Nutrition 0.000 description 2
- 235000011301 Brassica oleracea var capitata Nutrition 0.000 description 2
- 235000001169 Brassica oleracea var oleracea Nutrition 0.000 description 2
- 240000003259 Brassica oleracea var. botrytis Species 0.000 description 2
- 235000008635 Cadaba farinosa Nutrition 0.000 description 2
- 241000628166 Cadaba farinosa Species 0.000 description 2
- 241000209507 Camellia Species 0.000 description 2
- 244000292211 Canna coccinea Species 0.000 description 2
- 235000005273 Canna coccinea Nutrition 0.000 description 2
- 235000008697 Cannabis sativa Nutrition 0.000 description 2
- 244000025254 Cannabis sativa Species 0.000 description 2
- 241000208293 Capsicum Species 0.000 description 2
- 235000009467 Carica papaya Nutrition 0.000 description 2
- 240000006432 Carica papaya Species 0.000 description 2
- 240000004927 Carissa macrocarpa Species 0.000 description 2
- 235000021511 Cinnamomum cassia Nutrition 0.000 description 2
- 244000228088 Cola acuminata Species 0.000 description 2
- 241000350000 Colophospermum mopane Species 0.000 description 2
- 241000195493 Cryptophyta Species 0.000 description 2
- 244000241257 Cucumis melo Species 0.000 description 2
- 235000009842 Cucumis melo Nutrition 0.000 description 2
- 235000017788 Cydonia oblonga Nutrition 0.000 description 2
- 244000236931 Cydonia oblonga Species 0.000 description 2
- SRBFZHDQGSBBOR-IOVATXLUSA-N D-xylopyranose Chemical compound O[C@@H]1COC(O)[C@H](O)[C@H]1O SRBFZHDQGSBBOR-IOVATXLUSA-N 0.000 description 2
- 241000746417 Dalbergia monetaria Species 0.000 description 2
- 244000000626 Daucus carota Species 0.000 description 2
- 235000002767 Daucus carota Nutrition 0.000 description 2
- 240000001008 Dimocarpus longan Species 0.000 description 2
- 235000005903 Dioscorea Nutrition 0.000 description 2
- 244000281702 Dioscorea villosa Species 0.000 description 2
- 235000000504 Dioscorea villosa Nutrition 0.000 description 2
- 235000011511 Diospyros Nutrition 0.000 description 2
- 241000723267 Diospyros Species 0.000 description 2
- 235000001942 Elaeis Nutrition 0.000 description 2
- 241000512897 Elaeis Species 0.000 description 2
- 235000001950 Elaeis guineensis Nutrition 0.000 description 2
- 101150094177 Erf gene Proteins 0.000 description 2
- VGGSQFUCUMXWEO-UHFFFAOYSA-N Ethene Chemical compound C=C VGGSQFUCUMXWEO-UHFFFAOYSA-N 0.000 description 2
- 239000005977 Ethylene Substances 0.000 description 2
- 235000000235 Euphoria longan Nutrition 0.000 description 2
- 235000010099 Fagus sylvatica Nutrition 0.000 description 2
- 240000000731 Fagus sylvatica Species 0.000 description 2
- 235000008730 Ficus carica Nutrition 0.000 description 2
- 244000025361 Ficus carica Species 0.000 description 2
- 244000194101 Ginkgo biloba Species 0.000 description 2
- 239000004471 Glycine Substances 0.000 description 2
- 240000000047 Gossypium barbadense Species 0.000 description 2
- 235000009429 Gossypium barbadense Nutrition 0.000 description 2
- 241000238631 Hexapoda Species 0.000 description 2
- 235000005206 Hibiscus Nutrition 0.000 description 2
- 235000007185 Hibiscus lunariifolius Nutrition 0.000 description 2
- 244000284380 Hibiscus rosa sinensis Species 0.000 description 2
- 108010033040 Histones Proteins 0.000 description 2
- 241000282412 Homo Species 0.000 description 2
- 241000782597 Hypericum erectum Species 0.000 description 2
- 235000000177 Indigofera tinctoria Nutrition 0.000 description 2
- 244000017020 Ipomoea batatas Species 0.000 description 2
- 235000002678 Ipomoea batatas Nutrition 0.000 description 2
- 240000004322 Lens culinaris Species 0.000 description 2
- 240000007472 Leucaena leucocephala Species 0.000 description 2
- 235000010643 Leucaena leucocephala Nutrition 0.000 description 2
- 235000004431 Linum usitatissimum Nutrition 0.000 description 2
- 240000006240 Linum usitatissimum Species 0.000 description 2
- 241000219743 Lotus Species 0.000 description 2
- 235000014826 Mangifera indica Nutrition 0.000 description 2
- 240000007228 Mangifera indica Species 0.000 description 2
- 235000004456 Manihot esculenta Nutrition 0.000 description 2
- 241000218666 Metasequoia Species 0.000 description 2
- 240000000249 Morus alba Species 0.000 description 2
- 235000008708 Morus alba Nutrition 0.000 description 2
- 235000006508 Nelumbo nucifera Nutrition 0.000 description 2
- 235000006510 Nelumbo pentapetala Nutrition 0.000 description 2
- 240000002778 Neonotonia wightii Species 0.000 description 2
- 101001030481 Oryza sativa subsp. japonica NAC domain-containing protein 22 Proteins 0.000 description 2
- 238000012408 PCR amplification Methods 0.000 description 2
- 241000209117 Panicum Species 0.000 description 2
- 235000006443 Panicum miliaceum subsp. miliaceum Nutrition 0.000 description 2
- 235000009037 Panicum miliaceum subsp. ruderale Nutrition 0.000 description 2
- 241000233805 Phoenix Species 0.000 description 2
- 102000016462 Phosphate Transport Proteins Human genes 0.000 description 2
- 108010092528 Phosphate Transport Proteins Proteins 0.000 description 2
- 108091000041 Phosphoenolpyruvate Carboxylase Proteins 0.000 description 2
- 235000005205 Pinus Nutrition 0.000 description 2
- 241000218602 Pinus <genus> Species 0.000 description 2
- 241000219843 Pisum Species 0.000 description 2
- 235000010582 Pisum sativum Nutrition 0.000 description 2
- 240000004713 Pisum sativum Species 0.000 description 2
- 241000209048 Poa Species 0.000 description 2
- 235000018794 Podocarpus totara Nutrition 0.000 description 2
- 240000003145 Podocarpus totara Species 0.000 description 2
- WCUXLLCKKVVCTQ-UHFFFAOYSA-M Potassium chloride Chemical compound [Cl-].[K+] WCUXLLCKKVVCTQ-UHFFFAOYSA-M 0.000 description 2
- 235000011432 Prunus Nutrition 0.000 description 2
- 244000184734 Pyrus japonica Species 0.000 description 2
- 238000011529 RT qPCR Methods 0.000 description 2
- 235000009413 Ratibida columnifera Nutrition 0.000 description 2
- 108020004511 Recombinant DNA Proteins 0.000 description 2
- 102000018120 Recombinases Human genes 0.000 description 2
- 108010091086 Recombinases Proteins 0.000 description 2
- 108020005091 Replication Origin Proteins 0.000 description 2
- 241001092459 Rubus Species 0.000 description 2
- 241000229286 Rudbeckia Species 0.000 description 2
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 2
- 241000208829 Sambucus Species 0.000 description 2
- 108050007496 Shikimate kinase 2 Proteins 0.000 description 2
- 241000220261 Sinapis Species 0.000 description 2
- 235000012308 Tagetes Nutrition 0.000 description 2
- 241000736851 Tagetes Species 0.000 description 2
- 235000004298 Tamarindus indica Nutrition 0.000 description 2
- 240000004584 Tamarindus indica Species 0.000 description 2
- 235000006468 Thea sinensis Nutrition 0.000 description 2
- 244000299461 Theobroma cacao Species 0.000 description 2
- 235000009470 Theobroma cacao Nutrition 0.000 description 2
- 102000008579 Transposases Human genes 0.000 description 2
- 108010020764 Transposases Proteins 0.000 description 2
- 240000009038 Viola odorata Species 0.000 description 2
- 235000013487 Viola odorata Nutrition 0.000 description 2
- 235000007244 Zea mays Nutrition 0.000 description 2
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 2
- 239000002253 acid Substances 0.000 description 2
- 239000008186 active pharmaceutical agent Substances 0.000 description 2
- 230000004075 alteration Effects 0.000 description 2
- 238000000137 annealing Methods 0.000 description 2
- 239000003242 anti bacterial agent Substances 0.000 description 2
- 229940088710 antibiotic agent Drugs 0.000 description 2
- 230000003078 antioxidant effect Effects 0.000 description 2
- 239000011324 bead Substances 0.000 description 2
- 230000008901 benefit Effects 0.000 description 2
- 230000027455 binding Effects 0.000 description 2
- 150000001768 cations Chemical class 0.000 description 2
- 230000005779 cell damage Effects 0.000 description 2
- 208000037887 cell injury Diseases 0.000 description 2
- 239000003086 colorant Substances 0.000 description 2
- 235000018597 common camellia Nutrition 0.000 description 2
- 230000002596 correlated effect Effects 0.000 description 2
- 210000000805 cytoplasm Anatomy 0.000 description 2
- 238000013461 design Methods 0.000 description 2
- 235000004879 dioscorea Nutrition 0.000 description 2
- 235000014134 echinacea Nutrition 0.000 description 2
- 238000004520 electroporation Methods 0.000 description 2
- 230000008030 elimination Effects 0.000 description 2
- 238000003379 elimination reaction Methods 0.000 description 2
- 230000013020 embryo development Effects 0.000 description 2
- 210000002257 embryonic structure Anatomy 0.000 description 2
- 108010032090 ethylene-responsive element binding protein Proteins 0.000 description 2
- 235000008995 european elder Nutrition 0.000 description 2
- 230000001747 exhibiting effect Effects 0.000 description 2
- 238000002474 experimental method Methods 0.000 description 2
- 230000004720 fertilization Effects 0.000 description 2
- 230000008124 floral development Effects 0.000 description 2
- RWSXRVCMGQZWBV-WDSKDSINSA-N glutathione Chemical compound OC(=O)[C@@H](N)CCC(=O)N[C@@H](CS)C(=O)NCC(O)=O RWSXRVCMGQZWBV-WDSKDSINSA-N 0.000 description 2
- 235000002532 grape seed extract Nutrition 0.000 description 2
- 230000015784 hyperosmotic salinity response Effects 0.000 description 2
- 229940097275 indigo Drugs 0.000 description 2
- COHYTHOBJLSHDF-UHFFFAOYSA-N indigo powder Natural products N1C2=CC=CC=C2C(=O)C1=C1C(=O)C2=CC=CC=C2N1 COHYTHOBJLSHDF-UHFFFAOYSA-N 0.000 description 2
- 230000008595 infiltration Effects 0.000 description 2
- 238000001764 infiltration Methods 0.000 description 2
- 230000000977 initiatory effect Effects 0.000 description 2
- 230000010354 integration Effects 0.000 description 2
- 230000003993 interaction Effects 0.000 description 2
- 238000005304 joining Methods 0.000 description 2
- KWGKDLIKAYFUFQ-UHFFFAOYSA-M lithium chloride Chemical compound [Li+].[Cl-] KWGKDLIKAYFUFQ-UHFFFAOYSA-M 0.000 description 2
- 235000005739 manihot Nutrition 0.000 description 2
- 230000013011 mating Effects 0.000 description 2
- 239000002609 medium Substances 0.000 description 2
- 239000012528 membrane Substances 0.000 description 2
- 230000000877 morphologic effect Effects 0.000 description 2
- 238000002887 multiple sequence alignment Methods 0.000 description 2
- 238000010899 nucleation Methods 0.000 description 2
- 230000036961 partial effect Effects 0.000 description 2
- 239000002245 particle Substances 0.000 description 2
- 235000021017 pears Nutrition 0.000 description 2
- 238000010647 peptide synthesis reaction Methods 0.000 description 2
- 239000000575 pesticide Substances 0.000 description 2
- 239000010452 phosphate Substances 0.000 description 2
- 239000001739 pinus spp. Substances 0.000 description 2
- 235000014774 prunus Nutrition 0.000 description 2
- 238000010188 recombinant method Methods 0.000 description 2
- 238000012216 screening Methods 0.000 description 2
- 238000009394 selective breeding Methods 0.000 description 2
- 238000002791 soaking Methods 0.000 description 2
- 238000013179 statistical model Methods 0.000 description 2
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 2
- 239000000758 substrate Substances 0.000 description 2
- 230000002194 synthesizing effect Effects 0.000 description 2
- 230000005026 transcription initiation Effects 0.000 description 2
- 230000001131 transforming effect Effects 0.000 description 2
- 230000017260 vegetative to reproductive phase transition of meristem Effects 0.000 description 2
- 238000005406 washing Methods 0.000 description 2
- VRYALKFFQXWPIH-PBXRRBTRSA-N (3r,4s,5r)-3,4,5,6-tetrahydroxyhexanal Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)CC=O VRYALKFFQXWPIH-PBXRRBTRSA-N 0.000 description 1
- 108020004463 18S ribosomal RNA Proteins 0.000 description 1
- CAAMSDWKXXPUJR-UHFFFAOYSA-N 3,5-dihydro-4H-imidazol-4-one Chemical compound O=C1CNC=N1 CAAMSDWKXXPUJR-UHFFFAOYSA-N 0.000 description 1
- OPIFSICVWOWJMJ-AEOCFKNESA-N 5-bromo-4-chloro-3-indolyl beta-D-galactoside Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1OC1=CNC2=CC=C(Br)C(Cl)=C12 OPIFSICVWOWJMJ-AEOCFKNESA-N 0.000 description 1
- 102100028220 ABI gene family member 3 Human genes 0.000 description 1
- 240000004507 Abelmoschus esculentus Species 0.000 description 1
- 241000208140 Acer Species 0.000 description 1
- 108090000104 Actin-related protein 3 Proteins 0.000 description 1
- 241000219068 Actinidia Species 0.000 description 1
- 102000007469 Actins Human genes 0.000 description 1
- 108010085238 Actins Proteins 0.000 description 1
- 241000592335 Agathis australis Species 0.000 description 1
- 240000007241 Agrostis stolonifera Species 0.000 description 1
- HOVPGJUNRLMIOZ-CIUDSAMLSA-N Ala-Ser-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CO)NC(=O)[C@H](C)N HOVPGJUNRLMIOZ-CIUDSAMLSA-N 0.000 description 1
- 241000962146 Alsophila tricolor Species 0.000 description 1
- 235000009328 Amaranthus caudatus Nutrition 0.000 description 1
- 240000001592 Amaranthus caudatus Species 0.000 description 1
- 241000380131 Ammophila arenaria Species 0.000 description 1
- 241000744007 Andropogon Species 0.000 description 1
- 101710117679 Anthocyanidin 3-O-glucosyltransferase Proteins 0.000 description 1
- 235000002764 Apium graveolens Nutrition 0.000 description 1
- 235000015849 Apium graveolens Dulce Group Nutrition 0.000 description 1
- 235000010591 Appio Nutrition 0.000 description 1
- 108700025465 Arabidopsis PYK10 Proteins 0.000 description 1
- 101100001797 Arabidopsis thaliana AP2 gene Proteins 0.000 description 1
- 101000638299 Arabidopsis thaliana NAC domain-containing protein 101 Proteins 0.000 description 1
- 101001000071 Arabidopsis thaliana NAC domain-containing protein 102 Proteins 0.000 description 1
- 101000638306 Arabidopsis thaliana NAC domain-containing protein 105 Proteins 0.000 description 1
- 101001030474 Arabidopsis thaliana NAC domain-containing protein 26 Proteins 0.000 description 1
- 101001030395 Arabidopsis thaliana NAC domain-containing protein 30 Proteins 0.000 description 1
- 101000588941 Arabidopsis thaliana NAC domain-containing protein 37 Proteins 0.000 description 1
- 101001128381 Arabidopsis thaliana NAC domain-containing protein 7 Proteins 0.000 description 1
- 101001128388 Arabidopsis thaliana NAC domain-containing protein 76 Proteins 0.000 description 1
- 101100403794 Arabidopsis thaliana NAC002 gene Proteins 0.000 description 1
- 101100079125 Arabidopsis thaliana NAC007 gene Proteins 0.000 description 1
- 101100132482 Arabidopsis thaliana NAC072 gene Proteins 0.000 description 1
- 101100079138 Arabidopsis thaliana NAC098 gene Proteins 0.000 description 1
- 101100478627 Arabidopsis thaliana S-ACP-DES2 gene Proteins 0.000 description 1
- 235000003911 Arachis Nutrition 0.000 description 1
- 244000105624 Arachis hypogaea Species 0.000 description 1
- 235000006226 Areca catechu Nutrition 0.000 description 1
- 241000534456 Arenaria <Aves> Species 0.000 description 1
- 241001167018 Aroa Species 0.000 description 1
- 241001313868 Arundina Species 0.000 description 1
- 241000243239 Astelia fragrans Species 0.000 description 1
- 241001061264 Astragalus Species 0.000 description 1
- 241001061305 Astragalus cicer Species 0.000 description 1
- 241000972773 Aulopiformes Species 0.000 description 1
- 235000007320 Avena fatua Nutrition 0.000 description 1
- 241000209764 Avena fatua Species 0.000 description 1
- 235000018410 Avena fatua var sativa Nutrition 0.000 description 1
- 235000000832 Ayote Nutrition 0.000 description 1
- 241000012950 Baikiaea plurijuga Species 0.000 description 1
- 241000209128 Bambusa Species 0.000 description 1
- 235000017166 Bambusa arundinacea Nutrition 0.000 description 1
- 235000017491 Bambusa tulda Nutrition 0.000 description 1
- 244000036905 Benincasa cerifera Species 0.000 description 1
- 235000011274 Benincasa cerifera Nutrition 0.000 description 1
- 235000016068 Berberis vulgaris Nutrition 0.000 description 1
- 241000219164 Bertholletia Species 0.000 description 1
- 235000021533 Beta vulgaris Nutrition 0.000 description 1
- 108010006654 Bleomycin Proteins 0.000 description 1
- 235000004480 Bombax malabaricum Nutrition 0.000 description 1
- 235000017647 Brassica oleracea var italica Nutrition 0.000 description 1
- 235000012905 Brassica oleracea var viridis Nutrition 0.000 description 1
- 244000064816 Brassica oleracea var. acephala Species 0.000 description 1
- 235000000540 Brassica rapa subsp rapa Nutrition 0.000 description 1
- 244000277360 Bruguiera gymnorhiza Species 0.000 description 1
- 241001246223 Bulgaria Species 0.000 description 1
- 241001424028 Burkea africana Species 0.000 description 1
- 241000726739 Butea Species 0.000 description 1
- 241000565319 Butea monosperma Species 0.000 description 1
- 235000010773 Cajanus indicus Nutrition 0.000 description 1
- 244000105627 Cajanus indicus Species 0.000 description 1
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 1
- 241000973255 Carex elata Species 0.000 description 1
- 235000017350 Carissa Nutrition 0.000 description 1
- 235000001479 Carissa macrocarpa Nutrition 0.000 description 1
- 235000003255 Carthamus tinctorius Nutrition 0.000 description 1
- 244000020518 Carthamus tinctorius Species 0.000 description 1
- 241000723418 Carya Species 0.000 description 1
- 235000014036 Castanea Nutrition 0.000 description 1
- 241001070941 Castanea Species 0.000 description 1
- 241000701489 Cauliflower mosaic virus Species 0.000 description 1
- 244000146553 Ceiba pentandra Species 0.000 description 1
- 235000003301 Ceiba pentandra Nutrition 0.000 description 1
- 241001148660 Cenchrus sp. Species 0.000 description 1
- 108010077544 Chromatin Proteins 0.000 description 1
- 240000006740 Cichorium endivia Species 0.000 description 1
- 235000018536 Cichorium endivia Nutrition 0.000 description 1
- 241000723347 Cinnamomum Species 0.000 description 1
- 241000219109 Citrullus Species 0.000 description 1
- 244000241235 Citrullus lanatus Species 0.000 description 1
- 235000009831 Citrullus lanatus Nutrition 0.000 description 1
- 241000207199 Citrus Species 0.000 description 1
- 241000737241 Cocos Species 0.000 description 1
- 108020004705 Codon Proteins 0.000 description 1
- 241000723377 Coffea Species 0.000 description 1
- 235000007460 Coffea arabica Nutrition 0.000 description 1
- 240000007154 Coffea arabica Species 0.000 description 1
- 244000016593 Coffea robusta Species 0.000 description 1
- 235000002187 Coffea robusta Nutrition 0.000 description 1
- 244000205754 Colocasia esculenta Species 0.000 description 1
- 235000006481 Colocasia esculenta Nutrition 0.000 description 1
- 235000007706 Corchorus sp Nutrition 0.000 description 1
- 235000002787 Coriandrum sativum Nutrition 0.000 description 1
- 244000018436 Coriandrum sativum Species 0.000 description 1
- 241001507946 Cotoneaster Species 0.000 description 1
- 235000004237 Crocus Nutrition 0.000 description 1
- 241000596148 Crocus Species 0.000 description 1
- 235000015655 Crocus sativus Nutrition 0.000 description 1
- 244000124209 Crocus sativus Species 0.000 description 1
- 240000005109 Cryptomeria japonica Species 0.000 description 1
- 241000219112 Cucumis Species 0.000 description 1
- 235000010071 Cucumis prophetarum Nutrition 0.000 description 1
- 241000219122 Cucurbita Species 0.000 description 1
- 235000009854 Cucurbita moschata Nutrition 0.000 description 1
- 235000009804 Cucurbita pepo subsp pepo Nutrition 0.000 description 1
- 241001559589 Cullen Species 0.000 description 1
- 241000132493 Cyathea dealbata Species 0.000 description 1
- 102000001493 Cyclophilins Human genes 0.000 description 1
- 108010068682 Cyclophilins Proteins 0.000 description 1
- 244000019459 Cynara cardunculus Species 0.000 description 1
- 235000019106 Cynara scolymus Nutrition 0.000 description 1
- IGXWBGJHJZYPQS-SSDOTTSWSA-N D-Luciferin Chemical compound OC(=O)[C@H]1CSC(C=2SC3=CC=C(O)C=C3N=2)=N1 IGXWBGJHJZYPQS-SSDOTTSWSA-N 0.000 description 1
- WQZGKKKJIJFFOK-QTVWNMPRSA-N D-mannopyranose Chemical compound OC[C@H]1OC(O)[C@@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-QTVWNMPRSA-N 0.000 description 1
- 230000004544 DNA amplification Effects 0.000 description 1
- 102000004163 DNA-directed RNA polymerases Human genes 0.000 description 1
- 108090000626 DNA-directed RNA polymerases Proteins 0.000 description 1
- 241000035389 Davallia divaricata Species 0.000 description 1
- 208000005156 Dehydration Diseases 0.000 description 1
- CYCGRDQQIOGCKX-UHFFFAOYSA-N Dehydro-luciferin Natural products OC(=O)C1=CSC(C=2SC3=CC(O)=CC=C3N=2)=N1 CYCGRDQQIOGCKX-UHFFFAOYSA-N 0.000 description 1
- 241001414378 Diheteropogon Species 0.000 description 1
- 241001414368 Diheteropogon amplectens Species 0.000 description 1
- 235000000525 Dimocarpus longan Nutrition 0.000 description 1
- 241000219761 Dioclea Species 0.000 description 1
- 241001638536 Dixonia Species 0.000 description 1
- 241000219764 Dolichos Species 0.000 description 1
- 241000249436 Dorycnium rectum Species 0.000 description 1
- 241000628129 Echinochloa pyramidalis Species 0.000 description 1
- 235000018060 Elaeis melanococca Nutrition 0.000 description 1
- 235000007349 Eleusine coracana Nutrition 0.000 description 1
- 244000078127 Eleusine coracana Species 0.000 description 1
- 101100491986 Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) aromA gene Proteins 0.000 description 1
- 102100027723 Endogenous retrovirus group K member 6 Rec protein Human genes 0.000 description 1
- 101710091045 Envelope protein Proteins 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- YQYJSBFKSSDGFO-UHFFFAOYSA-N Epihygromycin Natural products OC1C(O)C(C(=O)C)OC1OC(C(=C1)O)=CC=C1C=C(C)C(=O)NC1C(O)C(O)C2OCOC2C1O YQYJSBFKSSDGFO-UHFFFAOYSA-N 0.000 description 1
- 235000009008 Eriobotrya japonica Nutrition 0.000 description 1
- 244000061508 Eriobotrya japonica Species 0.000 description 1
- 101000933461 Escherichia coli (strain K12) Beta-glucuronidase Proteins 0.000 description 1
- 108700039887 Essential Genes Proteins 0.000 description 1
- 244000166124 Eucalyptus globulus Species 0.000 description 1
- 241001175061 Euclea schimperi Species 0.000 description 1
- 235000013420 Eugenia uniflora Nutrition 0.000 description 1
- 240000003813 Eugenia uniflora Species 0.000 description 1
- 241000206602 Eukaryota Species 0.000 description 1
- 241001140636 Eulalia villosa Species 0.000 description 1
- 108700024394 Exon Proteins 0.000 description 1
- 241001070947 Fagus Species 0.000 description 1
- 244000233576 Feijoa sellowiana Species 0.000 description 1
- 235000012068 Feijoa sellowiana Nutrition 0.000 description 1
- 241000234642 Festuca Species 0.000 description 1
- 241000234643 Festuca arundinacea Species 0.000 description 1
- BJGNCJDXODQBOB-UHFFFAOYSA-N Fivefly Luciferin Natural products OC(=O)C1CSC(C=2SC3=CC(O)=CC=C3N=2)=N1 BJGNCJDXODQBOB-UHFFFAOYSA-N 0.000 description 1
- 235000017317 Fortunella Nutrition 0.000 description 1
- 241000169596 Freycinetia Species 0.000 description 1
- 235000016676 Freycinetia banksii Nutrition 0.000 description 1
- 240000004719 Freycinetia banksii Species 0.000 description 1
- 108700028146 Genetic Enhancer Elements Proteins 0.000 description 1
- CEAZRRDELHUEMR-URQXQFDESA-N Gentamicin Chemical compound O1[C@H](C(C)NC)CC[C@@H](N)[C@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](NC)[C@@](C)(O)CO2)O)[C@H](N)C[C@@H]1N CEAZRRDELHUEMR-URQXQFDESA-N 0.000 description 1
- 229930182566 Gentamicin Natural products 0.000 description 1
- 241000208152 Geranium Species 0.000 description 1
- 244000105059 Geranium thunbergii Species 0.000 description 1
- 235000005491 Geranium thunbergii Nutrition 0.000 description 1
- 235000008100 Ginkgo biloba Nutrition 0.000 description 1
- TWHDOEYLXXQYOZ-FXQIFTODSA-N Gln-Asn-Gln Chemical compound C(CC(=O)N)[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CCC(=O)N)C(=O)O)N TWHDOEYLXXQYOZ-FXQIFTODSA-N 0.000 description 1
- SDSMVVSHLAAOJL-UKJIMTQDSA-N Gln-Val-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H](C(C)C)NC(=O)[C@H](CCC(=O)N)N SDSMVVSHLAAOJL-UKJIMTQDSA-N 0.000 description 1
- 108010024636 Glutathione Proteins 0.000 description 1
- QCTLGOYODITHPQ-WHFBIAKZSA-N Gly-Cys-Ser Chemical compound [H]NCC(=O)N[C@@H](CS)C(=O)N[C@@H](CO)C(O)=O QCTLGOYODITHPQ-WHFBIAKZSA-N 0.000 description 1
- 239000005562 Glyphosate Substances 0.000 description 1
- 108050002220 Green fluorescent protein, GFP Proteins 0.000 description 1
- 241001648387 Grevillea Species 0.000 description 1
- 241000013479 Guibourtia coleosperma Species 0.000 description 1
- 101150105462 HIS6 gene Proteins 0.000 description 1
- 241000214032 Hedysarum Species 0.000 description 1
- 235000002941 Hemerocallis fulva Nutrition 0.000 description 1
- 240000009206 Hemerocallis fulva Species 0.000 description 1
- 241001582739 Heteropogon <robber fly> Species 0.000 description 1
- 240000007860 Heteropogon contortus Species 0.000 description 1
- RNAYRCNHRYEBTH-IHRRRGAJSA-N His-Met-Leu Chemical compound [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(C)C)C(O)=O RNAYRCNHRYEBTH-IHRRRGAJSA-N 0.000 description 1
- 101000724234 Homo sapiens ABI gene family member 3 Proteins 0.000 description 1
- 101000836261 Homo sapiens U4/U6.U5 tri-snRNP-associated protein 2 Proteins 0.000 description 1
- 241000209219 Hordeum Species 0.000 description 1
- 244000284937 Hyparrhenia rufa Species 0.000 description 1
- 241000310653 Hyperthelia dissoluta Species 0.000 description 1
- IDAHFEPYTJJZFD-PEFMBERDSA-N Ile-Asp-Glu Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CCC(=O)O)C(=O)O)N IDAHFEPYTJJZFD-PEFMBERDSA-N 0.000 description 1
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 1
- 235000013757 Juglans Nutrition 0.000 description 1
- 241000758789 Juglans Species 0.000 description 1
- 101100288095 Klebsiella pneumoniae neo gene Proteins 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- 235000003228 Lactuca sativa Nutrition 0.000 description 1
- 240000008415 Lactuca sativa Species 0.000 description 1
- 241000219729 Lathyrus Species 0.000 description 1
- 241000536650 Latirus Species 0.000 description 1
- 108091026898 Leader sequence (mRNA) Proteins 0.000 description 1
- 241000219739 Lens Species 0.000 description 1
- 235000014647 Lens culinaris subsp culinaris Nutrition 0.000 description 1
- 235000010666 Lens esculenta Nutrition 0.000 description 1
- 235000000421 Lepidium meyenii Nutrition 0.000 description 1
- 240000000759 Lepidium meyenii Species 0.000 description 1
- 241001092400 Leptarrhena pyrolifolia Species 0.000 description 1
- KUIDCYNIEJBZBU-AJNGGQMLSA-N Leu-Ile-Leu Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(C)C)C(O)=O KUIDCYNIEJBZBU-AJNGGQMLSA-N 0.000 description 1
- 241000208204 Linum Species 0.000 description 1
- 241001329168 Loudetia simplex Species 0.000 description 1
- 108060001084 Luciferase Proteins 0.000 description 1
- 239000005089 Luciferase Substances 0.000 description 1
- DDWFXDSYGUXRAY-UHFFFAOYSA-N Luciferin Natural products CCc1c(C)c(CC2NC(=O)C(=C2C=C)C)[nH]c1Cc3[nH]c4C(=C5/NC(CC(=O)O)C(C)C5CC(=O)O)CC(=O)c4c3C DDWFXDSYGUXRAY-UHFFFAOYSA-N 0.000 description 1
- 235000018780 Luffa acutangula Nutrition 0.000 description 1
- 244000280244 Luffa acutangula Species 0.000 description 1
- 241000219745 Lupinus Species 0.000 description 1
- 241000202831 Luzula Species 0.000 description 1
- 241000605547 Luzula sylvatica Species 0.000 description 1
- 241000227653 Lycopersicon Species 0.000 description 1
- 235000002262 Lycopersicon Nutrition 0.000 description 1
- 244000276497 Lycopersicon esculentum Species 0.000 description 1
- 241000219822 Macrotyloma axillare Species 0.000 description 1
- 240000003394 Malpighia glabra Species 0.000 description 1
- 235000014837 Malpighia glabra Nutrition 0.000 description 1
- 241000208949 Malpighiaceae Species 0.000 description 1
- 101710175625 Maltose/maltodextrin-binding periplasmic protein Proteins 0.000 description 1
- 241000220225 Malus Species 0.000 description 1
- 244000081841 Malus domestica Species 0.000 description 1
- 235000011430 Malus pumila Nutrition 0.000 description 1
- 235000000889 Mammea americana Nutrition 0.000 description 1
- 240000005984 Mammea americana Species 0.000 description 1
- 240000001794 Manilkara zapota Species 0.000 description 1
- 235000011339 Manilkara zapota Nutrition 0.000 description 1
- PKVZBNCYEICAQP-UHFFFAOYSA-N Mecamylamine hydrochloride Chemical compound Cl.C1CC2C(C)(C)C(NC)(C)C1C2 PKVZBNCYEICAQP-UHFFFAOYSA-N 0.000 description 1
- 241000213996 Melilotus Species 0.000 description 1
- 235000014435 Mentha Nutrition 0.000 description 1
- 241001072983 Mentha Species 0.000 description 1
- 241000878006 Miscanthus sinensis Species 0.000 description 1
- 235000009815 Momordica Nutrition 0.000 description 1
- 241000218984 Momordica Species 0.000 description 1
- 108700005084 Multigene Family Proteins 0.000 description 1
- 241000234295 Musa Species 0.000 description 1
- 240000008790 Musa x paradisiaca Species 0.000 description 1
- 235000018290 Musa x paradisiaca Nutrition 0.000 description 1
- 101710135898 Myc proto-oncogene protein Proteins 0.000 description 1
- 102100038895 Myc proto-oncogene protein Human genes 0.000 description 1
- XMBSYZWANAQXEV-UHFFFAOYSA-N N-alpha-L-glutamyl-L-phenylalanine Natural products OC(=O)CCC(N)C(=O)NC(C(O)=O)CC1=CC=CC=C1 XMBSYZWANAQXEV-UHFFFAOYSA-N 0.000 description 1
- KZNQNBZMBZJQJO-UHFFFAOYSA-N N-glycyl-L-proline Natural products NCC(=O)N1CCCC1C(O)=O KZNQNBZMBZJQJO-UHFFFAOYSA-N 0.000 description 1
- 101150074841 NAM2 gene Proteins 0.000 description 1
- 241001532689 Narcissus pseudonarcissus Species 0.000 description 1
- 241001230286 Narenga Species 0.000 description 1
- 229930193140 Neomycin Natural products 0.000 description 1
- 244000183278 Nephelium litchi Species 0.000 description 1
- 235000015742 Nephelium litchi Nutrition 0.000 description 1
- 101100329389 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) cre-1 gene Proteins 0.000 description 1
- 101100395023 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) his-7 gene Proteins 0.000 description 1
- 239000000020 Nitrocellulose Substances 0.000 description 1
- 238000000636 Northern blotting Methods 0.000 description 1
- 108010077850 Nuclear Localization Signals Proteins 0.000 description 1
- 108091005461 Nucleic proteins Chemical group 0.000 description 1
- 239000004677 Nylon Substances 0.000 description 1
- 108020005187 Oligonucleotide Probes Proteins 0.000 description 1
- 241000219830 Onobrychis Species 0.000 description 1
- 240000001439 Opuntia Species 0.000 description 1
- 241001446528 Ornithopus Species 0.000 description 1
- 240000001516 Oryza latifolia Species 0.000 description 1
- 101001000019 Oryza sativa subsp. japonica NAC domain-containing protein 71 Proteins 0.000 description 1
- 240000008114 Panicum miliaceum Species 0.000 description 1
- 235000007199 Panicum miliaceum Nutrition 0.000 description 1
- 241001520808 Panicum virgatum Species 0.000 description 1
- 235000000370 Passiflora edulis Nutrition 0.000 description 1
- 244000288157 Passiflora edulis Species 0.000 description 1
- 240000004370 Pastinaca sativa Species 0.000 description 1
- 235000002769 Pastinaca sativa Nutrition 0.000 description 1
- 206010034133 Pathogen resistance Diseases 0.000 description 1
- 241001618237 Peltophorum africanum Species 0.000 description 1
- 239000006002 Pepper Substances 0.000 description 1
- 241000182534 Pericallis hybrida Species 0.000 description 1
- 241000218196 Persea Species 0.000 description 1
- 244000025272 Persea americana Species 0.000 description 1
- 235000011236 Persea americana var americana Nutrition 0.000 description 1
- 240000009164 Petroselinum crispum Species 0.000 description 1
- 235000002770 Petroselinum crispum Nutrition 0.000 description 1
- 108010002747 Pfu DNA polymerase Proteins 0.000 description 1
- 244000081757 Phalaris arundinacea Species 0.000 description 1
- 241000219833 Phaseolus Species 0.000 description 1
- ZWJKVFAYPLPCQB-UNQGMJICSA-N Phe-Arg-Thr Chemical compound C[C@@H](O)[C@H](NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@@H](N)Cc1ccccc1)C(O)=O ZWJKVFAYPLPCQB-UNQGMJICSA-N 0.000 description 1
- RVRRHFPCEOVRKQ-KKUMJFAQSA-N Phe-His-Asn Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CC2=CN=CN2)C(=O)N[C@@H](CC(=O)N)C(=O)O)N RVRRHFPCEOVRKQ-KKUMJFAQSA-N 0.000 description 1
- 241000746983 Phleum pratense Species 0.000 description 1
- 235000015867 Phoenix canariensis Nutrition 0.000 description 1
- 244000297511 Phoenix canariensis Species 0.000 description 1
- 240000008340 Phormium cookianum Species 0.000 description 1
- IAJOBQBIJHVGMQ-UHFFFAOYSA-N Phosphinothricin Natural products CP(O)(=O)CCC(N)C(O)=O IAJOBQBIJHVGMQ-UHFFFAOYSA-N 0.000 description 1
- 244000273256 Phragmites communis Species 0.000 description 1
- 235000014676 Phragmites communis Nutrition 0.000 description 1
- 235000015334 Phyllostachys viridis Nutrition 0.000 description 1
- 244000082204 Phyllostachys viridis Species 0.000 description 1
- 244000064622 Physalis edulis Species 0.000 description 1
- 241000195888 Physcomitrella Species 0.000 description 1
- 240000000020 Picea glauca Species 0.000 description 1
- 235000008127 Picea glauca Nutrition 0.000 description 1
- 235000008331 Pinus X rigitaeda Nutrition 0.000 description 1
- 235000011613 Pinus brutia Nutrition 0.000 description 1
- 241000018646 Pinus brutia Species 0.000 description 1
- 235000016761 Piper aduncum Nutrition 0.000 description 1
- 240000003889 Piper guineense Species 0.000 description 1
- 235000017804 Piper guineense Nutrition 0.000 description 1
- 235000008184 Piper nigrum Nutrition 0.000 description 1
- 235000003447 Pistacia vera Nutrition 0.000 description 1
- 240000006711 Pistacia vera Species 0.000 description 1
- 108010064851 Plant Proteins Proteins 0.000 description 1
- 241000133788 Pogonarthria Species 0.000 description 1
- 241000133806 Pogonarthria squarrosa Species 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- 241000219000 Populus Species 0.000 description 1
- 241000168036 Populus alba Species 0.000 description 1
- 241000183024 Populus tremula Species 0.000 description 1
- QMABBZHZMDXHKU-FKBYEOEOSA-N Pro-Tyr-Trp Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(O)=O QMABBZHZMDXHKU-FKBYEOEOSA-N 0.000 description 1
- 240000000037 Prosopis spicigera Species 0.000 description 1
- 235000006629 Prosopis spicigera Nutrition 0.000 description 1
- 101800004937 Protein C Proteins 0.000 description 1
- 101710188315 Protein X Proteins 0.000 description 1
- 235000011158 Prunus mume Nutrition 0.000 description 1
- 244000018795 Prunus mume Species 0.000 description 1
- 235000008572 Pseudotsuga menziesii Nutrition 0.000 description 1
- 240000001416 Pseudotsuga menziesii Species 0.000 description 1
- 241000508269 Psidium Species 0.000 description 1
- 241000350492 Pterolobium stellatum Species 0.000 description 1
- 244000294611 Punica granatum Species 0.000 description 1
- 235000014360 Punica granatum Nutrition 0.000 description 1
- 108091061402 RAV family Proteins 0.000 description 1
- 230000004570 RNA-binding Effects 0.000 description 1
- 238000012180 RNAeasy kit Methods 0.000 description 1
- 235000019057 Raphanus caudatus Nutrition 0.000 description 1
- 244000088415 Raphanus sativus Species 0.000 description 1
- 235000011380 Raphanus sativus Nutrition 0.000 description 1
- 244000097202 Rathbunia alamosensis Species 0.000 description 1
- 235000009776 Rathbunia alamosensis Nutrition 0.000 description 1
- 235000009411 Rheum rhabarbarum Nutrition 0.000 description 1
- 244000193032 Rheum rhaponticum Species 0.000 description 1
- 235000011129 Rhopalostylis sapida Nutrition 0.000 description 1
- 240000007586 Rhopalostylis sapida Species 0.000 description 1
- 244000171263 Ribes grossularia Species 0.000 description 1
- 235000002357 Ribes grossularia Nutrition 0.000 description 1
- 108091028664 Ribonucleotide Proteins 0.000 description 1
- 240000000528 Ricinus communis Species 0.000 description 1
- 235000004443 Ricinus communis Nutrition 0.000 description 1
- 241001493421 Robinia <trematode> Species 0.000 description 1
- 101150038966 SAD2 gene Proteins 0.000 description 1
- 108091006597 SLC15A4 Proteins 0.000 description 1
- 241000209051 Saccharum Species 0.000 description 1
- 241000124033 Salix Species 0.000 description 1
- 101800001700 Saposin-D Proteins 0.000 description 1
- 102400000827 Saposin-D Human genes 0.000 description 1
- 241001138409 Sciadopitys verticillata Species 0.000 description 1
- 241001639806 Searsia natalensis Species 0.000 description 1
- 241000228160 Secale cereale x Triticum aestivum Species 0.000 description 1
- 229920002684 Sepharose Polymers 0.000 description 1
- 241001116459 Sequoia Species 0.000 description 1
- 241001138418 Sequoia sempervirens Species 0.000 description 1
- 241000422847 Sequoiadendron Species 0.000 description 1
- 241000422846 Sequoiadendron giganteum Species 0.000 description 1
- 235000009367 Sesamum alatum Nutrition 0.000 description 1
- 240000000452 Sesamum alatum Species 0.000 description 1
- 235000003434 Sesamum indicum Nutrition 0.000 description 1
- 235000010896 Sesbania bispinosa Nutrition 0.000 description 1
- 244000112572 Sesbania bispinosa Species 0.000 description 1
- 235000015392 Sesbania grandiflora Nutrition 0.000 description 1
- 244000244100 Solanum integrifolium Species 0.000 description 1
- 235000000099 Solanum integrifolium Nutrition 0.000 description 1
- 235000002560 Solanum lycopersicum Nutrition 0.000 description 1
- 102100021484 Solute carrier family 15 member 4 Human genes 0.000 description 1
- 235000007230 Sorghum bicolor Nutrition 0.000 description 1
- 241000219315 Spinacia Species 0.000 description 1
- 241001520881 Sporobolus Species 0.000 description 1
- 241000847989 Sporobolus fimbriatus Species 0.000 description 1
- 241000408201 Stiburus Species 0.000 description 1
- 241000475042 Stolonifera Species 0.000 description 1
- 229940100389 Sulfonylurea Drugs 0.000 description 1
- 244000045719 Syzygium Species 0.000 description 1
- 235000012096 Syzygium samarangense Nutrition 0.000 description 1
- 241000505911 Tadehagi Species 0.000 description 1
- 241000722046 Taxodium Species 0.000 description 1
- 241001138405 Taxodium distichum Species 0.000 description 1
- 239000004098 Tetracycline Substances 0.000 description 1
- 244000152045 Themeda triandra Species 0.000 description 1
- 102100036407 Thioredoxin Human genes 0.000 description 1
- 108010022394 Threonine synthase Proteins 0.000 description 1
- 101710150448 Transcriptional regulator Myc Proteins 0.000 description 1
- 241000219793 Trifolium Species 0.000 description 1
- 240000002913 Trifolium pratense Species 0.000 description 1
- 241001645022 Tripolium Species 0.000 description 1
- 235000007264 Triticum durum Nutrition 0.000 description 1
- 235000002041 Triticum macha Nutrition 0.000 description 1
- 244000102426 Triticum macha Species 0.000 description 1
- 235000007247 Triticum turgidum Nutrition 0.000 description 1
- 240000002805 Triticum turgidum Species 0.000 description 1
- 241000209143 Triticum turgidum subsp. durum Species 0.000 description 1
- 235000004424 Tropaeolum majus Nutrition 0.000 description 1
- 240000001260 Tropaeolum majus Species 0.000 description 1
- 235000018946 Tropaeolum minus Nutrition 0.000 description 1
- 240000008573 Tropaeolum minus Species 0.000 description 1
- ZKVANNIVSDOQMG-HKUYNNGSSA-N Trp-Tyr-Gly Chemical compound C1=CC=C2C(=C1)C(=CN2)C[C@@H](C(=O)N[C@@H](CC3=CC=C(C=C3)O)C(=O)NCC(=O)O)N ZKVANNIVSDOQMG-HKUYNNGSSA-N 0.000 description 1
- 240000003021 Tsuga heterophylla Species 0.000 description 1
- 235000008554 Tsuga heterophylla Nutrition 0.000 description 1
- CRHFOYCJGVJPLE-AVGNSLFASA-N Tyr-Gln-Asn Chemical compound C1=CC(=CC=C1C[C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CC(=O)N)C(=O)O)N)O CRHFOYCJGVJPLE-AVGNSLFASA-N 0.000 description 1
- 102100027243 U4/U6.U5 tri-snRNP-associated protein 2 Human genes 0.000 description 1
- 108090000848 Ubiquitin Proteins 0.000 description 1
- 102000044159 Ubiquitin Human genes 0.000 description 1
- PAPWZOJOLKZEFR-AVGNSLFASA-N Val-Arg-Lys Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CCCCN)C(=O)O)N PAPWZOJOLKZEFR-AVGNSLFASA-N 0.000 description 1
- GBESYURLQOYWLU-LAEOZQHASA-N Val-Glu-Asp Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC(=O)O)C(=O)O)N GBESYURLQOYWLU-LAEOZQHASA-N 0.000 description 1
- 108010067390 Viral Proteins Proteins 0.000 description 1
- 208000036142 Viral infection Diseases 0.000 description 1
- 235000009754 Vitis X bourquina Nutrition 0.000 description 1
- 235000012333 Vitis X labruscana Nutrition 0.000 description 1
- 241000596981 Watsonia Species 0.000 description 1
- 108700040099 Xylose isomerases Proteins 0.000 description 1
- 241000985592 Zantedeschia Species 0.000 description 1
- 240000001198 Zantedeschia aethiopica Species 0.000 description 1
- 240000003307 Zinnia violacea Species 0.000 description 1
- 241001478412 Zizania palustris Species 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- 230000003213 activating effect Effects 0.000 description 1
- 230000032683 aging Effects 0.000 description 1
- PMMURAAUARKVCB-UHFFFAOYSA-N alpha-D-ara-dHexp Natural products OCC1OC(O)CC(O)C1O PMMURAAUARKVCB-UHFFFAOYSA-N 0.000 description 1
- 235000012735 amaranth Nutrition 0.000 description 1
- 239000004178 amaranth Substances 0.000 description 1
- 229960000723 ampicillin Drugs 0.000 description 1
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 1
- 238000012197 amplification kit Methods 0.000 description 1
- 239000001387 apium graveolens Substances 0.000 description 1
- 238000013459 approach Methods 0.000 description 1
- PYMYPHUHKUWMLA-UHFFFAOYSA-N arabinose Natural products OCC(O)C(O)C(O)C=O PYMYPHUHKUWMLA-UHFFFAOYSA-N 0.000 description 1
- 101150037081 aroA gene Proteins 0.000 description 1
- 235000016520 artichoke thistle Nutrition 0.000 description 1
- 235000006533 astragalus Nutrition 0.000 description 1
- 239000011425 bamboo Substances 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- SRBFZHDQGSBBOR-UHFFFAOYSA-N beta-D-Pyranose-Lyxose Natural products OC1COC(O)C(O)C1O SRBFZHDQGSBBOR-UHFFFAOYSA-N 0.000 description 1
- 230000003115 biocidal effect Effects 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 238000013452 biotechnological production Methods 0.000 description 1
- 238000005422 blasting Methods 0.000 description 1
- 229960001561 bleomycin Drugs 0.000 description 1
- OYVAGSVQBOHSSS-UAPAGMARSA-O bleomycin A2 Chemical compound N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC=C(N=1)C=1SC=C(N=1)C(=O)NCCC[S+](C)C)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1N=CNC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C OYVAGSVQBOHSSS-UAPAGMARSA-O 0.000 description 1
- 230000000903 blocking effect Effects 0.000 description 1
- 235000019577 caloric intake Nutrition 0.000 description 1
- 150000001720 carbohydrates Chemical class 0.000 description 1
- 235000014633 carbohydrates Nutrition 0.000 description 1
- 229910052799 carbon Inorganic materials 0.000 description 1
- 230000033077 cellular process Effects 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 229960005091 chloramphenicol Drugs 0.000 description 1
- WIIZWVCIJKGZOK-RKDXNWHRSA-N chloramphenicol Chemical compound ClC(Cl)C(=O)N[C@H](CO)[C@H](O)C1=CC=C([N+]([O-])=O)C=C1 WIIZWVCIJKGZOK-RKDXNWHRSA-N 0.000 description 1
- 210000003483 chromatin Anatomy 0.000 description 1
- NNKKTZOEKDFTBU-YBEGLDIGSA-N cinidon ethyl Chemical compound C1=C(Cl)C(/C=C(\Cl)C(=O)OCC)=CC(N2C(C3=C(CCCC3)C2=O)=O)=C1 NNKKTZOEKDFTBU-YBEGLDIGSA-N 0.000 description 1
- 239000001407 cinnamomum spp. Substances 0.000 description 1
- 235000020971 citrus fruits Nutrition 0.000 description 1
- 108091036078 conserved sequence Proteins 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 235000014510 cooky Nutrition 0.000 description 1
- 230000010485 coping Effects 0.000 description 1
- 238000012272 crop production Methods 0.000 description 1
- 239000012297 crystallization seed Substances 0.000 description 1
- 238000005520 cutting process Methods 0.000 description 1
- 230000001086 cytosolic effect Effects 0.000 description 1
- 230000034994 death Effects 0.000 description 1
- 230000002950 deficient Effects 0.000 description 1
- 238000010217 densitometric analysis Methods 0.000 description 1
- 239000005547 deoxyribonucleotide Substances 0.000 description 1
- 125000002637 deoxyribonucleotide group Chemical group 0.000 description 1
- 102000004419 dihydrofolate reductase Human genes 0.000 description 1
- 201000010099 disease Diseases 0.000 description 1
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 1
- 238000004090 dissolution Methods 0.000 description 1
- 239000003814 drug Substances 0.000 description 1
- 238000001035 drying Methods 0.000 description 1
- 210000005069 ears Anatomy 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 229940088598 enzyme Drugs 0.000 description 1
- 238000010195 expression analysis Methods 0.000 description 1
- 235000004426 flaxseed Nutrition 0.000 description 1
- 239000003205 fragrance Substances 0.000 description 1
- ZZUFCTLCJUWOSV-UHFFFAOYSA-N furosemide Chemical compound C1=C(Cl)C(S(=O)(=O)N)=CC(C(O)=O)=C1NCC1=CC=CO1 ZZUFCTLCJUWOSV-UHFFFAOYSA-N 0.000 description 1
- 108020001507 fusion proteins Proteins 0.000 description 1
- 102000037865 fusion proteins Human genes 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 238000010353 genetic engineering Methods 0.000 description 1
- 229960002518 gentamicin Drugs 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- IAJOBQBIJHVGMQ-BYPYZUCNSA-N glufosinate-P Chemical compound CP(O)(=O)CC[C@H](N)C(O)=O IAJOBQBIJHVGMQ-BYPYZUCNSA-N 0.000 description 1
- 229960003180 glutathione Drugs 0.000 description 1
- 108010077515 glycylproline Proteins 0.000 description 1
- XDDAORKBJWWYJS-UHFFFAOYSA-N glyphosate Chemical compound OC(=O)CNCP(O)(O)=O XDDAORKBJWWYJS-UHFFFAOYSA-N 0.000 description 1
- 229940097068 glyphosate Drugs 0.000 description 1
- 230000002363 herbicidal effect Effects 0.000 description 1
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 1
- 230000003054 hormonal effect Effects 0.000 description 1
- 239000005556 hormone Substances 0.000 description 1
- 229940088597 hormone Drugs 0.000 description 1
- 238000003898 horticulture Methods 0.000 description 1
- 238000010191 image analysis Methods 0.000 description 1
- 238000003384 imaging method Methods 0.000 description 1
- 230000001771 impaired effect Effects 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- 238000012994 industrial processing Methods 0.000 description 1
- 239000004615 ingredient Substances 0.000 description 1
- 238000002347 injection Methods 0.000 description 1
- 239000007924 injection Substances 0.000 description 1
- 229910052500 inorganic mineral Inorganic materials 0.000 description 1
- 230000000366 juvenile effect Effects 0.000 description 1
- 229960000318 kanamycin Drugs 0.000 description 1
- 229930027917 kanamycin Natural products 0.000 description 1
- SBUJHOSQTJFQJX-NOAMYHISSA-N kanamycin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N SBUJHOSQTJFQJX-NOAMYHISSA-N 0.000 description 1
- 229930182823 kanamycin A Natural products 0.000 description 1
- 101150066555 lacZ gene Proteins 0.000 description 1
- 235000012902 lepidium meyenii Nutrition 0.000 description 1
- 239000003446 ligand Substances 0.000 description 1
- 239000002502 liposome Substances 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 230000004807 localization Effects 0.000 description 1
- 238000004020 luminiscence type Methods 0.000 description 1
- 230000008774 maternal effect Effects 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 235000013372 meat Nutrition 0.000 description 1
- 238000002844 melting Methods 0.000 description 1
- 230000008018 melting Effects 0.000 description 1
- 210000003716 mesoderm Anatomy 0.000 description 1
- 229930182817 methionine Natural products 0.000 description 1
- 230000000813 microbial effect Effects 0.000 description 1
- 244000005700 microbiome Species 0.000 description 1
- 238000000520 microinjection Methods 0.000 description 1
- 239000011707 mineral Substances 0.000 description 1
- 230000002438 mitochondrial effect Effects 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 230000009456 molecular mechanism Effects 0.000 description 1
- 229960004927 neomycin Drugs 0.000 description 1
- 229920001220 nitrocellulos Polymers 0.000 description 1
- 230000009871 nonspecific binding Effects 0.000 description 1
- 231100000252 nontoxic Toxicity 0.000 description 1
- 230000003000 nontoxic effect Effects 0.000 description 1
- 238000003499 nucleic acid array Methods 0.000 description 1
- 238000007899 nucleic acid hybridization Methods 0.000 description 1
- 235000021232 nutrient availability Nutrition 0.000 description 1
- 235000021231 nutrient uptake Nutrition 0.000 description 1
- 235000016709 nutrition Nutrition 0.000 description 1
- 230000035764 nutrition Effects 0.000 description 1
- 229920001778 nylon Polymers 0.000 description 1
- 239000002751 oligonucleotide probe Substances 0.000 description 1
- 230000005305 organ development Effects 0.000 description 1
- 239000010815 organic waste Substances 0.000 description 1
- 230000003204 osmotic effect Effects 0.000 description 1
- 230000001717 pathogenic effect Effects 0.000 description 1
- 239000012071 phase Substances 0.000 description 1
- 238000000206 photolithography Methods 0.000 description 1
- 230000035479 physiological effects, processes and functions Effects 0.000 description 1
- 230000008638 plant developmental process Effects 0.000 description 1
- 230000037039 plant physiology Effects 0.000 description 1
- 235000021118 plant-derived protein Nutrition 0.000 description 1
- 229920001223 polyethylene glycol Polymers 0.000 description 1
- 229920000642 polymer Polymers 0.000 description 1
- 238000006116 polymerization reaction Methods 0.000 description 1
- 238000011176 pooling Methods 0.000 description 1
- 230000029279 positive regulation of transcription, DNA-dependent Effects 0.000 description 1
- 239000002243 precursor Substances 0.000 description 1
- 230000000750 progressive effect Effects 0.000 description 1
- 229960000856 protein c Drugs 0.000 description 1
- 210000001938 protoplast Anatomy 0.000 description 1
- 235000015136 pumpkin Nutrition 0.000 description 1
- 230000005855 radiation Effects 0.000 description 1
- 210000000664 rectum Anatomy 0.000 description 1
- 230000011371 regulation of developmental process Effects 0.000 description 1
- 230000022532 regulation of transcription, DNA-dependent Effects 0.000 description 1
- 230000003252 repetitive effect Effects 0.000 description 1
- 230000001850 reproductive effect Effects 0.000 description 1
- 239000011347 resin Substances 0.000 description 1
- 229920005989 resin Polymers 0.000 description 1
- 230000003938 response to stress Effects 0.000 description 1
- 238000010839 reverse transcription Methods 0.000 description 1
- 230000002441 reversible effect Effects 0.000 description 1
- 239000002336 ribonucleotide Substances 0.000 description 1
- 125000002652 ribonucleotide group Chemical group 0.000 description 1
- 230000021749 root development Effects 0.000 description 1
- 235000019515 salmon Nutrition 0.000 description 1
- 239000012266 salt solution Substances 0.000 description 1
- 238000013077 scoring method Methods 0.000 description 1
- 230000003248 secreting effect Effects 0.000 description 1
- 230000007226 seed germination Effects 0.000 description 1
- 230000035040 seed growth Effects 0.000 description 1
- 238000010187 selection method Methods 0.000 description 1
- 230000019491 signal transduction Effects 0.000 description 1
- 229910052708 sodium Inorganic materials 0.000 description 1
- 239000001509 sodium citrate Substances 0.000 description 1
- NLJMYIDDQXHKNR-UHFFFAOYSA-K sodium citrate Chemical compound O.O.[Na+].[Na+].[Na+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O NLJMYIDDQXHKNR-UHFFFAOYSA-K 0.000 description 1
- FQENQNTWSFEDLI-UHFFFAOYSA-J sodium diphosphate Chemical compound [Na+].[Na+].[Na+].[Na+].[O-]P([O-])(=O)OP([O-])([O-])=O FQENQNTWSFEDLI-UHFFFAOYSA-J 0.000 description 1
- 229940048086 sodium pyrophosphate Drugs 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 239000007790 solid phase Substances 0.000 description 1
- 210000001082 somatic cell Anatomy 0.000 description 1
- 229960000268 spectinomycin Drugs 0.000 description 1
- UNFWWIHTNXNPBV-WXKVUWSESA-N spectinomycin Chemical compound O([C@@H]1[C@@H](NC)[C@@H](O)[C@H]([C@@H]([C@H]1O1)O)NC)[C@]2(O)[C@H]1O[C@H](C)CC2=O UNFWWIHTNXNPBV-WXKVUWSESA-N 0.000 description 1
- 238000010561 standard procedure Methods 0.000 description 1
- 210000000130 stem cell Anatomy 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 235000021012 strawberries Nutrition 0.000 description 1
- 229960005322 streptomycin Drugs 0.000 description 1
- 235000000346 sugar Nutrition 0.000 description 1
- YROXIXLRRCOBKF-UHFFFAOYSA-N sulfonylurea Chemical class OC(=N)N=S(=O)=O YROXIXLRRCOBKF-UHFFFAOYSA-N 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 230000004083 survival effect Effects 0.000 description 1
- 238000004114 suspension culture Methods 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 210000004233 talus Anatomy 0.000 description 1
- 235000013616 tea Nutrition 0.000 description 1
- 229960002180 tetracycline Drugs 0.000 description 1
- 229930101283 tetracycline Natural products 0.000 description 1
- 235000019364 tetracycline Nutrition 0.000 description 1
- 150000003522 tetracyclines Chemical class 0.000 description 1
- 235000019818 tetrasodium diphosphate Nutrition 0.000 description 1
- 239000001577 tetrasodium phosphonato phosphate Substances 0.000 description 1
- 108060008226 thioredoxin Proteins 0.000 description 1
- 229940094937 thioredoxin Drugs 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 108091006106 transcriptional activators Proteins 0.000 description 1
- 108091008023 transcriptional regulators Proteins 0.000 description 1
- 238000002054 transplantation Methods 0.000 description 1
- 229960005486 vaccine Drugs 0.000 description 1
- 230000009385 viral infection Effects 0.000 description 1
- 230000003612 virological effect Effects 0.000 description 1
- 230000000007 visual effect Effects 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
- 238000005303 weighing Methods 0.000 description 1
- 241000228158 x Triticosecale Species 0.000 description 1
- 238000001086 yeast two-hybrid system Methods 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/82—Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
- C12N15/8241—Phenotypically and genetically modified plants via recombinant DNA technology
- C12N15/8261—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/415—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from plants
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/82—Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/82—Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
- C12N15/8201—Methods for introducing genetic material into plant cells, e.g. DNA, RNA, stable or transient incorporation, tissue culture methods adapted for transformation
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/82—Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
- C12N15/8241—Phenotypically and genetically modified plants via recombinant DNA technology
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/82—Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
- C12N15/8241—Phenotypically and genetically modified plants via recombinant DNA technology
- C12N15/8261—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield
- C12N15/8262—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield involving plant development
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A40/00—Adaptation technologies in agriculture, forestry, livestock or agroalimentary production
- Y02A40/10—Adaptation technologies in agriculture, forestry, livestock or agroalimentary production in agriculture
- Y02A40/146—Genetically Modified [GMO] plants, e.g. transgenic plants
Landscapes
- Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Life Sciences & Earth Sciences (AREA)
- Engineering & Computer Science (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Biomedical Technology (AREA)
- Biotechnology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- General Engineering & Computer Science (AREA)
- Wood Science & Technology (AREA)
- Zoology (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- General Health & Medical Sciences (AREA)
- Biophysics (AREA)
- Microbiology (AREA)
- Physics & Mathematics (AREA)
- Plant Pathology (AREA)
- Cell Biology (AREA)
- Botany (AREA)
- Gastroenterology & Hepatology (AREA)
- Medicinal Chemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Peptides Or Proteins (AREA)
- Breeding Of Plants And Reproduction By Means Of Culturing (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Abstract
Description
잔기 | 보존적 치환 | 잔기 | 보존적 치환 |
Ala | Ser | Leu | Ile; Val |
Arg | Lys | Lys | Arg; Gln |
Asn | Gln; His | Met | Leu; Ile |
Asp | Glu | Phe | Met; Leu; Tyr |
Gln | Asn | Ser | Thr; Gly |
Cys | Ser | Thr | Ser; Val |
Glu | Asp | Trp | Tyr |
Gly | Pro | Tyr | Trp; Phe |
His | Asn; Gln | Val | Ile; Leu |
Ile | Leu, Val |
유전자 출처 | 참고문헌 |
액틴 | McElroy 등, Plant Cell, 2: 163-171, 1990 |
HMGP | WO 2004/070039 |
CAMV 35S | Odell 등, Nature, 313: 810-812, 1985 |
CaMV 19S | Nilsson 등, Physiol. Plant. 100:456-462, 1997 |
GOS2 | de Pater 등, Plant J Nov;2(6):837-44, 1992, WO 2004/065596 |
유비퀴틴 | Christensen 등, Plant Mol. Biol. 18: 675-689, 1992 |
벼 사이클로필린 | Buchholz 등, Plant Mol Biol. 25(5): 837-43, 1994 |
옥수수 H3 히스톤 | Lepetit 등, Mol. Gen. Genet. 231:276-285, 1992 |
알팔파 H3 히스톤 | Wu 등 Plant Mol. Biol. 11:641-649, 1988 |
액틴 2 | An 등, Plant J. 10(1); 107-121, 1996 |
34S FMV | Sanger 등, Plant. Mol. Biol., 14, 1990: 433-443 |
Rubisco small subunit | US 4,962,028 |
OCS | Leisner (1988) Proc Natl Acad Sci USA 85(5): 2553 |
SAD1 | Jain 등, Crop Science, 39 (6), 1999: 1696 |
SAD2 | Jain 등, Crop Science, 39 (6), 1999: 1696 |
nos | Shaw 등 (1984) Nucleic Acids Res. 12(20):7831-7846 |
V-ATPase | WO 01/14572 |
Super 프로모터 | WO 95/14098 |
G-box 단백질 | WO 94/12015 |
유전자 출처 | 참고문헌 |
RCc3 | Plant Mol Biol. 1995 Jan;27(2):237-48 |
아라비돕시스 인산염 수송체 PHT1 | Kovam 등, 2005 |
메디카고 인산염 수송체 | Xiao 등, 2006 |
아라비돕시스 Pyk10 | Nitz 등 (2001) Plant Sci 161(2): 337-346 |
유전자 | 발현 | 참고문헌 |
옥수수 오르쏘인산염 디키나아제 | 잎 특이적 | Fukavama 등, 2001 |
옥수수 포스포에놀피루베이트 카복실라아제 | 잎 특이적 | Kausch 등, 2001 |
벼 포스포에놀피루베이트 카복실라아제 | 잎 특이적 | Liu 등, 2003 |
벼 작은 서브유닛 Rubisco | 잎 특이적 | Nomura 등, 2000 |
벼 베타 익스팬신 EXBP9 | 어린 줄기 특이적 | WO 2004/070039 |
Pigeonpea 작은 서브유닛 Rubisco | 잎 특이적 | Panguluri 등, 2005 |
완두 RBCS3A | 잎 특이적 |
핵산 | 아미노산 | NCBI 억세션(Accession) 번호 | 다른 이름 (있을 경우) | 출처 |
서열번호 1 | 서열번호 2 | XM_479673.1 | NAM2 (도 2의 정렬에서 CDS4054라 칭함) | 오리자 사티바 ( Oryza sativa ) |
서열번호 3 | 서열번호 4 | AK106313 | 오리자 사티바 ( Oryza sativa ) | |
서열번호 5 | 서열번호 6 | NM_187584.1 | 오리자 사티바 ( Oryza sativa ) | |
서열번호 7 | 서열번호 8 | XM_467007.1 | 오리자 사티바 ( Oryza sativa ) | |
서열번호 9 | 서열번호 10 | XM_473322.1 | 오리자 사티바 ( Oryza sativa ) | |
서열번호 11 | 서열번호 12 | ABE89364 | 메디카고 트룬카툴라 (Medicago truncatula) | |
서열번호 13 | 서열번호 14 | NM_101098.2 | ANAC007/EMB2749 | 아라비돕시스 탈리아나 ( Arabidopsis thaliana ) |
서열번호 15 | 서열번호 16 | NM_104947.1 | ANAC026 | 아라비돕시스 탈리아나 ( Arabidopsis thaliana ) |
서열번호 17 | 서열번호 18 | XM_476289.1 | 오리자 사티바 ( Oryza sativa ) | |
서열번호 19 | 서열번호 20 | NM_127362.1 | ANAC037 | 아라비돕시스 탈리아나 ( Arabidopsis thaliana ) |
서열번호 21 | 서열번호 22 | NM_119783.2 | ANAC076 | 아라비돕시스 탈리아나 ( Arabidopsis thaliana ) |
서열번호 23 | 서열번호 24 | NM_187584.1 | 오리자 사티바 ( Oryza sativa ) | |
서열번호 25 | 서열번호 26 | NM_125632.1 | ANAC101 | 아라비돕시스 탈리아나 ( Arabidopsis thaliana ) |
서열번호 27 | 서열번호 28 | NM_126028.1 | ANAC105 | 아라비돕시스 탈리아나 ( Arabidopsis thaliana ) |
서열번호 29 | 서열번호 30 | AK071064.1 | 오리자 사티바 ( Oryza sativa ) | |
서열번호 31 | 서열번호 32 | NM_105851.1 | ANAC030 | 아라비돕시스 탈리아나 ( Arabidopsis thaliana ) |
서열번호 33 | 서열번호 34 | NM_197511.1 | 오리자 사티바 ( Oryza sativa ) | |
서열번호 35 | 서열번호 36 | AB217775.1 | 지니아 엘레강스 (Zinnia elegans ) | |
서열번호 37 | 서열번호 38 | AJ833965.1 | 제아 메이스 ( Zea mays ) |
서열번호 50 | 서열번호 51 | XM_470088.1 | NAC1 (도 2의 정렬에서 CDS4035로서 알려짐) | 오리자 사티바 ( Oryza sativa ) |
서열번호 52 | 서열번호 53 | AB028185.1 BAA89800.1 | NAC4 (도 2의 정렬에서 OsNAC6로서 알려짐) | 오리자 사티바 ( Oryza sativa ) |
서열번호 54 | 서열번호 55 | AB028184.1 BAA89799.1 | NAC6 (도 2의 정렬에서 OsNAC5로서 알려짐) | 오리자 사티바 ( Oryza sativa ) |
서열번호 56 | 서열번호 57 | AK107330.1 | NAC7 (도 2의 정렬에서 ONAC24로서 알려짐) | 오리자 사티바 ( Oryza sativa ) |
서열번호 58 | 서열번호 59 | AK069257.1 | NAC3 (도 2의 정렬에서 CDS4034로서 알려짐) | 오리자 사티바 ( Oryza sativa ) |
서열번호 60 | 서열번호 61 | AY625683.1 AAU08786.1 | NAC2-유사 TaNAC2 | 트리티쿰 아애스티붐 (Triticum aestivum ) |
서열번호 62 | 서열번호 63 | AY103772.1 | PCO133091 | 제아 메이스(Zea mays) |
서열번호 64 | 서열번호 65 | AJ010829.1 CAA09371.1 | GRAB1 TACAA09371.1 | 트리티쿰 아애스티붐 (Triticum aestivum ) |
서열번호 66 | 서열번호 67 | NM_186659.2 NP_911548.1 | NAC3-like RiceNP_911548.1 | 오리자 사티바 ( Oryza sativa ) |
서열번호 68 | 서열번호 69 | DQ267442.1 ABB72844.1 | NAC1-유사 elaeis | 엘레이스 귀넨시스 (Elaeis guineensis ) |
서열번호 70 | 서열번호 71 | AB028183.1 BAA89798.1 | NAC4-유사 OsNAC4 | 오리자 사티바 ( Oryza sativa ) |
서열번호 72 | 서열번호 73 | DQ028770.1 AAY46122.1 | NAC2-유사 GmNAC2AAY46122.1 | 글라이신 맥스 ( Glycine max ) |
서열번호 74 | 서열번호 75 | AY498713.1 AAR88435.1 | NAC-유사 토마토NAC | 라이코퍼시콘 에스쿨렌툼 ( Lycopersicon esculentum ) |
서열번호 76 | 서열번호 77 | AY245883.1 AAP35052.1 | NAC5-8 브라시카NAC5-8"NAC-도메인 | 브라시카 나푸스 (Brassica napus ) |
서열번호 78 | 서열번호 79 | XM_475238.1 XP_475238.1 | NAC48 AK068392"putative | 오리자 사티바 ( Oryza sativa ) |
서열번호 80 | 서열번호 81 | AJ401151.1 CAC42087.1 | NAC 솔라눔"putative | 솔라눔 튜베로숨 (Solanum tuberosum) |
서열번호 82 | 서열번호 83 | NM_147856.2 NP_680161.1 | ATAF2 AT5G08790"="ATAF2"NP_680161.1" | 아라비돕시스 탈리아나 (Arabidopsis thaliana ) |
서열번호 84 | 서열번호 85 | AF509873.1 AAM34773.1 | NH10 PetuniaNH10="nam-유사 | 페투니아 x 하이브리다 (Petunia x hybrida ) |
서열번호 86 | 서열번호 87 | AB218789 BAE48667.1 | NAC 프루누스Pm74"NAC | 프루누스 무메 (Prunus mume ) |
서열번호 88 | 서열번호 89 | AY245885.1 AAP35054.1 | NAC18 BnNAC18"NAC-도메인 | 브라시카 나푸스 (Brassica napus) |
서열번호 90 | 서열번호 91 | NM_125774.3 NP_201184.2 | ANAC102 | 아라비돕시스 탈리아나 (Arabidopsis thaliana ) |
서열번호 92 | 서열번호 93 | AY714222.1 AAW48094.1 | NAC CaNAC1 | 캡시쿰 안눔 (Capsicum annuum ) |
서열번호 94 | 서열번호 95 | NM_100054.2 NP_171677 | ATAF1 | 아라비돕시스 탈리아나 (Arabidopsis thaliana ) |
서열번호 96 | 서열번호 97 | AY573802.1 AAU43922.1 | NAC-NOR LeNAC-NOR"전사 | 라이코퍼시콘 에스쿨렌툼 ( Lycopersicon esculentum ) |
서열번호 98 | 서열번호 99 | NM_118875.2 NP_567773.1 | RD26 아라비돕시스 | 아라비돕시스 탈리아나 (Arabidopsis thaliana ) |
서열번호 100 | 서열번호 101 | DQ022843.1 AAY44098.1 | NAC69-3 NAC69-3"TaNAC69-3""NAC | 트리티쿰 아애스티붐 ( Triticum aestivum ) |
서열번호 102 | 서열번호 103 | A625682.1 AAU08785.1 | NAC69-1 NAC69-1"TaNAC69""NAC | 트리티쿰 아애스티붐 ( Triticum aestivum ) |
서열번호 104 | 서열번호 105 | AY742218.1 AAW62955.1 | NAC23 사카룸 | 사카룸 오피시날룸 (Saccharaum officinarum ) |
서열번호 106 | 서열번호 107 | AK063406.1 | NAC10 ONAC10AK063406 | 오리자 사티바 ( Oryza sativa ) |
서열번호 108 | 서열번호 109 | AC145753.1 | NAM 메디카고NAC유사 | 메디카고 트룬카툴라 (Medicago truncatula ) |
유전자 | 정방향 프라이머 | 역방향 프라이머 |
OsNAC4 | 5'CAACACTAGTAGGATAAAG3' | 5'CCACTGGGCTAATTAATTA3' |
OsNAC6 | 5'GTCGACCCACGCGTCCGCT3' | 5'ACTGAAGTACCCGTTCTTA3' |
OsNAC7 | 5'TCCTCCACAAGAGAAACTA3' | 5'GTACAGTGTAGCACAATAA3' |
형질 | Positive events | 평균차이 | p 값 |
최대 면적 | 6 events | 13.70% | <0.077 |
전체 +11% | 0 (F 검정) | ||
출현 활력 | 5 events | 29.60% | <0.225 |
전체 +16% | <0.0108 (F 검정) | ||
TKW | 5 events | 5.40% | <0.097 |
전체 +3% | 0 (F 검정) | ||
첫 번째 원추화서 | 3 events | 20.33% | <0.061 |
총 종자 수 | 2 events | 16 | <0.15 |
형질 | Positive events | 평균 차이 | p 값 |
최대 면적 | 3 events | 18.33% | <0.051 |
전체 +9% | <0.0023 (F 검정) | ||
출현 활력 | 3 events | 30.67% | <0.38 |
최대 뿌리 | 2 events | 10.50% | <0.088 |
TKW | 4 events | 6.50% | <0.042 |
전체 +4% | 0 (F 검정) | ||
첫 번째 원추화서 | 3 events | 15.67% | <0.34 |
총 종자 수 | 3 events | 13.33 | <0.281 |
전체 +5% | <0.091 (F 검정) |
형질 | Positive events | 평균 차이 | p value |
최대 면적 | 2 events | 10.5 % | <0.0011 |
전체 +8 % | 0 (F 검정) | ||
출현 활력 | 3 events | 42 % | <0.0007 |
TKW | 3 events | 4 % | <0.042 |
전체 +4.66 % | <0.0251 (F 검정) | ||
첫 번째 원추화서 | 3 events | 4.33 % | <0.091 |
전체+ 2% | <0.00275 (F 검정) | ||
길쭉한 뿌리 | 2 events | 6 % | <0.0901 |
형질 | Positive events | 평균차이 | p 값 |
최대 면적 | 2 events | 13.00% | <0.0125 |
전체 + 4% | <0.0313 (F 검정) | ||
출현 활력 | 2 events | 13.50% | <0.288 |
전체 +7% | <0.11 (F 검정) | ||
최대 뿌리 | 1 event | 9.00% | <0.0597 |
전체 +4% | <0.0722 (F 검정) | ||
총 종자 수확량 | 2 events | 16.00% | <0.094 |
전체 +6% | <0.0733 (F 검정) | ||
총 종자 수 | 2 events | 14.5 | <0.137 |
형질 | Positive events | 평균 차이 | p 값 |
최대 면적 | 2 events | 8 % | <0.1077 |
총 종자 수확량 | 2 events | 49 % | <0.018 |
전체 +20% | 0.002 (F 검정) | ||
속이 채워진 종자 수 | 2 events | 50.5 % | <0.0138 |
전체 +20% | 0.0017 (F 검정) | ||
충만율 | 2 events | 46.5% | <0.0418 |
전체 + 16% | 0.011 (F 검정) | ||
수확 지수 | 2 events | 47% | <0.0168 |
전체 +19% | 0.0037 | ||
높이 | 2 events | 6.5 % | <0.0103 |
총 종자수 | 2 events | 26 % | <0.0579 |
전체 + 4% | 0.1951 (F 검정 | ||
최대 뿌리 | 2 events | 6.5 % | <0.1038 |
원추화서 당 꽃 | 2 events | 17.5% | <0.1019 |
형질 | Positive events | 평균 차이 | p 값 |
최대 면적 | 2 events | 17.50% | <0.0104 |
출현 활력 | 2 events | 21.00% | <0.2385 |
최대 뿌리 | 3 events | 13.33% | <0.0093 |
전체 + 5.00% | <0.0673 (F 검정) | ||
rootshoot 지수 | 4events | 64.00% | <0.1279 |
전체 + 37% | <0.0005 (F 검정) | ||
총 종자 수확량 | 2 events | 20.00% | <0.2378 |
총 종자 수 | 2 events | 20% | <0.0323 |
형질 | Positive events | 평균차이 | p 값 |
최대 면적 | 3 events | 18.33% | <0.011 |
전체 +11% | 0 (F 검정) | ||
출현 활력 | 3 events | 17.33% | <0.422 |
최대 뿌리 | 1 event | 11.00% | <0.0249 |
전체 +4% | <0.0370 (F 검정) | ||
총 종자 수확량 | 2 events | 20.50% | <0.08 |
원추화서 당 꽃 | 3 events | 10% | <0.101 |
첫째 원추화서 | 19.00% | <0.0769 | |
총 종자 수 | 2 events | 15% | <0.177 |
전체 +5% | <0.0751 (F 검정) |
형질 | Positive events | 평균차이 | p 값 |
총 종자 수확량 | 2 events | 29.00% | <0.00777 |
전체 + 6% | <0.00553 (F 검정) | ||
총 종자 수 | 1 event | 44% | <0.0001 |
전체 + 5% | <0.1084 (F 검정) |
이름/식별자 | 출처 생물체 | 핵산 서열번호 | 폴리펩티드 서열번호 |
AP2-EREBP | 오리자 사티바 ( Oryza sativa ) | 131 | 132 |
Os07g47790 | 오리자 사티바 (Oryza sativa) | 139 | 140 |
AAX13280 | 트리티쿰 아애스티붐 ( Triticum aestivum ) | 141 | 142 |
Os01g21120 | 오리자 사티바 ( Oryza sativa ) | 143 | 144 |
Os03g08470 | 오리자 사티바 ( Oryza sativa ) | 145 | 146 |
CAD56466 | 트리티쿰 아애스티붐 ( Triticum aestivum | 147 | 148 |
AT2G47520.1 | 아라비돕시스 탈리아나 ( Arabidopsis thaliana ) | 149 | 150 |
Os02g54160 | 오리자 사티바 ( Oryza sativa ) | 151 | 152 |
Os09g26420 | 오리자 사티바 ( Oryza sativa ) | 153 | 154 |
AAP32468 | 트리티쿰 아애스티붐 (Triticum aestivum) | 155 | 156 |
AAP32467 | 트리티쿰 아애스티붐 ( Triticum aestivum) | 157 | 158 |
AT1G53910.1 | 아라비돕시스 탈리아나 ( Arabidopsis thaliana ) | 159 | 160 |
AAM65746 | 아라비돕시스 탈리아나 ( Arabidopsis thaliana ) | 161 | 162 |
AT3G14230.1 | 아라비돕시스 탈리아나 ( Arabidopsis thaliana ) | 163 | 164 |
AT3G14230.2 | 아라비돕시스 탈리아나 ( Arabidopsis thaliana ) | 165 | 166 |
AT3G14230.3 | 아라비돕시스 탈리아나 ( Arabidopsis thaliana ) | 167 | 168 |
AT3G16770 | 아라비돕시스 탈리아나 ( Arabidopsis thaliana ) | 169 | 170 |
Os07g42510 | 오리자 사티바 ( Oryza sativa ) | 171 | 172 |
Os03g08490 | 오리자 사티바 ( Oryza sativa ) | 173 | 174 |
Os03g08500 | 오리자 사티바 ( Oryza sativa ) | 175 | 176 |
AT1G72360 | 아라비돕시스 탈리아나 ( Arabidopsis thaliana ) | 177 | 178 |
Os03g08460 | 오리자 사티바 ( Oryza sativa ) | 179 | 180 |
Os05g29810 | 오리자 사티바 ( Oryza sativa ) | 181 | 182 |
Os03g22170 | 오리자 사티바 ( Oryza sativa ) | 183 | 184 |
Os10g25170 | 오리자 사티바 ( Oryza sativa ) | 185 | 186 |
Os09g11460 | 오리자 사티바 ( Oryza sativa ) | 187 | 188 |
AAK95687 | 라이코퍼시콘 에스쿨렌툼 ( Lycopersicon esculentum ) | 189 | 190 |
Os09g11480 | 오리자 사티바 ( Oryza sativa ) | 191 | 192 |
AAQ91334 | 라이코퍼시콘 에스쿨렌툼 ( Lycopersicon esculentum ) | 193 | 194 |
AAR87866 | 라이코퍼시콘 에스쿨렌툼 ( Lycopersicon esculentum ) | 195 | 196 |
AT1G80580 | 아라비돕시스 탈리아나 ( Arabidopsis thaliana ) | 197 | 198 |
AAP40022 | 니코티아나 타바쿰 ( Nicotian tabacum ) | 199 | 200 |
CAE54591 | 파구스 실바티카 ( Fagus sylvatica ) | 201 | 202 |
CAD21849 | 파구스 실바티카 ( Fagus sylvatica ) | 203 | 204 |
ABD65407 | 캡시쿰 안눔 ( Capsicum annuum ) | 205 | 206 |
AAP72289 | 캡시쿰 안눔 ( Capsicum annuum ) | 207 | 208 |
AAS20427 | 캡시쿰 안눔 ( Capsicum annuum ) | 209 | 210 |
AAX07458 | 고시피움 히르수툼 ( Gossypium hirsutum ) | 211 | 212 |
AAT77192 | 고시피움 발바덴스 ( Gossypium barbadense ) | 213 | 214 |
AAX20013 | 고시피움 히르수툼 (Gossypium hirsutum ) | 215 | 216 |
AAX68526 | 고시피움 히르수툼 ( Gossypium hirsutum ) | 217 | 218 |
AAX68525 | 고시피움 히르수툼 ( Gossypium hirsutum ) | 219 | 220 |
AAT77191 | 고시피움 발바덴스 ( Gossypium barbadense ) | 221 | 222 |
AAV51937 | 고시피움 히르수툼 ( Gossypium hirsutum ) | 223 | 224 |
AAV85777 | 고시피움 히르수툼 ( Gossypium hirsutum ) | 225 | 226 |
AAX07460 | 고시피움 히르수툼 ( Gossypium hirsutum ) | 227 | 228 |
AAX84670 | 마니홑 에스쿨렌타 ( Manihot esculenta ) | 229 | 230 |
AAW33881 | 포풀루스 알바 ( Populus alba ) x 포풀루스 트레물라 ( Populus tremula ) | 231 | 232 |
BAE71206 | 트리폴리움 프라텐스 ( Trifolium pretense ) | 233 | 234 |
AAQ10777 | 글라이신 맥스 ( Glycine max ) | 235 | 236 |
AAL67489 | 나르시수스 슈도나르시수스 ( Narcissus pseudonarcissus ) | 237 | 238 |
CAA05084 | 아라비돕시스 탈리아나 ( Arabidopsis thaliana ) | 239 | 240 |
ABE84970 | 메디카고 트룬카툴라 ( Medicago truncatula ) | 241 | 242 |
ABE80536 | 메디카고 트룬카툴라 (Medicago truncatula ) | 243 | 244 |
AAC29516 | 솔라눔 투베로숨 ( Solanum tuberosum ) | 245 | 246 |
BAC56862 | 솔라눔 투베로숨 ( Solanum tuberosum ) | 247 | 248 |
AAS01337 | 코페아 카네포라 ( Coffea canephora ) | 249 | 250 |
AAZ14085 | 호르데움 불가레 (Hordeum vulgare ) | 251 | 252 |
BAD01556 | 쿠쿠미스 멜로 ( Cucumis melo ) | 253 | 254 |
BAF43419 | 말루스 x 도메스티카 ( Malus x domestica ) | 255 | 256 |
Scoring matrix: Blosum62 |
첫째 갭: 12 |
연장 갭: 2 |
1 | 2 | 3 | 4 | 5 | 6 | 7 | 8 | 9 | 10 | 11 | 12 | 13 | 14 | 15 | |
1. 서열 132 | 27.7 | 63.3 | 29.8 | 38.3 | 62.4 | 24 | 59.5 | 40.8 | 61.1 | 58.2 | 37.2 | 37.2 | 37.1 | 37 | |
2. 서열 140 | 37.8 | 27.2 | 43.9 | 29.7 | 26.6 | 36.4 | 27.5 | 26.5 | 26.2 | 25.7 | 29.1 | 29.1 | 27.4 | 27.7 | |
3. 서열 142 | 76.5 | 35.8 | 29.9 | 33.1 | 90.8 | 24.5 | 55.9 | 39 | 94.6 | 88.5 | 35.9 | 35.9 | 36.7 | 37.3 | |
4. 서열 144 | 37.6 | 55.6 | 35.5 | 31.1 | 30.3 | 41.1 | 27.6 | 25 | 28.7 | 29.2 | 27.7 | 27.9 | 27.2 | 27.5 | |
5. 서열 146 | 50.6 | 37.7 | 48.2 | 39.5 | 32 | 24.9 | 36.1 | 33.2 | 30.7 | 30.2 | 34.3 | 34.3 | 32.1 | 32.4 | |
6. 서열 148 | 74.9 | 35.2 | 94.4 | 35.2 | 47 | 25.2 | 56.5 | 38.6 | 87.4 | 88 | 36.2 | 36.2 | 37.6 | 37.9 | |
7. 서열 150 | 31.8 | 48.1 | 32.1 | 52.7 | 34.1 | 32.1 | 23.6 | 22.2 | 23.9 | 24.7 | 26.3 | 26.3 | 24.8 | 25.3 | |
8. 서열 152 | 74.8 | 35.1 | 69.9 | 34.2 | 47.1 | 69 | 31.2 | 42.7 | 53.5 | 53.6 | 39.9 | 39.9 | 36.1 | 36.3 | |
9. 서열 154 | 54 | 33.6 | 51.5 | 32.6 | 45.7 | 51 | 28 | 56.1 | 37.3 | 36.1 | 36.8 | 36.8 | 35 | 35.3 | |
10. 서열 156 | 73.2 | 33.8 | 96.1 | 34.6 | 46.5 | 91.3 | 31.5 | 67.1 | 50 | 85.1 | 34.8 | 35.1 | 35.9 | 36.3 | |
11. 서열 158 | 70.7 | 34.6 | 89.9 | 36.1 | 45.8 | 90 | 34 | 66.6 | 48 | 86.8 | 32.5 | 32.5 | 34 | 34.4 | |
12. 서열 160 | 53.3 | 38.5 | 54.2 | 35.8 | 48 | 52.5 | 33 | 53.7 | 50 | 53.6 | 49.2 | 99.4 | 62.2 | 62.8 | |
13. 서열 162 | 53.3 | 38.5 | 54.2 | 35.8 | 48 | 52.5 | 33 | 53.7 | 50 | 53.6 | 49.2 | 100 | 62.2 | 62.8 | |
14. 서열 164 | 56.7 | 34.3 | 54.4 | 33.5 | 47.2 | 54.6 | 29.6 | 55.4 | 49.7 | 54.1 | 50.1 | 70.7 | 71 | 98.9 | |
15. 서열 166 | 57.1 | 34.7 | 54.7 | 33.9 | 47.7 | 54.9 | 30.4 | 55.7 | 49.7 | 54.7 | 50.7 | 71.7 | 72 | 98.9 | |
16. 서열 168 | 57.2 | 34.8 | 54.8 | 34 | 47.9 | 55.1 | 30.2 | 55.6 | 51 | 54.8 | 50.8 | 71.9 | 72.2 | 98.7 | 99.7 |
17. 서열 170 | 41.2 | 47.2 | 38.9 | 46.4 | 41.3 | 38.4 | 46.8 | 38.6 | 36.9 | 37.5 | 38.3 | 40.8 | 40.8 | 39.6 | 40 |
18. 서열 172 | 51.9 | 34.8 | 52.1 | 38.9 | 52 | 54.4 | 32.2 | 50.4 | 43.9 | 49.9 | 52.9 | 46.6 | 46.6 | 44.3 | 43.7 |
19. 서열 174 | 46.4 | 34.9 | 43.4 | 40.8 | 51.2 | 46.7 | 31.5 | 48.2 | 40.9 | 42.8 | 44 | 43.3 | 43.6 | 42.2 | 42.7 |
20. 서열 176 | 50 | 38.6 | 49.6 | 40.1 | 52.7 | 49 | 32.8 | 48.2 | 44.7 | 47.6 | 45.5 | 48 | 48 | 44.6 | 45.1 |
21. 서열 178 | 41.7 | 46.9 | 44.5 | 47.7 | 47 | 45 | 44.3 | 42.5 | 39.6 | 42.5 | 44.6 | 45 | 45.3 | 39.6 | 40.3 |
22. 서열 180 | 47.5 | 36.5 | 40.8 | 35.9 | 44.9 | 42.1 | 32.8 | 44.1 | 38.1 | 39.4 | 42.8 | 46.6 | 46.6 | 42.7 | 42.4 |
23. 서열 182 | 32.3 | 50 | 32.7 | 50.7 | 36.8 | 33.2 | 47 | 32.1 | 31.1 | 31.5 | 32.2 | 31.8 | 31.8 | 32.5 | 32.8 |
24. 서열 184 | 39 | 55.1 | 37.2 | 53.5 | 43.1 | 39.8 | 44.9 | 37.3 | 36.9 | 36.6 | 39.8 | 36.3 | 36.3 | 34.3 | 34.7 |
25. 서열 186 | 40.6 | 35.7 | 42 | 41.3 | 50.6 | 42.1 | 32 | 44.4 | 42.7 | 42.5 | 40.7 | 39.7 | 39.7 | 40.1 | 39.5 |
26. 서열 188 | 31.8 | 37.9 | 34.1 | 41.4 | 39.2 | 33.8 | 38.4 | 32.1 | 33.1 | 33 | 35.8 | 34.1 | 34.1 | 33 | 33.6 |
27. 서열 190 | 60.2 | 34.1 | 59.1 | 36.8 | 48.1 | 59.4 | 33.6 | 58.9 | 54.3 | 57.5 | 54.6 | 59.7 | 59.7 | 60.7 | 61.3 |
28. 서열 192 | 39.5 | 41.2 | 38 | 42 | 38.6 | 39.8 | 38 | 38.9 | 37.4 | 36.9 | 39.5 | 39.4 | 39.4 | 38 | 39.5 |
29. 서열 194 | 53.9 | 37 | 54.6 | 38.2 | 47.9 | 55.3 | 34.9 | 50.1 | 46.7 | 53.2 | 53.6 | 57.5 | 57.5 | 58.3 | 57.6 |
30. 서열 196 | 44.2 | 48.8 | 44.5 | 51.2 | 41.3 | 43.8 | 49.2 | 40.5 | 37.6 | 41.4 | 41.9 | 39.1 | 39.1 | 41.2 | 40 |
31. 서열 198 | 29.6 | 35.5 | 33.5 | 34 | 33.2 | 32.7 | 32 | 32.3 | 29.5 | 34.1 | 35.2 | 33.8 | 33.8 | 31.1 | 31.5 |
32. 서열 200 | 56.6 | 32.8 | 55.6 | 37 | 49.9 | 55.3 | 33.3 | 56.1 | 52.3 | 54 | 51.4 | 61.5 | 61.5 | 62.8 | 62.8 |
33. 서열 202 | 56.6 | 34.9 | 57.4 | 37.6 | 49.7 | 57.9 | 31 | 60.8 | 56.8 | 55.3 | 53.4 | 63.8 | 64 | 64.1 | 64.3 |
34. 서열 204 | 56.5 | 34.1 | 57.6 | 37.6 | 49.3 | 57.6 | 30.7 | 60.5 | 55.1 | 56.3 | 53.3 | 62.7 | 62.9 | 62.8 | 63.5 |
35. 서열 206 | 60 | 34.1 | 57.9 | 36.5 | 50.4 | 58.9 | 32.5 | 57.6 | 52.5 | 56.5 | 53.3 | 59.5 | 59.5 | 59.6 | 60.3 |
36. 서열 208 | 59.1 | 32.8 | 56.6 | 35.2 | 49.3 | 57.7 | 32 | 56.6 | 51.3 | 55.3 | 52 | 58.5 | 58.5 | 58.6 | 59.2 |
37. 서열 210 | 44.2 | 48.5 | 43.4 | 52.3 | 42.8 | 43.3 | 45.8 | 42.7 | 39.6 | 40.8 | 42.5 | 43.6 | 43.6 | 41.7 | 41.3 |
38. 서열 212 | 55.4 | 34.9 | 51.8 | 34.6 | 50 | 53.3 | 33.1 | 57.4 | 57.6 | 50 | 47.7 | 64.6 | 64.9 | 65.6 | 65.4 |
39. 서열 214 | 50.3 | 37 | 49.6 | 38.6 | 46.1 | 51.3 | 37 | 48.8 | 44.9 | 47.3 | 52.1 | 54.2 | 54.5 | 53.6 | 54.1 |
40. 서열 216 | 53.5 | 30.8 | 50.8 | 34.1 | 49 | 51.8 | 33.1 | 52.8 | 55.6 | 49.2 | 48.2 | 59.8 | 60.1 | 59.8 | 59.6 |
41. 서열 218 | 39 | 43.3 | 40 | 45.6 | 41.6 | 37.2 | 42.1 | 40 | 37.9 | 37.7 | 41 | 39.9 | 39.7 | 39.3 | 38.4 |
42. 서열 220 | 38.7 | 45.3 | 42 | 47.3 | 42.5 | 40.4 | 46.5 | 37.5 | 40.7 | 37.2 | 40.4 | 40.5 | 40.5 | 40.4 | 40 |
43. 서열 222 | 32.6 | 47.7 | 32.7 | 49.3 | 35.3 | 33 | 51.5 | 32.9 | 31.3 | 30.4 | 31.3 | 33.2 | 33.2 | 33.5 | 34.7 |
44. 서열 224 | 39.2 | 45.9 | 40.8 | 45.1 | 40.4 | 39.5 | 45.9 | 38.9 | 39.4 | 39.4 | 37.7 | 41.1 | 41.1 | 38.8 | 38.9 |
45. 서열 228 | 40.6 | 43.5 | 39.4 | 45.4 | 41.9 | 40.1 | 42.4 | 40.8 | 38.9 | 37.5 | 39.8 | 39.1 | 39.1 | 39.8 | 40.5 |
46. 서열 230 | 58 | 34.1 | 53.5 | 38.1 | 48 | 57 | 32 | 59.3 | 59.3 | 51.7 | 53.5 | 64.8 | 64.8 | 64.6 | 64.6 |
47. 서열 232 | 56.6 | 33.9 | 51.3 | 36.1 | 47.4 | 51.6 | 31.8 | 56.1 | 53.8 | 52.1 | 49.2 | 60.3 | 60 | 61.3 | 61.1 |
48. 서열 234 | 56.9 | 35.1 | 52.7 | 35.3 | 48.1 | 53.2 | 31.7 | 53.8 | 54.5 | 50.9 | 50.6 | 57.4 | 57.4 | 61 | 61.3 |
49. 서열 236 | 55.7 | 35.2 | 52.9 | 35.4 | 45.8 | 53.1 | 33.3 | 57 | 56.8 | 49.7 | 50.8 | 55.7 | 56 | 59.4 | 59.1 |
50. 서열 240 | 40.6 | 46.3 | 42.5 | 47.2 | 40.4 | 41.3 | 46.3 | 39.5 | 36.9 | 39.4 | 41.3 | 39.7 | 39.7 | 39.8 | 40.3 |
51. 서열 242 | 42.5 | 40.7 | 44.8 | 43.9 | 40.7 | 44.7 | 43 | 42.2 | 37.6 | 43.1 | 43.4 | 44.1 | 44.1 | 43 | 43.7 |
52. 서열 244 | 33.4 | 40.8 | 29.6 | 38.3 | 32.9 | 32.1 | 41.7 | 32.9 | 27.8 | 28.7 | 31.9 | 35.2 | 35.5 | 32.5 | 32.8 |
53. 서열 246 | 46.1 | 42.6 | 41.4 | 47.3 | 42.8 | 41.3 | 41.6 | 41.6 | 39.4 | 41.7 | 40.4 | 41.6 | 41.1 | 40.6 | 40.8 |
54. 서열 248 | 42.3 | 46.6 | 40.6 | 45.1 | 42.2 | 40.7 | 43.6 | 37.8 | 37.9 | 39.2 | 39.8 | 42.2 | 42.2 | 41.2 | 41.1 |
55. 서열 250 | 43.4 | 40.1 | 44.8 | 43.2 | 48.5 | 45.6 | 37.7 | 45.5 | 42.7 | 43.7 | 44.3 | 43 | 43 | 42.5 | 42.9 |
56. 서열 252 | 46.7 | 38.4 | 47.3 | 39.6 | 60.5 | 47.9 | 34.1 | 47.9 | 42.4 | 45.9 | 48.5 | 44.7 | 45.8 | 42.5 | 42.9 |
57. 서열 254 | 43.4 | 49.5 | 44.2 | 51.6 | 44.9 | 43.8 | 46.2 | 40.5 | 40.2 | 42.5 | 44 | 43 | 43 | 40.1 | 40 |
58. 서열 256 | 36.2 | 44.8 | 38.3 | 45.6 | 40.4 | 39.5 | 45.2 | 36.4 | 36.6 | 36.3 | 38.9 | 38.3 | 38.3 | 38 | 38.7 |
16 | 17 | 18 | 19 | 20 | 21 | 22 | 23 | 24 | 25 | 26 | 27 | 28 | 29 | 30 | ||
1. 서열 132 | 37.6 | 29.6 | 38.3 | 30.1 | 34 | 26.5 | 29.6 | 26 | 27.2 | 27.9 | 23.7 | 41.4 | 27.7 | 38.4 | 32.2 | |
2. 서열 140 | 27.8 | 34.1 | 28.7 | 27.7 | 27.6 | 34.1 | 26.1 | 40.3 | 45.8 | 28.5 | 26.6 | 26.9 | 32.5 | 28.7 | 36.7 | |
3. 서열 142 | 37.4 | 28.5 | 35.2 | 30.7 | 32.4 | 29.1 | 26.6 | 25.8 | 28.2 | 27.8 | 23.5 | 40.1 | 25.3 | 36.7 | 32.8 | |
4. 서열 144 | 27.5 | 35.9 | 30.6 | 32 | 31.3 | 33 | 29.8 | 41.6 | 39.3 | 31.4 | 28.8 | 29.4 | 30.2 | 31.2 | 43.5 | |
5. 서열 146 | 32.5 | 29.3 | 36.3 | 35.7 | 37.5 | 29.5 | 30.2 | 27.5 | 30.3 | 35.9 | 27.6 | 35.4 | 29.7 | 35.4 | 30.3 | |
6. 서열 148 | 38 | 28.4 | 36.9 | 31.6 | 32 | 30.3 | 26.9 | 26.9 | 28.7 | 29.3 | 23.5 | 40.9 | 26.5 | 38 | 33.3 | |
7. 서열 150 | 25.7 | 33.3 | 25.1 | 24 | 24.6 | 31.7 | 21.8 | 36.7 | 31 | 24.2 | 26.9 | 28 | 28 | 25.4 | 38.1 | |
8. 서열 152 | 36.4 | 28.3 | 37.2 | 32 | 31.6 | 30.1 | 27.9 | 25.8 | 28.6 | 32.2 | 23.4 | 42 | 28.7 | 37.5 | 31.1 | |
9. 서열 154 | 35.7 | 25.3 | 31.7 | 30.1 | 31 | 26.2 | 23.8 | 24.7 | 28.8 | 28.1 | 23.6 | 37.8 | 26.2 | 33.6 | 27.5 | |
10. 서열 156 | 36.4 | 27.3 | 33.2 | 30.2 | 31.4 | 27.7 | 24.6 | 24.7 | 24.5 | 26.2 | 22.4 | 39 | 24.2 | 35.3 | 30.5 | |
11. 서열 158 | 34.5 | 28 | 33.7 | 29.3 | 28.3 | 29.1 | 25.3 | 25.8 | 27.8 | 26.6 | 23.6 | 37.1 | 25.9 | 34.9 | 30.1 | |
12. 서열 160 | 63 | 28.5 | 32.4 | 28 | 30.2 | 31.3 | 27.3 | 24.9 | 25.7 | 27.2 | 24.9 | 43.4 | 29.1 | 42.9 | 28.9 | |
13. 서열 162 | 63 | 28.5 | 32.4 | 28.2 | 30.2 | 31 | 27.3 | 24.9 | 25.7 | 27.2 | 24.7 | 43.7 | 29.1 | 42.9 | 28.9 | |
14. 서열 164 | 98.7 | 29.3 | 32.6 | 27.9 | 29.9 | 27.7 | 26.1 | 24.5 | 26.3 | 27.1 | 24.1 | 42.5 | 27.9 | 44 | 29.1 | |
15. 서열 166 | 99.7 | 29.6 | 31.9 | 28.2 | 30.2 | 28.3 | 26.4 | 24.8 | 26.6 | 27.9 | 24.9 | 42.9 | 29.6 | 43.9 | 28.3 | |
16. 서열 168 | 29.7 | 31.9 | 28.3 | 30.3 | 28.1 | 26.7 | 24.9 | 26.7 | 28.5 | 23.9 | 43 | 29.4 | 44.8 | 29.5 | ||
17. 서열 170 | 40.1 | 30.7 | 29.6 | 29.3 | 31.6 | 24.8 | 36.1 | 35.6 | 28.5 | 26.5 | 28.9 | 30.4 | 31.6 | 34.9 | ||
18. 서열 172 | 43.6 | 40.6 | 31.4 | 32.6 | 30.1 | 28.3 | 28.8 | 28.5 | 32.5 | 24.4 | 33.8 | 26.4 | 32.5 | 28.1 | ||
19. 서열 174 | 42.8 | 42.7 | 46.2 | 47.1 | 30.5 | 30.9 | 30.5 | 28.9 | 35.3 | 24.5 | 29.3 | 28.8 | 27.4 | 28.7 | ||
20. 서열 176 | 45.2 | 41.3 | 50.3 | 59.3 | 28.9 | 30.3 | 27.9 | 29.2 | 34.3 | 24.6 | 29.8 | 28.5 | 29.9 | 29.7 | ||
21. 서열 178 | 40.1 | 45 | 45.6 | 44.5 | 45.9 | 27 | 30.2 | 28.6 | 26.1 | 27.9 | 31.4 | 28.4 | 31.2 | 33.7 | ||
22. 서열 180 | 42.8 | 38 | 42.1 | 47.2 | 47.1 | 41.4 | 25.8 | 25 | 26.5 | 26.1 | 28 | 27.5 | 30 | 24.7 | ||
23. 서열 182 | 32.9 | 46.8 | 39.2 | 38 | 37.7 | 42.7 | 35 | 37.4 | 27.6 | 28.6 | 23.9 | 33.5 | 26.6 | 31.3 | ||
24. 서열 184 | 34.5 | 48.8 | 38.6 | 40.5 | 38.6 | 43.1 | 37.1 | 44.4 | 30.6 | 27.2 | 24.6 | 30.6 | 28.3 | 35.4 | ||
25. 서열 186 | 39.6 | 40.7 | 45 | 51.2 | 50.2 | 39.8 | 38 | 33.9 | 37.9 | 26.9 | 29.2 | 28.5 | 27.3 | 26.6 | ||
26. 서열 188 | 33.7 | 44 | 33 | 37.4 | 36.8 | 41.6 | 35.3 | 37.9 | 39.5 | 39.8 | 23.3 | 41.3 | 25.7 | 25.2 | ||
27. 서열 190 | 61.5 | 39.2 | 49.7 | 44.9 | 45.2 | 46.2 | 45.4 | 32.5 | 34.7 | 43 | 33.9 | 27.1 | 52.8 | 32.8 | ||
28. 서열 192 | 39.6 | 43.2 | 37.1 | 39.9 | 39.8 | 47.7 | 41.4 | 40.8 | 43.6 | 37.6 | 56.4 | 37.4 | 29.5 | 26.5 | ||
29. 서열 194 | 59.1 | 42.2 | 45.3 | 47.1 | 46.5 | 45.3 | 45 | 36.4 | 38.8 | 43.1 | 37 | 66.9 | 41.9 | 31 | ||
30. 서열 196 | 41.4 | 51.2 | 39.8 | 41.4 | 42.2 | 53.1 | 39.6 | 41.5 | 50.8 | 38.2 | 42.7 | 45.4 | 44.6 | 43.4 | ||
31. 서열 198 | 31.6 | 43.8 | 33.9 | 35.2 | 30.4 | 42 | 34 | 36.3 | 40.6 | 33.5 | 39.5 | 34.4 | 41 | 32.1 | 41.5 | |
32. 서열 200 | 62 | 40.8 | 47.8 | 41.3 | 44.4 | 44.2 | 45 | 32.6 | 32.6 | 40.3 | 33.9 | 80.4 | 37.5 | 73.9 | 42.4 | |
33. 서열 202 | 64.3 | 38.4 | 47.9 | 45.8 | 47.9 | 44.7 | 46.6 | 32.5 | 36.8 | 41.3 | 35.2 | 71.7 | 35.2 | 62.2 | 44.7 | |
34. 서열 204 | 63.5 | 38.1 | 48.3 | 45.6 | 47.5 | 43.5 | 45.9 | 31.7 | 36 | 41.1 | 33.6 | 71.7 | 35.7 | 61.3 | 45.1 | |
35. 서열 206 | 60.3 | 41.9 | 50.7 | 44 | 46.4 | 45.1 | 44.8 | 33.9 | 36 | 39.7 | 36.3 | 90.7 | 38.4 | 66.7 | 46.1 | |
36. 서열 208 | 59.4 | 41.7 | 49.6 | 43.9 | 47.4 | 45.5 | 46.1 | 34.4 | 36.3 | 40.1 | 36.6 | 89.2 | 38.8 | 67.8 | 46.1 | |
37. 서열 210 | 42.2 | 55.7 | 43 | 43.6 | 43.2 | 50.8 | 40.5 | 41.3 | 51.1 | 37.9 | 40.5 | 45.7 | 46.2 | 43.4 | 81.4 | |
38. 서열 212 | 65.9 | 40.3 | 47.4 | 43.1 | 45.9 | 43.6 | 43.1 | 33.3 | 33.8 | 41.3 | 33.3 | 67.2 | 35.4 | 57.4 | 44.4 | |
39. 서열 214 | 54.3 | 40.8 | 44.7 | 43.9 | 44.1 | 47.6 | 41.1 | 34.5 | 37 | 41.9 | 32.9 | 58.9 | 36.7 | 53.5 | 48.6 | |
40. 서열 216 | 59.8 | 35.6 | 49.2 | 43.4 | 45.7 | 42.7 | 42.2 | 30.3 | 32.6 | 39.9 | 33.1 | 63.9 | 35.9 | 55.1 | 41.4 | |
41. 서열 218 | 38.2 | 62.5 | 39.2 | 39.9 | 41.6 | 50.8 | 44.5 | 44.4 | 40.6 | 37.9 | 41.8 | 40.1 | 42.5 | 44.3 | 50.6 | |
42. 서열 220 | 40.6 | 59.4 | 38 | 38.6 | 40.1 | 48.1 | 40.5 | 47.3 | 45.3 | 38.5 | 44.1 | 38.4 | 43 | 43.4 | 50.8 | |
43. 서열 222 | 34.5 | 50.8 | 32.5 | 30.8 | 35 | 42.7 | 35.9 | 51 | 40.7 | 34.5 | 44.4 | 32.5 | 41.2 | 38.5 | 41.9 | |
44. 서열 224 | 38.8 | 60.4 | 38 | 39.6 | 40.4 | 47.3 | 41.4 | 45.9 | 45.9 | 38.2 | 42 | 38.2 | 43.9 | 42.5 | 50 | |
45. 서열 228 | 40.4 | 62.6 | 40.1 | 39.6 | 41.3 | 50.4 | 42.3 | 44.3 | 42 | 39.8 | 43.5 | 41.1 | 42.7 | 45 | 51.1 | |
46. 서열 230 | 64.3 | 39.9 | 50.4 | 45.1 | 46.5 | 45.9 | 44.4 | 33.3 | 34.9 | 42 | 36 | 69.3 | 36.2 | 61.2 | 43.6 | |
47. 서열 232 | 61.8 | 39.2 | 46.3 | 40.8 | 43.4 | 43.7 | 43.4 | 31.3 | 35.8 | 38.4 | 32.6 | 67.4 | 36.8 | 56.8 | 42.1 | |
48. 서열 234 | 61.3 | 39 | 43.9 | 42.3 | 47 | 44.2 | 47.3 | 32.5 | 36.1 | 39 | 33 | 63.4 | 37.7 | 54.3 | 42.3 | |
49. 서열 236 | 59.4 | 39.6 | 45.6 | 44.5 | 46.9 | 43.2 | 41.9 | 33.3 | 37 | 39.1 | 33.6 | 63.5 | 35.4 | 53.1 | 41.9 | |
50. 서열 240 | 40.4 | 94.4 | 39.8 | 40.2 | 42.9 | 44.7 | 40.5 | 45.9 | 50 | 37.6 | 43.1 | 41.1 | 42 | 43.4 | 51.9 | |
51. 서열 242 | 43.6 | 47.2 | 43.6 | 42.1 | 41.3 | 44.9 | 43.3 | 37.4 | 42.3 | 37.9 | 34.1 | 48.4 | 39 | 48.3 | 58 | |
52. 서열 244 | 31.8 | 47.6 | 29.5 | 33.3 | 33.1 | 45 | 33.1 | 35.4 | 39.1 | 32.3 | 42.9 | 33.6 | 39.6 | 36.4 | 41.2 | |
53. 서열 246 | 41.2 | 46 | 41.8 | 41.7 | 41.9 | 47.7 | 44.5 | 35.2 | 43.6 | 37.6 | 37.6 | 48.4 | 41.6 | 45 | 81.2 | |
54. 서열 248 | 40.4 | 62.1 | 43 | 39.6 | 42.2 | 51.1 | 43.6 | 46.2 | 47 | 41.3 | 42.4 | 41.9 | 47 | 47.1 | 53.8 | |
55. 서열 250 | 43 | 45.9 | 47.4 | 45.3 | 45 | 42.6 | 44.4 | 37.7 | 43.8 | 44.7 | 35.6 | 50.5 | 40.4 | 48 | 55.3 | |
56. 서열 252 | 43.9 | 40.9 | 47.7 | 45.4 | 51.4 | 46 | 43.9 | 36.6 | 40.2 | 45.7 | 35.4 | 46.8 | 39.9 | 46.6 | 41.8 | |
57. 서열 154 | 40.4 | 55.7 | 41.8 | 44.2 | 43.2 | 52 | 41.1 | 41 | 46.9 | 38.2 | 38.5 | 45.2 | 42.9 | 42.8 | 63.7 | |
58. 서열 156 | 39.3 | 58.3 | 37.4 | 38.6 | 41.3 | 46.2 | 40.8 | 44 | 46 | 40.4 | 40.9 | 36.8 | 42.5 | 42.8 | 50 |
31 | 32 | 33 | 34 | 35 | 36 | 37 | 38 | 39 | 40 | 41 | 42 | 43 | 44 | 45 | |
1. 서열 132 | 20.3 | 41.3 | 41.2 | 41 | 40.3 | 39.4 | 31.4 | 42 | 34.5 | 38.4 | 26.8 | 29.5 | 24.2 | 28.2 | 27 |
2. 서열 140 | 24 | 25.8 | 27 | 26.4 | 25.1 | 26.3 | 36.6 | 26.9 | 26.8 | 25.5 | 33.1 | 33.3 | 35.4 | 33.1 | 33.7 |
3. 서열 142 | 21.5 | 40.3 | 41.2 | 40.5 | 38.7 | 37 | 29.9 | 38.4 | 34.3 | 35.7 | 26.3 | 28 | 24 | 27.9 | 26.2 |
4. 서열 144 | 24.1 | 30.1 | 30.4 | 30.2 | 28.9 | 28.5 | 42.8 | 27.8 | 29.4 | 27.3 | 34.2 | 37.5 | 33.9 | 37 | 34.8 |
5. 서열 146 | 21.5 | 36.8 | 34.5 | 33.8 | 36.9 | 36.2 | 29.7 | 35 | 29.4 | 34.9 | 29.3 | 29.1 | 25.1 | 28.3 | 27.8 |
6. 서열 148 | 21.2 | 41.3 | 43.1 | 42 | 40.6 | 38.9 | 31.2 | 39.9 | 35.6 | 37.2 | 27.4 | 27.8 | 24.4 | 27.7 | 27.2 |
7. 서열 150 | 23 | 26.9 | 26.1 | 25.8 | 26.7 | 26.3 | 39.4 | 25.6 | 26.3 | 25.3 | 33.7 | 34.8 | 35.8 | 34.8 | 32.8 |
8. 서열 152 | 21 | 41.1 | 43 | 43 | 41.1 | 40.1 | 29.8 | 43.2 | 35.9 | 39.7 | 27 | 29.1 | 25.2 | 28 | 27.2 |
9. 서열 154 | 20.8 | 37.1 | 40 | 38.7 | 35.9 | 35.5 | 28.3 | 38.8 | 30.8 | 38.1 | 27.2 | 29.4 | 23.5 | 27.9 | 26.7 |
10. 서열 156 | 21.3 | 39.5 | 39.9 | 39.5 | 38.5 | 36.8 | 28 | 36.9 | 32.5 | 34.6 | 25.8 | 26.2 | 22.6 | 27.6 | 25.1 |
11. 서열 158 | 23.7 | 38.1 | 40 | 38.8 | 36.8 | 35.1 | 29.6 | 35.4 | 35.7 | 34.2 | 25.7 | 26.8 | 22.7 | 26.5 | 26.5 |
12. 서열 160 | 23.2 | 47.2 | 48.8 | 47.9 | 44.3 | 43.6 | 32.2 | 52.1 | 39.1 | 46.6 | 28.4 | 30.7 | 25.4 | 30.1 | 28.4 |
13. 서열 162 | 23.2 | 46.9 | 48.8 | 47.6 | 44.1 | 43.3 | 32.2 | 52.1 | 39.1 | 46.6 | 28.4 | 30.9 | 25.4 | 30.4 | 28.4 |
14. 서열 164 | 21.8 | 45.8 | 47 | 45.3 | 43.9 | 43.9 | 29.8 | 50.9 | 38.2 | 45.8 | 28.5 | 30.3 | 24.8 | 30 | 29 |
15. 서열 166 | 21.5 | 46 | 47.3 | 45.5 | 43.8 | 43.8 | 30.1 | 51.1 | 38.8 | 46 | 28 | 30.1 | 24.3 | 29.8 | 28.3 |
16. 서열 168 | 21.3 | 45.9 | 47.6 | 45.9 | 44.4 | 44.4 | 30.2 | 52.5 | 39.2 | 46.6 | 28.3 | 31 | 24.3 | 29.9 | 28.3 |
17. 서열 170 | 24.5 | 30.8 | 28.1 | 28.3 | 30.8 | 30.2 | 36.9 | 28.5 | 27.3 | 26.1 | 45 | 44.1 | 39.2 | 44.3 | 45.2 |
18. 서열 172 | 21.6 | 34.3 | 32.2 | 32.2 | 34 | 33.2 | 28.9 | 34.3 | 28.8 | 36.2 | 27 | 28.4 | 25.6 | 25.4 | 27.5 |
19. 서열 174 | 23.5 | 26.9 | 30.2 | 29.9 | 28.3 | 27.8 | 28.4 | 28 | 24.9 | 27.8 | 25 | 25.9 | 22 | 27.9 | 24.9 |
20. 서열 176 | 19 | 30.4 | 31.2 | 31.3 | 29.7 | 29.8 | 28.5 | 30.1 | 25.9 | 30.3 | 25.2 | 26.7 | 23.1 | 28 | 25.8 |
21. 서열 178 | 23.9 | 32.5 | 33.2 | 33.2 | 31.4 | 31.9 | 32.7 | 32 | 31.5 | 31.5 | 33.9 | 31 | 28.6 | 31.4 | 33.1 |
22. 서열 180 | 20.5 | 27.9 | 29.8 | 29.2 | 27.6 | 28.3 | 24.8 | 27.3 | 22.1 | 25.2 | 27.2 | 26.4 | 23 | 26.1 | 25.8 |
23. 서열 182 | 24.2 | 24 | 24.3 | 24.5 | 24.8 | 25.1 | 32 | 24.4 | 24.5 | 23.7 | 35.2 | 37.5 | 33.2 | 37.4 | 35.5 |
24. 서열 184 | 24.9 | 24.5 | 27.1 | 26.5 | 24.9 | 25.6 | 36 | 25.4 | 25.4 | 24.4 | 29.6 | 30.5 | 26.8 | 31 | 29.4 |
25. 서열 186 | 23.1 | 27.6 | 28 | 27.7 | 27.3 | 26.2 | 25.2 | 28.5 | 24.2 | 27.9 | 25.8 | 24.8 | 23.1 | 25.5 | 25.5 |
26. 서열 188 | 23.8 | 24.7 | 23.3 | 22 | 24.9 | 25.3 | 25.1 | 24.3 | 20.9 | 23.6 | 28.2 | 27.8 | 26.9 | 25.6 | 27 |
27. 서열 190 | 21 | 69.5 | 54.9 | 54.5 | 84.3 | 82.1 | 33.6 | 51.3 | 44.6 | 49.5 | 28.7 | 27.6 | 23.9 | 28.2 | 29 |
28. 서열 192 | 26.7 | 26.7 | 25.2 | 25.2 | 26.5 | 27.2 | 27.1 | 26.1 | 23.5 | 27 | 27.4 | 29.1 | 27.9 | 28.4 | 27 |
29. 서열 194 | 21.3 | 68.5 | 48.7 | 48.3 | 54.5 | 55.4 | 31.7 | 44.9 | 35.9 | 44.2 | 30.4 | 31.6 | 28.4 | 31.3 | 30.7 |
30. 서열 196 | 21.9 | 32.3 | 32.5 | 32.7 | 35.2 | 34 | 72.7 | 32.3 | 34.2 | 28.9 | 32.3 | 33.9 | 28.7 | 33 | 32.9 |
31. 서열 198 | 20.9 | 18.9 | 18.8 | 20.2 | 20.5 | 23 | 22.1 | 21 | 20.9 | 24.3 | 24.4 | 26.5 | 24.9 | 25.3 | |
32. 서열 200 | 31.5 | 59.9 | 59.5 | 69.4 | 67.4 | 32.3 | 55.1 | 45.4 | 52.9 | 28.1 | 28.8 | 23.5 | 28.5 | 27.3 | |
33. 서열 202 | 30.7 | 72.9 | 96.3 | 56.1 | 55.1 | 33.2 | 66.1 | 54 | 58.6 | 30.5 | 28.5 | 24.1 | 28.9 | 30.7 | |
34. 서열 204 | 30.7 | 71.8 | 97.1 | 55.8 | 54.7 | 33.5 | 65.1 | 53 | 57.1 | 29.7 | 28.9 | 24.3 | 27.7 | 30.4 | |
35. 서열 206 | 32 | 81.1 | 72.2 | 72 | 97.3 | 34.4 | 53.5 | 45.8 | 49.5 | 28.8 | 28.9 | 25.3 | 27.2 | 28.8 | |
36. 서열 208 | 32.8 | 79.1 | 70.6 | 70.4 | 97.9 | 33.5 | 52.5 | 44.7 | 48 | 28.4 | 28.1 | 24.7 | 27.1 | 28.4 | |
37. 서열 210 | 43.6 | 43.2 | 43.7 | 43.2 | 45.9 | 46.6 | 32.1 | 32 | 30.6 | 35.8 | 36.5 | 32.5 | 32.4 | 36 | |
38. 서열 212 | 31.8 | 69 | 79.7 | 78.7 | 68.7 | 67.4 | 42.8 | 75.1 | 69.5 | 27.9 | 29 | 25.4 | 29.2 | 29.5 | |
39. 서열 214 | 33.5 | 56.1 | 66.9 | 66.1 | 58.7 | 58.3 | 46.4 | 77.7 | 52.9 | 25.4 | 26.9 | 23.4 | 25.9 | 26.7 | |
40. 서열 216 | 32.3 | 64.9 | 72.5 | 70.7 | 63.9 | 61.6 | 40.9 | 83.1 | 64.4 | 27 | 29.5 | 24 | 29.2 | 27.5 | |
41. 서열 218 | 43.7 | 42.6 | 41.3 | 40 | 40.5 | 39.3 | 51.1 | 40.3 | 40.1 | 37.6 | 62.8 | 65.8 | 61.9 | 95.8 | |
42. 서열 220 | 41.8 | 40.6 | 37.8 | 38.1 | 41.1 | 39 | 54.5 | 36.9 | 39.2 | 36.4 | 74.3 | 47.3 | 94.1 | 64.2 | |
43. 서열 222 | 38.7 | 35.1 | 33.1 | 33.3 | 33.1 | 33.3 | 44.3 | 34.1 | 33.2 | 32.8 | 69 | 54.3 | 46.5 | 68.8 | |
44. 서열 224 | 40.6 | 40.3 | 39.4 | 38.1 | 36.8 | 37.4 | 49.2 | 37.9 | 38.9 | 36.9 | 72.8 | 96.9 | 54.1 | 62.4 | |
45. 서열 228 | 42.4 | 43.2 | 42.9 | 41.9 | 40.3 | 38.8 | 52.3 | 41.8 | 41.1 | 38.6 | 97.3 | 74.8 | 70.2 | 73.3 | |
46. 서열 230 | 31.5 | 72.1 | 79.5 | 76.9 | 70.1 | 68 | 44.4 | 77.7 | 65.1 | 70.5 | 39.6 | 39.1 | 34.4 | 36.5 | 40.9 |
47. 서열 232 | 30.5 | 68.2 | 74.5 | 72.9 | 68.2 | 66.3 | 42.4 | 74.1 | 62.6 | 65.4 | 38.4 | 40.5 | 31.6 | 38.9 | 40.5 |
48. 서열 234 | 28.8 | 65.6 | 68.3 | 66.5 | 63.4 | 61.3 | 43.9 | 65.9 | 54.5 | 64.4 | 39.7 | 41.6 | 33 | 38.7 | 39.7 |
49. 서열 236 | 28.6 | 63.8 | 69.8 | 67.2 | 65.4 | 63.5 | 44.5 | 70.3 | 57.8 | 64.6 | 40.4 | 40.1 | 34.4 | 39.6 | 41.9 |
50. 서열 240 | 42.6 | 39.5 | 38.4 | 38.7 | 42.4 | 42.3 | 54.5 | 37.2 | 40.4 | 36.4 | 61.3 | 58.2 | 52 | 60.8 | 63.4 |
51. 서열 242 | 36.1 | 47.3 | 45.5 | 45.3 | 46.7 | 46.6 | 59 | 46.9 | 46.7 | 43.4 | 45.6 | 45.9 | 37 | 45.2 | 45.6 |
52. 서열 244 | 40.2 | 32.6 | 31 | 31.2 | 33.9 | 33.9 | 42.8 | 31.5 | 35.1 | 31.1 | 42.9 | 43.8 | 40.8 | 42.4 | 40.8 |
53. 서열 246 | 39.3 | 42.9 | 44.4 | 44.5 | 47.5 | 47.4 | 75.5 | 46.7 | 51.4 | 42.9 | 43.3 | 47 | 37.9 | 46.3 | 45 |
54. 서열 248 | 40.2 | 42.9 | 40.2 | 39.5 | 41.3 | 40.7 | 55.3 | 40.3 | 44.2 | 37.4 | 56.1 | 62.1 | 49.2 | 61.4 | 58 |
55. 서열 250 | 34.3 | 46.8 | 45.2 | 46.9 | 46.9 | 46.3 | 55.6 | 46.7 | 47.4 | 43.4 | 43.2 | 43.8 | 34 | 41.9 | 42.6 |
56. 서열 252 | 36 | 43.7 | 45.8 | 43.2 | 45.1 | 45 | 40.9 | 41.5 | 43 | 43.4 | 38.7 | 39 | 29.9 | 39.9 | 36.6 |
57. 서열 254 | 39.9 | 42.9 | 45.5 | 45.1 | 46.1 | 45.5 | 64.1 | 44.4 | 47 | 43.2 | 48 | 49.1 | 38.5 | 48 | 48.7 |
58. 서열 256 | 41.8 | 39.3 | 41.3 | 41.3 | 37.3 | 37.4 | 51.9 | 40 | 39.8 | 38.1 | 62.5 | 66 | 50.4 | 67.5 | 61.1 |
46 | 47 | 48 | 49 | 50 | 51 | 52 | 53 | 54 | 55 | 56 | 57 | 58 | |
1. 서열 132 | 41 | 41.4 | 40.8 | 41.6 | 28.6 | 29.8 | 21.5 | 33.4 | 27.9 | 32.1 | 33.3 | 31.5 | 26.6 |
2. 서열 140 | 28.1 | 27.1 | 26.8 | 27 | 36.4 | 31.3 | 26.8 | 31.8 | 36.4 | 31.1 | 28.4 | 37.8 | 33.2 |
3. 서열 142 | 38.8 | 38.3 | 38.6 | 36.2 | 30.3 | 30.5 | 20.2 | 27.2 | 29 | 30.2 | 31.3 | 32.4 | 26.8 |
4. 서열 144 | 31.3 | 28.4 | 29.2 | 31.1 | 35.1 | 33.7 | 23.5 | 37.8 | 34.6 | 35 | 30.5 | 43.8 | 36.2 |
5. 서열 146 | 34.8 | 34.4 | 35.8 | 34.5 | 27.8 | 30.4 | 21.5 | 28.1 | 28.1 | 31.9 | 49.7 | 31.5 | 29.6 |
6. 서열 148 | 43.4 | 39.7 | 39.8 | 37.9 | 29.5 | 32.2 | 21.5 | 29.4 | 28.9 | 30.3 | 31 | 34.5 | 26.7 |
7. 서열 150 | 26.2 | 25 | 24.9 | 25.3 | 33.2 | 33.7 | 29.1 | 34.1 | 35.1 | 31 | 25.5 | 37.7 | 35.7 |
8. 서열 152 | 45.3 | 42.4 | 40.8 | 39.5 | 28.3 | 30.4 | 22.1 | 28.6 | 28.1 | 30.7 | 35.7 | 31 | 25.4 |
9. 서열 154 | 43.1 | 37.4 | 36.8 | 39.7 | 26 | 27.8 | 19.8 | 27.1 | 27.3 | 30.6 | 30.2 | 28.7 | 27.8 |
10. 서열 156 | 39.2 | 37.9 | 37.5 | 34.5 | 28.7 | 27.7 | 19.9 | 27.4 | 27 | 29.1 | 28.8 | 30.8 | 26.8 |
11. 서열 158 | 40.9 | 37 | 38.6 | 37 | 29.5 | 29.8 | 21.1 | 27 | 27.4 | 29.2 | 31 | 32.9 | 26.5 |
12. 서열 160 | 49.3 | 46.3 | 44.8 | 44.4 | 28.3 | 30.8 | 24.1 | 29.9 | 29.7 | 29.3 | 31.1 | 32.2 | 27 |
13. 서열 162 | 49.3 | 46 | 45.1 | 44.4 | 28.3 | 30.8 | 24.4 | 29.1 | 30 | 29.3 | 31.6 | 32.5 | 27 |
14. 서열 164 | 46.6 | 42.3 | 43.2 | 42.6 | 29.7 | 31 | 22.6 | 28.3 | 29.2 | 29.9 | 30.6 | 29.8 | 28.8 |
15. 서열 166 | 47.1 | 42.7 | 43.6 | 42.8 | 30.1 | 31.8 | 21.8 | 28.8 | 29.3 | 30.2 | 30.8 | 29.6 | 28.8 |
16. 서열 168 | 46.7 | 42.7 | 44 | 43.1 | 30.1 | 31.4 | 21.7 | 28.6 | 28.8 | 30.3 | 31.9 | 30.2 | 28.6 |
17. 서열 170 | 30.2 | 29.1 | 29.1 | 28.4 | 90.8 | 32.5 | 29 | 34.3 | 41.2 | 31.4 | 27.5 | 35.4 | 42.8 |
18. 서열 172 | 34.9 | 31.7 | 31.5 | 33.5 | 29.8 | 28.7 | 19.5 | 26.9 | 29.7 | 31.5 | 36 | 30.1 | 27.9 |
19. 서열 174 | 31.1 | 28 | 28 | 30.8 | 29 | 28.3 | 21.1 | 26.9 | 29.4 | 28.8 | 32.4 | 25.5 | 28.6 |
20. 서열 176 | 31.6 | 29.9 | 32.2 | 33 | 28.7 | 26.5 | 22.5 | 28 | 25.5 | 27.1 | 35.9 | 30.8 | 27.7 |
21. 서열 178 | 35.5 | 33.3 | 31.4 | 32.2 | 31.2 | 28.9 | 26.6 | 30.1 | 31.4 | 29.3 | 30 | 35 | 30.6 |
22. 서열 180 | 28.2 | 26.4 | 29.6 | 29 | 26.7 | 27.1 | 19.6 | 24.1 | 25.7 | 24.1 | 27.4 | 26.8 | 27.5 |
23. 서열 182 | 24.1 | 24.5 | 25.7 | 26.8 | 36.2 | 28.9 | 23.6 | 27 | 33 | 28 | 27.7 | 33.3 | 35.2 |
24. 서열 184 | 27.4 | 25.7 | 25.6 | 26.2 | 34.9 | 31.8 | 23.7 | 32.8 | 33.6 | 30.6 | 29.8 | 34.2 | 33 |
25. 서열 186 | 30 | 28.3 | 27 | 29 | 28.2 | 25.4 | 22.6 | 25.6 | 25.8 | 28 | 32.4 | 26.9 | 28.3 |
26. 서열 188 | 23.6 | 21.3 | 22.1 | 24.8 | 27.5 | 23.1 | 27.9 | 23 | 29.1 | 23.2 | 25.8 | 23.4 | 28.3 |
27. 서열 190 | 52 | 49.7 | 46.2 | 45.1 | 28.6 | 37.1 | 22.2 | 32.2 | 28.9 | 36.1 | 32.2 | 35.1 | 27.2 |
28. 서열 192 | 27.5 | 26.1 | 27.8 | 26.9 | 29.1 | 26.4 | 24.7 | 24.6 | 30.4 | 24.9 | 28.7 | 27.4 | 29.2 |
29. 서열 194 | 46.2 | 45.3 | 41.8 | 40.1 | 31.5 | 32.8 | 26.6 | 31.3 | 33.2 | 30.9 | 32.6 | 31.4 | 30.7 |
30. 서열 196 | 34.1 | 31.4 | 31 | 30.9 | 37.3 | 44.6 | 26.2 | 77.7 | 33.2 | 46.2 | 28.8 | 51.1 | 34.9 |
31. 서열 198 | 18.9 | 19.2 | 19.9 | 19.9 | 23.7 | 20 | 24.9 | 21.4 | 22.5 | 23.7 | 22.8 | 22.1 | 25.1 |
32. 서열 200 | 57.4 | 55.4 | 48.4 | 46.9 | 30.1 | 35.5 | 22.1 | 32.4 | 31.5 | 34.5 | 32 | 34.5 | 29.7 |
33. 서열 202 | 67.1 | 59.2 | 53.5 | 54.4 | 28.6 | 33.8 | 20.4 | 31.5 | 30.3 | 33.2 | 31.1 | 35 | 31 |
34. 서열 204 | 66 | 58 | 51.1 | 52.5 | 28.8 | 31.1 | 20.3 | 31.2 | 28.6 | 34 | 30.5 | 34.6 | 31 |
35. 서열 206 | 51.8 | 49 | 45.6 | 45.3 | 30.2 | 34.7 | 22.3 | 33.5 | 29.5 | 34.5 | 30.7 | 36.8 | 28.3 |
36. 서열 208 | 50.3 | 47.8 | 44.2 | 44.2 | 29.6 | 34.8 | 22.4 | 32.7 | 28.9 | 33.4 | 30.6 | 36 | 28.7 |
37. 서열 210 | 33.6 | 31.4 | 33.9 | 34 | 38.2 | 44.3 | 26.8 | 67.9 | 37.6 | 46.3 | 29.5 | 48.6 | 33.9 |
38. 서열 212 | 63.7 | 57 | 49.9 | 52.2 | 28 | 34 | 22.3 | 31.6 | 28.4 | 33.8 | 31.2 | 34.3 | 29.6 |
39. 서열 214 | 50.8 | 48.2 | 40.3 | 43.5 | 26.1 | 32.4 | 20.4 | 30.6 | 28.4 | 31 | 25.6 | 34 | 25.4 |
40. 서열 216 | 57.9 | 53.2 | 49.5 | 48.5 | 27.3 | 32.3 | 19.9 | 29.9 | 27.7 | 31.8 | 31.6 | 31 | 27.4 |
41. 서열 218 | 28.6 | 26.6 | 28.8 | 30.1 | 44.4 | 31.5 | 26.3 | 29.1 | 44.6 | 29.4 | 25.3 | 32.2 | 50 |
42. 서열 220 | 30.4 | 30.2 | 30.1 | 31.2 | 45.8 | 32.3 | 25 | 31.5 | 48 | 30.6 | 27.9 | 32.4 | 52.1 |
43. 서열 222 | 26.5 | 24.5 | 24.9 | 25.6 | 37.7 | 26.9 | 28.8 | 25.3 | 37.5 | 25.6 | 21 | 27.1 | 41.8 |
44. 서열 224 | 28.1 | 29.1 | 29.3 | 29.6 | 44.5 | 31.1 | 24.7 | 29.9 | 46.9 | 29.5 | 27.5 | 30.5 | 51.3 |
45. 서열 228 | 29.4 | 27.6 | 29.3 | 30.7 | 45.3 | 31 | 24.8 | 29.7 | 45 | 30.3 | 24.9 | 31.8 | 49.4 |
46. 서열 230 | 68.5 | 52.9 | 51.9 | 30.8 | 33.3 | 22.1 | 31.9 | 31.4 | 35.1 | 32.9 | 36 | 29.1 | |
47. 서열 232 | 80.1 | 46 | 47.6 | 27.8 | 29.5 | 20.5 | 30 | 29.7 | 35.6 | 32.9 | 32.8 | 27.4 | |
48. 서열 234 | 68.3 | 62.6 | 69.4 | 27.5 | 34 | 20.3 | 31.7 | 28.4 | 32.5 | 29.7 | 32.9 | 26 | |
49. 서열 236 | 69.8 | 66.4 | 80.5 | 28.6 | 31.9 | 21.2 | 30.8 | 29.4 | 33.9 | 30.8 | 33.1 | 27.8 | |
50. 서열 240 | 39.9 | 37.9 | 37.4 | 41.1 | 31.3 | 28.6 | 33.9 | 42 | 32.3 | 28.4 | 36.6 | 40.4 | |
51. 서열 242 | 45.4 | 42.4 | 46 | 43.8 | 45.9 | 22.3 | 41.3 | 33.2 | 41.7 | 25.4 | 52.8 | 31.3 | |
52. 서열 244 | 31.8 | 31.1 | 31.9 | 31.3 | 47.2 | 38 | 23.3 | 27 | 23.3 | 22.2 | 23.2 | 28 | |
53. 서열 246 | 45.9 | 41.1 | 44.2 | 43 | 49.3 | 60.7 | 38.9 | 32.8 | 43.1 | 26 | 47.5 | 31.1 | |
54. 서열 248 | 44.6 | 40 | 39.5 | 40.9 | 60.2 | 47.2 | 39.4 | 48.7 | 30.5 | 29.3 | 33.2 | 39.9 | |
55. 서열 250 | 44.9 | 48.7 | 44.9 | 47.1 | 44.4 | 53.8 | 33.7 | 56.5 | 42.9 | 29.2 | 46.7 | 30.2 | |
56. 서열 252 | 47.2 | 45.8 | 39.5 | 43.5 | 40.2 | 40.9 | 32.6 | 42.4 | 41.8 | 44.4 | 26.5 | 26.9 | |
57. 서열 254 | 45.4 | 41.6 | 43.1 | 44.5 | 57.9 | 63.6 | 39.6 | 61.1 | 49.8 | 56.5 | 38.4 | 31.9 | |
58. 서열 256 | 39.6 | 36.6 | 37.1 | 35.9 | 58.3 | 46.9 | 42.1 | 45 | 54.2 | 41.9 | 39.9 | 46.5 |
데이터베이스 | accession 수 | accession 명 |
PRODOM | PD001423 | Q9SP16_ORYSA_Q9SP16; |
PRINTS | PR00367 | ETHRSPELEMNT |
GENE3D | G3DSA:3.30.730.10 | 기재 없음 |
PFAM | PF00847 | AP2 |
SMART | SM00380 | AP2 |
PROFILE | PS51032 | AP2_ERF |
SUPERFAMILY | SSF54171 | DNA-결합 도메인 |
길이 (AA) | 130 |
엽록체 운반 펩티드 | 0.098 |
미토콘드리아 운반 펩티드 | 0.339 |
분비 경로 신호 펩티드 | 0.035 |
다른 세포 내 표적 | 0.797 |
예측된 위치 | / |
신뢰성 등급 | 3 |
예측된 운반 펩티드 길이 | / |
이름 | 출처 생물체 | 핵산 서열번호 | 폴리펩티드 서열번호 | 상태 |
오리자 사티바 (Oryza sativa) | 257 | 258 | 전장 | |
오리자 사티바 (Oryza sativa) | 259 | 260 | 전장 | |
NP_001049235.1 | 오리자 사티바 (Oryza sativa) | 261 | 262 | 전장 |
ABB90886.1 | 트리티쿰 아애스티붐 (Triticum aestivum) | 263 | 264 | 전장 |
AAZ08560.1| | 트리티쿰 아애스티붐 (Triticum aestivum) | 265 | 266 | 전장 |
AAX13274.1 | 트리티쿰 아애스티붐 (Triticum aestivum) | 267 | 268 | 전장 |
NM_001054677.1 | 오리자 사티바 (Oryza sativa) | 269 | 270 | 전장 |
ABK28776.1 | 아라비돕시스 탈리아나 (Arabidopsis thaliana) | 271 | 272 | 전장 |
BAD37688.1 | 오리자 사티바 (Oryza sativa) | 273 | 274 | 전장 |
ABB89754.1 | 아스파라거스 오피시날리스 (Asparagus officinalis) | 275 | 276 | 전장 |
ABJ09421.1 | 알로에 베라 (Aloe vera) | 277 | 278 | 전장 |
AAT39542.1 | 고시피움 힐수툼 (Gossypium hirsutum) | 279 | 280 | 전장 |
AAF17691.1 | 아라비돕시스 탈리아나 (Arabidopsis thaliana) | 281 | 282 | 전장 |
NP_177931.1 | 아라비돕시스 탈리아나 (Arabidopsis thaliana) | 283 | 284 | 전장 |
NP_195688.1 | 아라비돕시스 탈리아나 (Arabidopsis thaliana) | 285 | 286 | 전장 |
AAM08622.1 | 오리자 사티바 (Oryza sativa) | 287 | 288 | 전장 |
ABB89755.1 | 브로우소네티아 파피리페라 (Broussonetia papyrifera) | 289 | 290 | 전장 |
AAZ14831.1 | 야트로파 쿨카스 (Jatropha curcas) | 291 | 292 | 전장 |
AAC49770.1 | 아라비돕시스 탈리아나 (Arabidopsis thaliana) | 293 | 294 | 전장 |
NP_001063013.1 | 오리자 사티바 (Oryza sativa) | 295 | 296 | 전장 |
NP_001061779.1 | 오리자 사티바 (Oryza sativa) | 297 | 298 | 전장 |
AAO13360.1 | 라이코퍼시콘 에스쿨렌툼 (Lycopersicon esculentum) | 299 | 300 | 전장 |
AAM80486.1 | 제아 메이스 (Zea mays) | 301 | 302 | 전장 |
AAP56252.1 | 오리자 사티바 (Oryza sativa) | 303 | 304 | 전장 |
AAF76898.1 | 아트리플렉스 홀텐시스 (Atriplex hortensis) | 305 | 306 | 전장 |
NP_173638.1 | 아라비돕시스 탈리아나 (Arabidopsis thaliana) | 307 | 308 | 전장 |
NP_179810.1 | 아라비돕시스 탈리아나 (Arabidopsis thaliana) | 309 | 310 | 전장 |
AAZ03388.1 | 글라이신 맥스 (Glycine max) | 311 | 312 | 전장 |
NP_564468.1 | 아라비돕시스 탈리아나 (Arabidopsis thaliana) | 313 | 314 | 전장 |
NP_179685.1 | 아라비돕시스 탈리아나 (Arabidopsis thaliana) | 315 | 316 | 전장 |
NP_193098.1 | 아라비돕시스 탈리아나 (Arabidopsis thaliana) | 317 | 318 | 전장 |
BAD25342.1 | 오리자 사티바 (Oryza sativa) | 319 | 320 | 전장 |
NP_001053379.1 | 오리자 사티바 (Oryza sativa) | 321 | 322 | 전장 |
CAD41199.2 | 오리자 사티바 (Oryza sativa) | 323 | 324 | 전장 |
NP_176620.1 | 아라비돕시스 탈리아나 (Arabidopsis thaliana) | 325 | 326 | 전장 |
11978.m07152 | 오리자 사티바 (Oryza sativa) | 327 | 328 | 전장 |
11975.m09040 | 오리자 사티바 (Oryza sativa) | 329 | 330 | 전장 |
형질 | Positive events | 평균 차이 |
뿌리 어린줄기 지수 | 3 events | 21.3 % |
전체 + 14% | ||
총 종자 수확량 | 2 events | 27 % |
충만률 | 3 events | 27 % |
TKW | 4 events | 8.75 % |
전체 + 6% | ||
수확지수 | 4 events | 30.5 % |
전체 + 16% | ||
뿌리 두께 | 2 events | 10.5 % |
높이 | 2 events | 8 % |
전체 + 4% |
형질 | Positive events | 평균 차이 |
최대 면적 | 2 events | 16.5 % |
전체 + 7% | ||
총 종자 수확량 | 2 events | 233 % |
전체 + 89% | ||
속이 찬 종자 수 | 2 events | 184.5 % |
전체 + 68% | ||
충만률 | 2 events | 206% |
전체 + 87% | ||
수확지수 | 2 events | 238.5% |
전체 + 86% | ||
TKW | 3 events | 11.3 % |
전체 + 7% | ||
높이 | 2 events | 12.5 % |
전체 + 7% |
Claims (82)
- NAC 전사인자를 코딩하는 핵산의 식물에서의 발현을 조절하는 단계를 포함하는 식물의 수확량 관련 형질을 향상시키는 방법으로서, 상기 NAC 전사인자의 아미노산 서열은 도 1에 도시된 것와 같은 NAC 계통수 구축에 이용시 임의의 다른 NAC 그룹보다는 서열번호 2로 표시된 아미노산 서열을 포함하는 NACs 그룹과 클러스터되는 경향이 있는 것을 특징으로 하는 방법.
- 제1항에 있어서, 상기 NAC 전사인자는 하기 모티프 중 임의의 하나 이상을 포함하는 것을 특징으로 하는 방법:모티프 I: KIDLDIIQELD, 또는 모티프 I의 서열에 증가하는 순으로 선호되는 적어도 50%, 60%, 70%, 80% 또는 90%의 서열 동일성을 갖는 모티프;모티프 II: CKYGXGHGGDEQTEW, 또는 모티프 II의 서열에 증가하는 순으로 선호되는 적어도 50%, 60%, 70%, 80% 또는 90%의 서열 동일성을 갖는 모티프, 여기서 X는 임의의 아미노산 또는 갭이며;모티프 III: GWVVCRAFQKP, 또는 모티프 III의 서열에 증가하는 순으로 선호되는 적어도 50%, 60%, 70%, 80% 또는 90%의 서열 동일성을 갖는 모티프.
- 제1항 또는 제2항에 있어서, 상기 NAC 전사인자를 코딩하는 핵산은 표 3에 제시된 핵산 서열번호 중 임의의 하나 또는 이의 부분 또는 표 3에 제시된 핵산 서 열번호 중 임의의 하나와 혼성화할 수 있는 서열인 것을 특징으로 하는 방법.
- 제1항 내지 제3항 중 어느 한 항에 있어서, 상기 조절된 발현은 T-DNA 활성화 태킹, TILLING, 또는 상동 재조합의 임의의 하나 이상에 의해 영향을 받는 것을 특징으로 하는 방법.
- 제1항 내지 제3항 중 어느 한 항에 있어서, 상기 조절된 발현은 NAC 전사인자를 코딩하는 핵산의 식물에 도입 및 발현에 의해 영향을 받으며, 상기 NAC 전사인자의 아미노산 서열은 도 1에 도시된 것와 같은 NAC 계통수 구축에 이용시 임의의 다른 NAC 그룹보다는 서열번호 2로 표시된 아미노산 서열을 포함하는 NACs 그룹과 클러스터되는 경향이 있는 것을 특징으로 하는 방법.
- 제1항 내지 제5항 중 어느 한 항에 있어서, 상기 향상된 수확량 관련 형질은 증가된 지상부 부위인 것을 특징으로 하는 방법.
- 제1항 내지 제6항 중 어느 한 항에 있어서, 상기 향상된 수확량 관련 형질은 증가된 종자 수확량인 것을 특징으로 하는 방법.
- 제5항 내지 제7항 중 어느 한 항에 있어서, 상기 핵산은 녹색 조직 특이적 프로모터, 바람직하게는 프로토클로로필리드(protochlorophylid) 환원효소 프로모 터에 작동가능하게 연결된 것을 특징으로 하는 방법.
- 제5항 내지 제7항 중 어느 한 항에 있어서, 상기 핵산은 구성적 프로모터, 바람직하게는 GOS2 프로모터에 작동가능하게 연결된 것을 특징으로 하는 방법.
- NAC 전사인자를 코딩하는 핵산의 식물에서의 발현을 조절하는 단계를 포함하는 식물의 수확량 관련 형질을 향상시키는 방법으로서, 상기 NAC 전사인자의 아미노산 서열은 도 1에 도시된 것와 같은 NAC 계통수 구축에 이용시 임의의 다른 NAC 그룹보다는 서열번호 51, 서열번호 53, 서열번호 55, 서열번호 57 또는 서열번호 59로 표시된 아미노산 서열을 포함하는 NACs 그룹과 클러스터되는 경향이 있는 것을 특징으로 하는 방법.
- NAC 전사인자를 코딩하는 핵산의 식물에서의 발현을 조절하는 단계를 포함하는 비생물적 스트레스 조건 하에서 키운 식물의 수확량 관련 형질을 향상시키는 방법으로서, 상기 NAC 전사인자의 아미노산 서열은 도 1에 도시된 것와 같은 NAC 계통수 구축에 이용시 임의의 다른 NAC 그룹보다는 서열번호 53으로 표시된 아미노산 서열을 포함하는 NACs 그룹과 클러스터되는 경향이 있는 것을 특징으로 하는 방법.
- 제10항에 있어서, 상기 NAC 전사인자는 하기 모티프 중 임의의 하나 이상을 포함하는 것을 특징으로 하는 방법:모티프 IV: PVPIIA, 또는 모티프 IV의 서열에 증가하는 순으로 선호되는 적어도 50%, 60%, 70%, 80% 또는 90%의 서열 동일성을 갖는 모티프;모티프 V: NGSRPN, 또는 모티프 V의 서열에 증가하는 순으로 선호되는 적어도 50%, 60%, 70%, 80% 또는 90%의 서열 동일성을 갖는 모티프;모티프 VI: CRLYNKK, 또는 모티프 VI의 서열에 증가하는 순으로 선호되는 적어도 50%, 60%, 70%, 80% 또는 90%의 서열 동일성을 갖는 모티프;모티프 VII: NEWEKMQ, 또는 모티프 VII의 서열에 증가하는 순으로 선호되는 적어도 50%, 60%, 70%, 80% 또는 90%의 서열 동일성을 갖는 모티프;모티프 VIII: WGETRTPESE, 또는 모티프 VIII의 서열에 증가하는 순으로 선호되는 적어도 50%, 60%, 70%, 80% 또는 90%의 서열 동일성을 갖는 모티프;모티프 IX: VPKKESMDDA, 또는 모티프 IX의 서열에 증가하는 순으로 선호되는 적어도 50%, 60%, 70%, 80% 또는 90%의 서열 동일성을 갖는 모티프;모티프 X: SYDDIQGMYS, 또는 모티프 X의 서열에 증가하는 순으로 선호되는 적어도 50%, 60%, 70%, 80% 또는 90%의 서열 동일성을 갖는 모티프; 및모티프 XI: DSMPRLHADSSCSE, 또는 모티프 XI의 서열에 증가하는 순으로 선호되는 적어도 50%, 60%, 70%, 80% 또는 90%의 서열 동일성을 갖는 모티프.
- 제10항 또는 제12항에 있어서, 상기 NAC 전사인자를 코딩하는 핵산은 표 4에 제시된 핵산 서열번호 중 임의의 하나 또는 이의 부분 또는 표 4에 제시된 핵산 서열번호 중 임의의 하나와 혼성화할 수 있는 서열인 것을 특징으로 하는 방법.
- 제10항 내지 제13항 중 어느 한 항에 있어서, 상기 조절된 발현은 T-DNA 활성화 태킹, TILLING, 또는 상동 재조합의 임의의 하나 이상에 의해 영향을 받는 것을 특징으로 하는 방법.
- 제10항 내지 제13항 중 어느 한 항에 있어서, 상기 조절된 발현은 NAC 전사인자를 코딩하는 핵산의 식물에 도입 및 발현에 의해 영향을 받으며, 상기 NAC 전사인자의 아미노산 서열은 도 1에 도시된 것와 같은 NAC 계통수 구축에 이용시 임의의 다른 NAC 그룹보다는 서열번호 51, 서열번호 53, 서열번호 55, 서열번호 57 또는 서열번호 59로 표시된 아미노산 서열을 포함하는 NACs 그룹과 클러스터되는 경향이 있는 것을 특징으로 하는 방법.
- 제10항 내지 제15항 중 어느 한 항에 있어서, 상기 향상된 수확량 관련 형질은 증가된 지상부 부위인 것을 특징으로 하는 방법.
- 제10항 내지 제16항 중 어느 한 항에 있어서, 상기 향상된 수확량 관련 형질은 증가된 종자 수확량인 것을 특징으로 하는 방법.
- 제10항 내지 제17항 중 어느 한 항에 있어서, 상기 향상된 수확량 관련 형질은 증가된 초기 활력(early vigour)인 것을 특징으로 하는 방법.
- 제15항 내지 제18항 중 어느 한 항에 있어서, 상기 핵산은 뿌리 특이적 프로모터, 바람직하게는 RCc3 프로모터에 작동가능하게 연결된 것을 특징으로 하는 방법.
- 제15항 내지 제18항 중 어느 한 항에 있어서, 상기 핵산은 구성적 프로모터, 바람직하게는 GOS2 프로모터에 작동가능하게 연결된 것을 특징으로 하는 방법.
- 제1항 내지 제20항 중 어느 한 항에 있어서, 상기 NAC 전사인자를 코딩하는 핵산은 식물 기원, 바람직하게는 단자엽 식물, 더 바람직하게는 화본과 (family Poaceae), 더욱 바람직하게는 오리자 속 (genus Oryza), 가장 바람직하게는 오리자 사티바 (Oryza sativa) 유래인 것을 특징으로 하는 방법.
- NAC 전사인자를 코딩하는 핵산을 포함하는 것을 특징으로 하는, 제1항 내지 제21항 중 어느 한 항에 따른 방법에 의해 수득가능한 종자를 포함하는 식물 또는 식물의 일부.
- 하기를 포함하는 구축물:(a) NAC 전사인자를 코딩하는 핵산으로서, 상기 NAC 전사인자의 아미노산 서열은 도 1에 도시된 것와 같은 NAC 계통수 구축에 이용시 임의의 다른 NAC 그룹보 다는 서열번호 2로 표시된 아미노산 서열을 포함하는 NACs 그룹과 클러스터되는 경향이 있는 것을 특징으로 하며;(b) (a)의 핵산 서열의 발현을 이끌 수 있는 하나 이상의 조절 서열; 및 선택적으로(c) 전사 종결 서열.
- 제23항에 있어서, 상기 하나 이상의 조절 서열은 적어도 녹색 조직 특이적 프로모터, 바람직하게는 프로토클로로필리드 환원효소 프로모터인 것을 특징으로 하는 구축물.
- 하기를 포함하는 구축물:(a) NAC 전사인자를 코딩하는 핵산으로서, 상기 NAC 전사인자의 아미노산 서열은 도 1에 도시된 것와 같은 NAC 계통수 구축에 이용시 임의의 다른 NAC 그룹보다는 서열번호 51, 서열번호 53, 서열번호 55, 서열번호 57 또는 서열번호 59로 표시된 아미노산 서열을 포함하는 NACs 그룹과 클러스터되는 경향이 있는 것을 특징으로 하며;(b) (a)의 핵산 서열의 발현을 이끌 수 있는 하나 이상의 조절 서열; 및 선택적으로(c) 전사 종결 서열.
- 제25항에 있어서, 상기 하나 이상의 조절 서열은 적어도 뿌리 특이적 프로모터, 바람직하게는 RCc3 프로모터인 것을 특징으로 하는 구축물.
- 제23항 또는 제25항에 있어서, 상기 하나 이상의 조절 서열은 적어도 구성적 프로모터, 바람직하게는 GOS2 프로모터인 것을 특징으로 하는 구축물.
- 대조구 식물에 비하여 향상된 수확량 관련 형질, 특히 증가된 종자 수확량 및/또는 증가된 지상부 부위를 갖는 식물을 제조하기 위한, 제23항 내지 제27항 중 어느 한 항에 따른 구축물의 용도.
- 제23항 내지 제27항 중 어느 한 항에 따른 구축물로 형질전환된 식물, 식물의 일부 또는 식물 세포.
- 하기 단계를 포함하는 대조구 식물에 비하여 향상된 수확량 관련 형질을 갖는 형질전환 식물의 제조 방법:(i) NAC 전사인자를 코딩하는 핵산을 식물에 도입 및 발현하는 단계로서, 상기 NAC 전사인자의 아미노산 서열은 도 1에 도시된 것와 같은 NAC 계통수 구축에 이용시 임의의 다른 NAC 그룹보다는 서열번호 2, 서열번호 51, 서열번호 53, 서열번호 55, 서열번호 57 또는 서열번호 59로 표시된 아미노산 서열을 포함하는 NACs 그룹과 클러스터되는 경향이 있는 것을 특징으로 하며; 그리고(ii) 식물의 생장 및 발달을 촉진하는 조건 하에서 식물 세포를 배양하는 단계.
- NAC 전사인자를 코딩하는 핵산의 증가된 발현으로 인해 적절한 대조구 식물에 비하여 증가된 수확량을 갖는 형질전환 식물로서, 상기 NAC 전사인자의 아미노산 서열은 도 1에 도시된 것와 같은 NAC 계통수 구축에 이용시 임의의 다른 NAC 그룹보다는 서열번호 2, 서열번호 51, 서열번호 53, 서열번호 55, 서열번호 57 또는 서열번호 59로 표시된 아미노산 서열을 포함하는 NACs 그룹과 클러스터되는 경향이 있는 것을 특징으로 하는 형질전환 식물.
- 제22항, 제29항 또는 제31항에 있어서, 상기 식물은 작물 식물 또는 단자엽 식물 또는 벼, 옥수수, 밀, 보리, 기장, 호밀, 수수 및 귀리 같은 곡물인 것을 특징으로 하는 형질전환 식물.
- 수확가능한 부분이 바람직하게는 종자인 것을 특징으로 하는, 제22항, 제29항, 제31항, 또는 32항 중 어느 한 항에 따른 식물의 수확가능한 부분.
- 제32항에 따른 식물 및/또는 제33항에 따른 식물의 수확가능한 부분 유래의 산물.
- 식물의 수확량 관련 형질의 향상에 NAC 전사인자를 코딩하는 핵산의 용도로서, 상기 NAC 전사인자의 아미노산 서열은 도 1에 도시된 것와 같은 NAC 계통수 구축에 이용시 임의의 다른 NAC 그룹보다는 서열번호 2, 서열번호 51, 서열번호 53, 서열번호 55, 서열번호 57 또는 서열번호 59로 표시된 아미노산 서열을 포함하는 NACs 그룹과 클러스터되는 경향이 있는 것을 특징으로 하는 용도.
- 비생물적 스트레스 조건 하에서 키운 식물의 수확량 관련 형질의 향상에 NAC4 전사인자를 코딩하는 핵산의 용도로서, 상기 NAC 전사인자의 아미노산 서열은 도 1에 도시된 것와 같은 NAC 계통수 구축에 이용시 임의의 다른 NAC 그룹보다는 서열번호 53으로 표시된 아미노산 서열을 포함하는 NACs 그룹과 클러스터되는 경향이 있는 것을 특징으로 하는 용도.
- 제35항 또는 제36항에 있어서, 상기 향상된 수확량 관련 형질은 대조구 식물에 비하여 증가된 종자 수확량 및/또는 증가된 지상부 부위 및/또는 초기 활력인 것을 특징으로 하는 용도.
- AP2-2 폴리펩티드를 코딩하는 핵산의 식물에서의 발현을 조절하는 단계를 포함하는, 대조구 식물에 비하여 식물의 수확량 관련 형질을 향상시키는 방법으로서, 상기 AP2-2 폴리펩티드는 모티프 XII (서열번호 133) 및 바람직하게는 또한 모티프 XIII (서열번호 134), 모티프 XIV (서열번호 135), 모티프 XV (서열번호 136), 모 티프 XVI (서열번호 137), 및 모티프 XVII (서열번호 138)의 하나 이상을 포함하는 것을 특징으로 하는 방법.
- 제38항에 있어서, 상기 AP2-2 폴리펩티드는 서열번호 132로 표시된 AP2-2 폴리펩티드에 증가하는 순으로 선호되는 적어도 20, 25, 30, 35, 40, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% 또는 그 이상의 서열 동일성을 갖는 것을 특징으로 하는 방법.
- 제38항 또는 제39항에 있어서, 상기 AP2-2 폴리펩티드를 코딩하는 핵산은 표 14에 제시된 핵산 서열번호 중 임의의 하나 또는 이의 부분 또는 표 14에 제시된 핵산 서열번호 중 임의의 하나와 혼성화할 수 있는 서열인 것을 특징으로 하는 방법.
- 제38항 내지 제40항 중 어느 항에 있어서, 상기 핵산 서열은 표 14에 제시된 서열번호 중 임의의 오쏘로그(orthologue) 또는 패럴로그(paralogue)를 코딩하는 것을 특징으로 하는 방법.
- 제38항 내지 제41항 중 어느 항에 있어서, 상기 조절된 발현은 AP2-2 폴리펩티드를 코딩하는 핵산의 식물에 도입 및 발현에 의해 영향을 받는 것을 특징으로 하는 방법.
- 제38항 내지 제42항 중 어느 항에 있어서, 상기 향상된 수확량 관련 형질은 대조구 식물에 비하여 증가된 수확량, 바람직하게는 증가된 종자 수확량인 것을 특징으로 하는 방법.
- 제42항 또는 제43항에 있어서, 상기 핵산은 구성적 프로모터, 바람직하게는 GOS2 프로모터에 작동가능하게 연결된 것을 특징으로 하는 방법.
- 제38항 내지 제44항 중 어느 항에 있어서, 상기 AP2-2 폴리펩티드를 코딩하는 핵산은 식물 기원, 바람직하게는 쌍자엽 식물, 더 바람직하게는 화본과 (family Poaceae), 더욱 바람직하게는 오리자 속 (genus Oryza), 가장 바람직하게는 오리자 사티바 (Oryza sativa) 유래인 것을 특징으로 하는 방법.
- AP2-2 폴리펩티드를 코딩하는 재조합 핵산을 포함하는 것을 특징으로 하는, 제38항 내지 제45항 중 어느 한 항의 방법에 의해 수득가능한 종자를 포함하는 식물 또는 식물의 일부.
- 하기를 포함하는 구축물:(a) 제38항 내지 제41항 중 어느 한 항에서 정의된 AP2-2 폴리펩티드를 코딩하는 핵산;(b) (a)의 핵산 서열의 발현을 이끌 수 있는 하나 이상의 조절 서열; 및 선택적으로(c) 전사 종결 서열.
- 제47항에 있어서, 상기 하나 이상의 조절 서열은 구성적 프로모터, 바람직하게는 GOS2 프로모터인 것을 특징으로 하는 구축물.
- 대조구 식물에 비하여 증가된 수확량, 특히 증가된 종자 수확량을 갖는 식물을 생산하는 방법에 대한 제47항 또는 제48항에 따른 구축물의 용도.
- 제47항 또는 제48항에 따른 구축물로 형질전환된 식물, 식물의 일부 또는 식물 세포.
- 하기 단계를 포함하는, 대조구 식물에 비하여 증가된 수확량, 특히 증가된 종자 수확량을 갖는 형질전환 식물의 제조 방법:(i) 제38항 내지 제41항 중 어느 한 항에서 정의된 AP2-2 폴리펩티드를 코딩하는 핵산을 식물에 도입 및 발현하는 단계; 및(ii) 식물의 생장 및 발달을 촉진하는 조건 하에서 식물 세포를 배양하는 단계.
- 제38항 내지 제41항 중 어느 한 항에서 정의된 AP2-2 폴리펩티드를 코딩하는 핵산의 증가된 발현으로 인하여 대조구 식물에 비하여 증가된 수확량, 특히 증가된 종자 수확량을 갖는 형질전환 식물, 또는 상기 형질전환 식물로부터 유래한 형질전환 식물 세포.
- 제46항, 제50항 또는 제52항에 있어서, 상기 식물은 작물 식물 또는 단자엽 식물 또는 벼, 옥수수, 밀, 보리, 기장, 호밀, 수수 및 귀리 같은 곡물 또는 상기 형질전환 식물로부터 유래한 형질전환 식물 세포인 것을 특징으로 하는 형질전환 식물.
- 수확가능한 부분이 바람직하게는 종자인 것을 특징으로 하는, 제53항에 따른 식물의 수확가능한 부분.
- 제53항에 따른 식물 및/또는 제54항에 따른 식물의 수확가능한 부분 유래의 산물.
- 대조구 식물에 비하여 식물에서 수확량 증가, 특히 종자 수확량 증가에 대한 제41항 중 어느 한 항에 정의된 AP2-2 폴리펩티드를 코딩하는 핵산의 용도.
- (i) 식물에서 하기를 포함하는 APETELA2-70-유사 (AP2-70-유사) 폴리펩티드 를 코딩하는 핵산의 발현을 조절하는 단계를 포함하는, 대조구 식물에 비하여 식물에 있어 수확량 관련 형질을 향상시키는 방법:(i) 서열번호 332로 표시된 AP2 DNA-결합 도메인: YRGVRQRHWGKWVAEIRLPRNARTRLWLGTFDTAEEAALAYDSAAFRLRGESARLNF, 또는 서열번호 332로 표시된 도메인에 증가하는 순으로 선호되는 적어도 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% 또는 그 이상의 서열 동일성을 갖는 도메인; 및(ii) 서열번호 258로 표시된 오리자 사티바 폴리펩티드 서열에 증가하는 순으로 선호되는 적어도 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% 또는 그 이상의 서열 동일성을 갖는 것; 및(iii) 서열번호 333으로 표시된 모티프 I: RLPXNX1RXRXWLGTF/YD/ET/S를 포함하는 것, 여기서 X는 임의의 아미노산이며, X1은 0, 1 내지 30개 갭이며; 및(iv) 서열번호 334로 표시된 모티프 XIX: RG D/E를 포함하는 것.
- 제57항에 있어서, 상기 AP2-70-유사 폴리펩티드는 추가로 하기 모티프 중의 하나 이상을 포함하는 것을 특징으로 하는 방법:(i) 서열번호 335/모티프 XX: WDESESFLLHKYPSLEIDWDAILS, 또는 모티프 XX에 증가하는 순으로 선호되는 적어도 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% 또는 그 이상의 서열 동일성을 갖는 모티프; 및/또는(ii) 서열번호 336/모티프 XXI: GPPLHAAVDAKLHAICH, 또는 모티프 XXI에 증가 하는 순으로 선호되는 적어도 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% 또는 그 이상의 서열 동일성을 갖는 모티프; 및/또는(iii) 서열번호 337/모티프 XXII: GANYLTPAQVLHVQAQLQRLRRP, 또는 모티프 XXII에 증가하는 순으로 선호되는 적어도 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% 또는 그 이상의 서열 동일성을 갖는 모티프; 및/또는(iv) 서열번호 338/모티프 XXIII: VDSKELMGALAPSMVSFSYPCSEQSASS, 또는 모티프 XXIII에 증가하는 순으로 선호되는 적어도 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% 그 이상의 서열 동일성을 갖는 모티프.
- 제57항 또는 제58항에 있어서, 상기 조절된 발현은 AP2-70-유사 폴리펩티드를 코딩하는 핵산의 식물에의 도입 및 발현에 의해 영향을 받는 것을 특징으로 하는 방법.
- 제57항 내지 제59항 중 어느 항에 있어서, 상기 AP2-70-유사 폴리펩티드를 코딩하는 핵산은 표 18에 제시된 핵산 서열번호 중 임의의 하나 또는 이의 부분 또는 표 18에 제시된 핵산 서열번호 중 임의의 하나와 혼성화할 수 있는 서열인 것을 특징으로 하는 방법.
- 제57항 내지 제60항 중 어느 항에 있어서, 상기 핵산 서열은 표 18에 제시된 서열번호 중 임의의 오쏘로그 또는 패럴로그를 코딩하는 것을 특징으로 하는 방법.
- 제57항 내지 제61항 중 어느 항에 있어서, 상기 향상된 수확량 관련 형질은 대조구 식물에 비하여 증가된 수확량, 바람직하게는 증가된 종자 수확량인 것을 특징으로 하는 방법.
- 제59항 내지 제62항 중 어느 한 항에 있어서, 상기 핵산은 구성적 프로모터, 바람직하게는 GOS2 프로모터, 가장 바람직하게는 벼 유래 GOS2 프로모터에 작동가능하게 연결된 것을 특징으로 하는 방법.
- 제59항 내지 제52항 중 어느 한 항에 있어서, 상기 핵산은 뿌리 특이적 프로모터, 바람직하게는 RCC3 프로모터, 가장 바람직하게는 벼 유래 RCC3 프로모터에 작동가능하게 연결된 것을 특징으로 하는 방법.
- 제57항 내지 제64항 중 어느 항에 있어서, 상기 AP2-70-유사 폴리펩티드를 코딩하는 핵산은 식물 기원, 바람직하게는 단자엽 식물, 더 바람직하게는 화본과 (family Poaceae), 더욱 바람직하게는 오리자 속 (genus Oryza), 가장 바람직하게는 오리자 사티바 유래인 것을 특징으로 하는 방법.
- AP2-70-유사 폴리펩티드를 코딩하는 재조합 핵산을 포함하는 것을 특징으로 하는, 제57항 내지 제65항 중 어느 한 항의 방법에 의해 수득가능한 종자를 포함하 는 식물 또는 식물의 일부.
- 하기를 포함하는 분리된 핵산분자:(a) 서열번호 257로 표시된 핵산;(b) 서열번호 257로 표시된 핵산의 상보체;(c) 서열번호 258로 표시된 아미노산 서열에 증가하는 순으로 선호되는 적어도 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% 또는 그 이상의 서열 동일성을 갖는, 및 서열번호 331: PFLMQWLNLLPLPVLDSSSWCPEHFHNSESDALP에 증가하는 순으로 선호되는 적어도 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% 또는 그 이상의 서열 동일성을 갖는 AP2-70-유사 폴리펩티드를 코딩하는 핵산.
- 하기를 포함하는 분리된 폴리펩티드:(a) 서열번호 258로 표시된 아미노산 서열;(b) 서열번호 258로 표시된 아미노산 서열에 증가하는 순으로 선호되는 적어도 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% 또는 그 이상의 서열 동일성을 갖는, 및 서열번호 331: PFLMQWLNLLPLPVLDSSSWCPEHFHNSESDALP에 증가하는 순으로 선호되는 적어도 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% 또는 그 이상의 서열 동일성을 갖는 아미노산 서열;(c) 상기 (i) 또는 (ii)의 아미노산 서열 중 임의의 유도체.
- 하기를 포함하는 구축물:(a) 제57항, 제58항 또는 제67항에서 정의된 AP2-70-유사 폴리펩티드를 코딩하는 핵산; (a)의 핵산 서열의 발현을 이끌 수 있는 하나 이상의 조절 서열, 및 선택적으로(b) 전사 종결 서열.
- 제69항에 있어서, 상기 하나 이상의 조절 서열이 하기로부터 선택되는 것을 특징으로 하는 구축물:(i) 구성적 프로모터, 바람직하게는 GOS2 프로모터, 가장 바람직하게는 벼 유래 GOS2 프로모터; 또는(ii) 뿌리 특이적 프로모터, 바람직하게는 RCC3 프로모터, 가장 바람직하게는 벼 유래 RCC3 프로모터.
- 대조구 식물에 비하여 증가된 수확량, 특히 증가된 종자 수확량을 갖는 식물의 제조 방법에 대한 제69항 또는 제70항에 따른 구축물의 용도.
- 제69항 또는 제70항에 따른 구축물로 형질전환된 식물, 식물의 일부 또는 식물 세포.
- 하기 단계를 포함하는, 대조구 식물에 비하여 증가된 수확량, 특히 증가된 종자 수확량을 갖는 형질전환 식물의 제조 방법:(i) 제57항, 제58항 또는 제67항에 정의된 AP2-70-유사 폴리펩티드를 코딩하는 핵산을 식물에 도입 및 발현하는 단계; 및(ii) 식물의 생장 및 발달을 촉진하는 조건 하에서 식물 세포를 배양하는 단계.
- 제57항, 제58항 또는 제67항에 정의된 AP2-70-유사 폴리펩티드를 코딩하는 핵산의 증가된 발현으로 인하여 대조구 식물에 비하여 증가된 수확량, 특히 증가된 종자 수확량을 갖는 형질전환 식물, 또는 상기 형질전환식물로부터 유래한 형질전환 식물 세포.
- 제66항, 제72항 또는 제74항에 있어서, 상기 식물은 작물 식물 또는 단자엽 식물 또는 벼, 옥수수, 밀, 보리, 기장, 호밀, 수수 및 귀리 같은 곡물, 또는 상기 형질전환 식물로부터 유래한 형질전환 식물 세포인 것을 특징으로 하는 형질전환 식물.
- 수확가능한 부분이 바람직하게는 종자인 것을 특징으로 하는, 제75항에 따른 식물의 수확가능한 부분.
- 제75항에 따른 식물 및/또는 제76항에 따른 식물의 수확가능한 부분 유래의 산물.
- 대조구 식물에 비하여 식물에서 수확량 증가, 특히 종자 수확량 증가에 대한 AP2-70-유사 폴리펩티드를 코딩하는 핵산의 용도.
- 하기를 포함하는 분리된 핵산 분자:(i) 서열번호 347, 서열번호 349, 서열번호 351, 서열번호 353, 서열번호 355, 서열번호 357, 서열번호 359, 서열번호 361, 또는 서열번호 363 중의 하나로 표시된 핵산;(ii) 서열번호 347, 서열번호 349, 서열번호 351, 서열번호 353, 서열번호 355, 서열번호 357, 서열번호 359, 서열번호 361, 또는 서열번호 363 중의 하나로 표시된 핵산의 상보체;(iii) 서열번호 348, 서열번호 350, 서열번호 352, 서열번호 354, 서열번호 356, 서열번호 358, 서열번호 360, 서열번호 362, 또는 서열번호 364 중의 하나로 표시된 아미노산 서열에 증가하는 순으로 선호되는 적어도 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% 또는 그 이상의 서열 동일성을 갖는 NAC 폴리펩티드를 코딩하는 핵산.
- 하기를 포함하는 분리된 폴리펩티드:(i) 서열번호 348, 서열번호 350, 서열번호 352, 서열번호 354, 서열번호 356, 서열번호 358, 서열번호 360, 서열번호 362, 또는 서열번호 364 중의 하나로 표시된 아미노산 서열;(ii) 서열번호 348, 서열번호 350, 서열번호 352, 서열번호 354, 서열번호 356, 서열번호 358, 서열번호 360, 서열번호 362, 또는 서열번호 364 중의 하나로 표시된 아미노산 서열에 증가하는 순으로 선호되는 적어도 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% 또는 그 이상의 서열 동일성을 갖는 아미노산 서열;(iii) 상기 (i) 또는 (ii)의 아미노산 서열 중 임의의 유도체.
- 하기를 포함하는 분리된 핵산 분자:(i) 서열번호 341, 서열번호 343, 또는 서열번호 345 중의 하나로 표시된 핵산;(ii) 서열번호 341, 서열번호 343, 또는 서열번호 345 중의 하나로 표시된 핵산의 상보체;(iii) 서열번호 342, 서열번호 344, 또는 서열번호 346 중의 하나로 표시된 아미노산 서열에 증가하는 순으로 선호되는 적어도 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% 또는 그 이상의 서열 동일성을 갖는 POI 폴리펩티드를 코딩하는 핵산.
- 하기를 포함하는 분리된 폴리펩티드:(i) 서열번호 342, 서열번호 344, 또는 서열번호 346 중의 하나로 표시된 아미노산 서열;(ii) 서열번호 342, 서열번호 344, 또는 서열번호 346 중의 하나로 표시된 아미노산 서열에 증가하는 순으로 선호되는 적어도 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% 또는 그 이상의 서열 동일성을 갖는 아미노산 서열;(iii) 상기 (i) 또는 (ii)의 아미노산 서열 중 임의의 유도체.
Applications Claiming Priority (21)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
EP06447082.6 | 2006-06-15 | ||
EP06447082 | 2006-06-15 | ||
EP06447081.8 | 2006-06-15 | ||
EP06447081 | 2006-06-15 | ||
US81644406P | 2006-06-26 | 2006-06-26 | |
US81644706P | 2006-06-26 | 2006-06-26 | |
US60/816,447 | 2006-06-26 | ||
US60/816,444 | 2006-06-26 | ||
EP07100862.7 | 2007-01-19 | ||
EP07100862 | 2007-01-19 | ||
EP07101535 | 2007-01-31 | ||
EP07101535.8 | 2007-01-31 | ||
EP07101534 | 2007-01-31 | ||
EP07101534.1 | 2007-01-31 | ||
US88995707P | 2007-02-15 | 2007-02-15 | |
US60/889,957 | 2007-02-15 | ||
US89104507P | 2007-02-22 | 2007-02-22 | |
US89104707P | 2007-02-22 | 2007-02-22 | |
US60/891,047 | 2007-02-22 | ||
US60/891,045 | 2007-02-22 | ||
PCT/EP2007/005292 WO2007144190A2 (en) | 2006-06-15 | 2007-06-15 | Plants with modulated expression of nac transcription factors having enhanced yield-related traits and a method for making the same |
Related Child Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
KR1020117016442A Division KR101261985B1 (ko) | 2007-06-15 | 2007-06-15 | Nac 전사인자의 발현 조절로 향상된 수확량 관련 형질을 갖는 식물 및 이의 제조 방법 |
Publications (2)
Publication Number | Publication Date |
---|---|
KR20090027219A true KR20090027219A (ko) | 2009-03-16 |
KR101105330B1 KR101105330B1 (ko) | 2012-01-18 |
Family
ID=38799338
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
KR1020087031365A Expired - Fee Related KR101105330B1 (ko) | 2006-06-15 | 2007-06-15 | Nac 전사인자의 발현 조절로 향상된 수확량 관련 형질을갖는 식물 및 이의 제조 방법 |
Country Status (8)
Country | Link |
---|---|
US (2) | US20090276918A1 (ko) |
EP (2) | EP2032704A2 (ko) |
KR (1) | KR101105330B1 (ko) |
AR (1) | AR069996A1 (ko) |
AU (1) | AU2007260202B2 (ko) |
CA (1) | CA2654100A1 (ko) |
MX (1) | MX2008016047A (ko) |
WO (1) | WO2007144190A2 (ko) |
Cited By (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2011126238A3 (en) * | 2010-04-09 | 2012-02-02 | Myongji University Industry And Academia Cooperation Foundation | Aboveground organ specific promoters for transforming plants and uses thereof |
KR101306678B1 (ko) * | 2012-05-31 | 2013-09-10 | 명지대학교 산학협력단 | 벼 꽃 발달단계 중 초기단계에서 특이적으로 발현하는 유전자의 프로모터 및 이의 용도 |
Families Citing this family (18)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN100526465C (zh) * | 2007-03-12 | 2009-08-12 | 华中农业大学 | 利用水稻转录因子基因snac2提高植物耐冷耐盐能力 |
US8299318B2 (en) | 2007-07-05 | 2012-10-30 | Ceres, Inc. | Nucleotide sequences and corresponding polypeptides conferring modulated plant characteristics |
MX2010012720A (es) * | 2008-06-20 | 2010-12-14 | Basf Plant Science Gmbh | Plantas que tienen rasgos mejorados relacionados con el rendimiento y un metodo para obtenerlas. |
WO2010079332A1 (en) * | 2009-01-09 | 2010-07-15 | Rothamsted Research Ltd. | Improving biomass yield |
US20120102599A1 (en) * | 2009-04-29 | 2012-04-26 | Crop Functional Genomics Center | Plants Having Enhanced Yield-Related Traits and a Method for Making the Same |
KR101699223B1 (ko) * | 2009-07-07 | 2017-01-24 | 바스프 플랜트 사이언스 컴퍼니 게엠베하 | 조절된 탄소 분배를 갖는 식물 및 이의 제조 방법 |
BR112012003796A2 (pt) | 2009-08-19 | 2016-11-22 | Basf Plant Science Co Gmbh | método para intensificar traços relacionados ao rendimento em plantas com relação às plantas de controle, construto, uso de um construto, planta, parte de planta ou célula de planta, método para a produção de uma planta trangênica, partes colhíveis de uma planta, produtos, e, uso de um ácido nucleico. |
AU2012234910B2 (en) * | 2011-03-28 | 2016-07-28 | Commonwealth Scientific And Industrial Research Organisation | Stress tolerant wheat plants |
KR101662483B1 (ko) * | 2011-10-21 | 2016-10-06 | 바스프 플랜트 사이언스 컴퍼니 게엠베하 | 향상된 수확량 관련 형질을 갖는 식물 및 이의 제조 방법 |
WO2013067128A1 (en) | 2011-11-02 | 2013-05-10 | Ceres, Inc. | Transgenic plants having increased tolerance to aluminum |
WO2013158228A1 (en) * | 2012-04-20 | 2013-10-24 | Monsanto Technology Llc | Transgenic plants with enhanced traits |
CN102924582B (zh) * | 2012-11-22 | 2013-11-20 | 中国农业科学院作物科学研究所 | 植物抗逆性相关蛋白TaNAC67及其编码基因与应用 |
WO2015150412A1 (en) * | 2014-03-31 | 2015-10-08 | Consejo Superior De Investigaciones Cientificas | Transgenic plants with increased number of fruits and seeds and method for obtaining thereof |
US9101100B1 (en) | 2014-04-30 | 2015-08-11 | Ceres, Inc. | Methods and materials for high throughput testing of transgene combinations |
WO2016000236A1 (en) | 2014-07-03 | 2016-01-07 | Pioneer Overseas Corporation | Plants having altered agronomic characteristics under nitrogen limiting conditions and related constructs and methods involving genes encoding nac3/onac067 polypeptides |
CN106868021B (zh) * | 2017-03-23 | 2021-03-02 | 周口师范学院 | 控制水稻种子大小基因OsNAC1及其应用 |
WO2020005667A1 (en) * | 2018-06-29 | 2020-01-02 | Pioneer Hi-Bred International, Inc. | Compositions and methods for editing an endogenous nac gene in plants |
CN115925843B (zh) * | 2022-07-25 | 2024-09-03 | 华中农业大学 | 柿单宁生物合成正调控转录因子DkMYB21基因、蛋白质及其应用 |
Family Cites Families (16)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP0419533A1 (en) | 1988-06-01 | 1991-04-03 | THE TEXAS A&M UNIVERSITY SYSTEM | Method for transforming plants via the shoot apex |
WO1993022443A1 (en) | 1992-04-24 | 1993-11-11 | Sri International | In vivo homologous sequence targeting in eukaryotic cells |
WO1995015972A1 (en) | 1993-12-09 | 1995-06-15 | Thomas Jefferson University | Compounds and methods for site-directed mutations in eukaryotic cells |
US6395547B1 (en) | 1994-02-17 | 2002-05-28 | Maxygen, Inc. | Methods for generating polynucleotides having desired characteristics by iterative selection and recombination |
US5605793A (en) | 1994-02-17 | 1997-02-25 | Affymax Technologies N.V. | Methods for in vitro recombination |
US6555732B1 (en) | 1998-09-14 | 2003-04-29 | Pioneer Hi-Bred International, Inc. | Rac-like genes and methods of use |
US7511190B2 (en) * | 1999-11-17 | 2009-03-31 | Mendel Biotechnology, Inc. | Polynucleotides and polypeptides in plants |
EP1151103B1 (en) | 1999-02-11 | 2004-08-11 | Institute of Molecular Agrobiology | Nac1 - a plant gene encoding a transcription factor involved in cotyledon and lateral root development |
US8426685B2 (en) * | 2001-04-18 | 2013-04-23 | Mendel Biotechnology, Inc. | Yield-related polynucleotides and polypeptides in plants |
US20110093981A9 (en) * | 1999-05-06 | 2011-04-21 | La Rosa Thomas J | Nucleic acid molecules and other molecules associated with transcription in plants and uses thereof for plant improvement |
US20100293669A2 (en) * | 1999-05-06 | 2010-11-18 | Jingdong Liu | Nucleic Acid Molecules and Other Molecules Associated with Plants and Uses Thereof for Plant Improvement |
KR100455617B1 (ko) | 1999-07-22 | 2004-11-06 | 독립행정법인농업생물자원연구소 | 단자엽 식물의 초신속 형질전환 방법 |
US20110131679A2 (en) * | 2000-04-19 | 2011-06-02 | Thomas La Rosa | Rice Nucleic Acid Molecules and Other Molecules Associated with Plants and Uses Thereof for Plant Improvement |
AU2002314417A1 (en) * | 2001-06-22 | 2003-01-08 | Syngenta Participations Ag | Identification and characterization of plant genes |
AU2002345250A1 (en) | 2001-06-22 | 2003-01-08 | Syngenta Participations Ag | Plant disease resistance genes |
JP2005185101A (ja) * | 2002-05-30 | 2005-07-14 | National Institute Of Agrobiological Sciences | 植物の全長cDNAおよびその利用 |
-
2007
- 2007-06-15 US US12/304,581 patent/US20090276918A1/en not_active Abandoned
- 2007-06-15 EP EP07764668A patent/EP2032704A2/en not_active Withdrawn
- 2007-06-15 CA CA002654100A patent/CA2654100A1/en not_active Abandoned
- 2007-06-15 WO PCT/EP2007/005292 patent/WO2007144190A2/en active Application Filing
- 2007-06-15 MX MX2008016047A patent/MX2008016047A/es active IP Right Grant
- 2007-06-15 KR KR1020087031365A patent/KR101105330B1/ko not_active Expired - Fee Related
- 2007-06-15 AU AU2007260202A patent/AU2007260202B2/en not_active Expired - Fee Related
- 2007-06-15 EP EP12191752.0A patent/EP2599869A3/en not_active Withdrawn
- 2007-06-15 AR ARP070102657A patent/AR069996A1/es unknown
-
2015
- 2015-09-23 US US14/862,306 patent/US20160010104A1/en not_active Abandoned
Cited By (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2011126238A3 (en) * | 2010-04-09 | 2012-02-02 | Myongji University Industry And Academia Cooperation Foundation | Aboveground organ specific promoters for transforming plants and uses thereof |
KR101306678B1 (ko) * | 2012-05-31 | 2013-09-10 | 명지대학교 산학협력단 | 벼 꽃 발달단계 중 초기단계에서 특이적으로 발현하는 유전자의 프로모터 및 이의 용도 |
Also Published As
Publication number | Publication date |
---|---|
AU2007260202B2 (en) | 2014-03-27 |
EP2032704A2 (en) | 2009-03-11 |
EP2599869A2 (en) | 2013-06-05 |
AR069996A1 (es) | 2010-03-10 |
KR101105330B1 (ko) | 2012-01-18 |
US20160010104A1 (en) | 2016-01-14 |
CA2654100A1 (en) | 2007-12-21 |
MX2008016047A (es) | 2009-05-22 |
AU2007260202A1 (en) | 2007-12-21 |
WO2007144190A3 (en) | 2008-04-17 |
EP2599869A3 (en) | 2013-09-11 |
US20090276918A1 (en) | 2009-11-05 |
WO2007144190A2 (en) | 2007-12-21 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
KR101105330B1 (ko) | Nac 전사인자의 발현 조절로 향상된 수확량 관련 형질을갖는 식물 및 이의 제조 방법 | |
AU2019253838B2 (en) | Polynucleotides, polypeptides encoded thereby, and methods of using same for increasing abiotic stress tolerance, biomass and/or yield in plants expressing same | |
KR101662483B1 (ko) | 향상된 수확량 관련 형질을 갖는 식물 및 이의 제조 방법 | |
KR101647732B1 (ko) | 향상된 수확량 관련 형질을 갖는 식물 및 이의 제조 방법 | |
CN101365786B (zh) | 具有改良的生长特征的植物及其生产方法 | |
CN101495640B (zh) | 具有增强的产量相关性状的伸展蛋白受体样激酶受调节表达的植物和用于产生该植物的方法 | |
CN101842489B (zh) | 具有增强的产量相关性状的植物和用于制备该植物的方法 | |
CN101784667B (zh) | 来自玉米的次生壁形成基因及其用途 | |
KR101699223B1 (ko) | 조절된 탄소 분배를 갖는 식물 및 이의 제조 방법 | |
KR101356311B1 (ko) | 증가된 수확량을 갖는 식물 및 이의 생산 방법 | |
KR20120126061A (ko) | 향상된 수확량 관련 형질을 갖는 식물 및 이의 제조 방법 | |
KR101754083B1 (ko) | 향상된 수확량 관련 형질을 갖는 식물 및 이의 제조 방법 | |
BRPI0618328A2 (pt) | método para melhorar caracterìsticas de crescimento de planta em relação às plantas do tipo selvagem correspondentes, construção, célula hospedeira, método para produzir uma planta transgênnica, parte de planta ou célula de planta tendo caracterìsticas de crescimento de planta melhoradas em relação às plantas do tipo selvagem correspondentes, e, usos de uma construção e de um ácido nucleico | |
KR101227432B1 (ko) | 향상된 수확량 관련 형질을 갖는 식물 및 이의 제조 방법 | |
BRPI0721100A2 (pt) | Método para intensificar características relacionadas a rendimentos em plantas, e para a produção de uma planta transgênica, planta ou parte de mesma, molécula de ácido nucleico isolado, polipeptídio isolado, construção, usos de uma construção, de um ácido nucleico e de uma sequência de ácido nucleico, planta, parte de planta ou célula vegetal, partes colhíveis de uma planta, e, produtos | |
CN101351556B (zh) | 具有改良生长特性的植物及其制备方法 | |
KR101429473B1 (ko) | 향상된 수확량 관련 형질을 갖는 식물 및 이의 제조 방법 | |
CN101883783A (zh) | 具有增强的产量相关性状的植物及其制备方法 | |
BRPI0618965A2 (pt) | construção de ácido nucléico, polipeptìdeo isolado compreendendo uma sequência de aminoácido, célula de planta compreendendo um polinucleotìdeo exógeno, método para aumentar a toleráncia de uma planta a uma condição de estresse, método para aumentar a biomassa, vigor e/ou rendimento de uma planta, método para aumentar a eficiência do uso de fertilizante e/ou absorção de uma planta e célula de planta | |
CN101605902A (zh) | 具有增强的产量相关性状和/或提高的非生物胁迫抗性的植物和制备该植物的方法 | |
KR20100040939A (ko) | 향상된 수확량 관련 형질을 갖는 식물 및 이의 제조 방법 | |
KR101261985B1 (ko) | Nac 전사인자의 발현 조절로 향상된 수확량 관련 형질을 갖는 식물 및 이의 제조 방법 | |
CA2602768A1 (en) | Plants having increased yield and a method for making the same | |
BRPI0619242A2 (pt) | proteìna, métodos para aumentar produção de semente e/ou aumentar taxa de crescimento de plantas e taxa de crescimento, célula vegetal, construção, e, métodos para produzir uma planta transgenica, para melhorar caracterìsticas de crescimento de plantas e caracterìsticas de crescimento em relação a correspondentes plantas do tipo selvagem, para aumentar produção vegetal, número de sementes em plantas e produção de semente em plantas |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
A201 | Request for examination | ||
PA0105 | International application |
Patent event date: 20081224 Patent event code: PA01051R01D Comment text: International Patent Application |
|
PA0201 | Request for examination |
Patent event code: PA02012R01D Patent event date: 20081224 Comment text: Request for Examination of Application |
|
PG1501 | Laying open of application | ||
E902 | Notification of reason for refusal | ||
PE0902 | Notice of grounds for rejection |
Comment text: Notification of reason for refusal Patent event date: 20110114 Patent event code: PE09021S01D |
|
A107 | Divisional application of patent | ||
PA0104 | Divisional application for international application |
Comment text: Divisional Application for International Patent Patent event code: PA01041R01D Patent event date: 20110714 |
|
E701 | Decision to grant or registration of patent right | ||
PE0701 | Decision of registration |
Patent event code: PE07011S01D Comment text: Decision to Grant Registration Patent event date: 20120102 |
|
GRNT | Written decision to grant | ||
PR0701 | Registration of establishment |
Comment text: Registration of Establishment Patent event date: 20120105 Patent event code: PR07011E01D |
|
PR1002 | Payment of registration fee |
Payment date: 20120105 End annual number: 3 Start annual number: 1 |
|
PG1601 | Publication of registration | ||
FPAY | Annual fee payment |
Payment date: 20150130 Year of fee payment: 4 |
|
PR1001 | Payment of annual fee |
Payment date: 20150130 Start annual number: 4 End annual number: 4 |
|
FPAY | Annual fee payment |
Payment date: 20160308 Year of fee payment: 5 |
|
PR1001 | Payment of annual fee |
Payment date: 20160308 Start annual number: 5 End annual number: 5 |
|
FPAY | Annual fee payment |
Payment date: 20170105 Year of fee payment: 6 |
|
PR1001 | Payment of annual fee |
Payment date: 20170105 Start annual number: 6 End annual number: 6 |
|
LAPS | Lapse due to unpaid annual fee | ||
PC1903 | Unpaid annual fee |
Termination category: Default of registration fee Termination date: 20181016 |