KR100950445B1 - Antiviral agents with inhibitory activities on on avian and swine influenza virus or novel influenza virus by compounds isolated from glycyrrhiza uralensis - Google Patents

Antiviral agents with inhibitory activities on on avian and swine influenza virus or novel influenza virus by compounds isolated from glycyrrhiza uralensis Download PDF

Info

Publication number
KR100950445B1
KR100950445B1 KR1020090101628A KR20090101628A KR100950445B1 KR 100950445 B1 KR100950445 B1 KR 100950445B1 KR 1020090101628 A KR1020090101628 A KR 1020090101628A KR 20090101628 A KR20090101628 A KR 20090101628A KR 100950445 B1 KR100950445 B1 KR 100950445B1
Authority
KR
South Korea
Prior art keywords
swine
avian
compound
virus
neuraminidase
Prior art date
Application number
KR1020090101628A
Other languages
Korean (ko)
Inventor
윤인중
이홍식
김동원
오원근
박준수
부이탄텅
다오트롱투완
Original Assignee
주식회사 중앙백신연구소
조선대학교산학협력단
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 주식회사 중앙백신연구소, 조선대학교산학협력단 filed Critical 주식회사 중앙백신연구소
Priority to KR1020090101628A priority Critical patent/KR100950445B1/en
Application granted granted Critical
Publication of KR100950445B1 publication Critical patent/KR100950445B1/en

Links

Images

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/12Ketones
    • AHUMAN NECESSITIES
    • A23FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23KFODDER
    • A23K20/00Accessory food factors for animal feeding-stuffs
    • A23K20/10Organic substances
    • A23K20/111Aromatic compounds
    • AHUMAN NECESSITIES
    • A23FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23LFOODS, FOODSTUFFS, OR NON-ALCOHOLIC BEVERAGES, NOT COVERED BY SUBCLASSES A21D OR A23B-A23J; THEIR PREPARATION OR TREATMENT, e.g. COOKING, MODIFICATION OF NUTRITIVE QUALITIES, PHYSICAL TREATMENT; PRESERVATION OF FOODS OR FOODSTUFFS, IN GENERAL
    • A23L2/00Non-alcoholic beverages; Dry compositions or concentrates therefor; Their preparation
    • A23L2/52Adding ingredients
    • AHUMAN NECESSITIES
    • A23FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23LFOODS, FOODSTUFFS, OR NON-ALCOHOLIC BEVERAGES, NOT COVERED BY SUBCLASSES A21D OR A23B-A23J; THEIR PREPARATION OR TREATMENT, e.g. COOKING, MODIFICATION OF NUTRITIVE QUALITIES, PHYSICAL TREATMENT; PRESERVATION OF FOODS OR FOODSTUFFS, IN GENERAL
    • A23L29/00Foods or foodstuffs containing additives; Preparation or treatment thereof
    • A23L29/03Organic compounds
    • A23L29/035Organic compounds containing oxygen as heteroatom
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K36/00Medicinal preparations of undetermined constitution containing material from algae, lichens, fungi or plants, or derivatives thereof, e.g. traditional herbal medicines
    • A61K36/18Magnoliophyta (angiosperms)
    • A61K36/185Magnoliopsida (dicotyledons)
    • A61K36/48Fabaceae or Leguminosae (Pea or Legume family); Caesalpiniaceae; Mimosaceae; Papilionaceae
    • A61K36/484Glycyrrhiza (licorice)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2236/00Isolation or extraction methods of medicinal preparations of undetermined constitution containing material from algae, lichens, fungi or plants, or derivatives thereof, e.g. traditional herbal medicine
    • A61K2236/30Extraction of the material
    • A61K2236/33Extraction of the material involving extraction with hydrophilic solvents, e.g. lower alcohols, esters or ketones
    • A61K2236/333Extraction of the material involving extraction with hydrophilic solvents, e.g. lower alcohols, esters or ketones using mixed solvents, e.g. 70% EtOH

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Natural Medicines & Medicinal Plants (AREA)
  • Engineering & Computer Science (AREA)
  • Polymers & Plastics (AREA)
  • Food Science & Technology (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Epidemiology (AREA)
  • Animal Behavior & Ethology (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Veterinary Medicine (AREA)
  • Nutrition Science (AREA)
  • Biotechnology (AREA)
  • Alternative & Traditional Medicine (AREA)
  • Botany (AREA)
  • Medical Informatics (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Animal Husbandry (AREA)
  • Zoology (AREA)
  • Medicines Containing Plant Substances (AREA)
  • Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)

Abstract

PURPOSE: A Glycyrrhiza uralensis extract and calcone based compounds suppressing neuraminidase are provided to treat novel swine-origin influenza. CONSTITUTION: A Glycyrrhiza uralensis extract for preventing or treating avian and swine ingluenza contains is extracted using ethanol or methanol and contains chalcone based compound. The chalcone based compound is Licochacone F, Echicnatin, Licochalcon D, Licochalcone A, Isoliquiritigenin, Licoagrochalcone A, 5-Prenylbutein and Kanzonol C. A functional health food for preventing or treating diseases relating to avian and swine influenza contains Glycyrrhiza uralensis extract. A pharmaceutical composition for preventing or treating diseases relating to avian and swine influenza contains Glycyrrhiza uralensis extract or chalcone compouns as active ingredient. The pharmaceutical composition also contains pharmaceutically acceptable carrier or excipient.

Description

감초로부터 얻은 조류, 돼지 인플루엔자 및 신종플루에 대한 항바이러스제 {Antiviral agents with inhibitory activities on on Avian and Swine influenza virus or Novel influenza virus by compounds isolated from Glycyrrhiza uralensis}Antiviral agents with inhibitory activities on on Avian and Swine influenza virus or Novel influenza virus by compounds isolated from Glycyrrhiza uralensis}

본 발명은 감초(Glycyrrhiza uralensis) 유래의 뉴라미니데이즈 효소 (neuraminidase)를 저해하는 화합물 및 이를 유효성분으로 포함하는 조류 및 돼지 인플루엔자와 신종플루의 예방과 치료에 사용하는 조성물에 관한 것이다. The present invention is licorice ( Glycyrrhiza The present invention relates to a compound which inhibits neuraminidase derived from uralensis ) and a composition for use in the prevention and treatment of avian and swine influenza and swine flu comprising the same as an active ingredient.

더욱 상세하게는 감초를 에탄올 또는 메탄올로 추출 농축한 후 수용액에 포화시키고 에틸아세테이트로 분획한 분획 또는 이들 에틸아세테이트 분획으로부터 크로마토그래피를 이용하여 순수 분리 정제하여 얻은 하기 화학식 1로 표시되는 칼콘(chalcone) 계열의 화합물 중 어느 하나를 포함하는 뉴라미니데이즈 저해 화합물과 이를 유효성분으로 함유하는 감기, 조류 및 돼지 인플루엔자, 신종플루 등과 같은 바이러스 뉴라미니데이즈 저해 관련 질환의 예방 및 치료용 조성물에 관한 것이다.Chalcone and more particularly, that after extraction Concentration of the licorice with ethanol or methanol saturated in solution and represented by the following general formula (1) obtained by separation and purification of pure by chromatography from the fraction or combinations of ethyl acetate fractions were fractions with ethyl acetate (chalcone) The present invention relates to a neuraminidase inhibitor compound comprising any one of a series of compounds and a composition for preventing and treating a virus neuraminidase inhibitory related disease such as a cold, avian and swine influenza, swine flu, etc. containing the same as an active ingredient.

인플루엔자 바이러스는 '오르소믹소'과에 속하는 RNA 바이러 스(Orthomyxovirus)로서 A, B, C형으로 분류된다. A형은 사람에게 주로 감염이 확인되며 B, C형에 비하여 돼지, 기타 포유류 및 다양한 야생조류에서 감염이 확인되고 있는 바이러스이다. 최근, 전 세계적으로 문제가 되고 있는 조류 인플루엔자(Avian influenza), 돼지 인플루엔자(Swine influenza) 및 신종플루(Novel flu) 등은 모두 A형 바이러스에 속한다. Influenza viruses are orthomyxoviruses belonging to the orthomyxo family and are classified into A, B and C types. Type A is a virus that has been confirmed mainly in humans and has been confirmed in pigs, other mammals, and various wild birds compared to types B and C. Recently, Avian influenza, swine influenza and Novel flu, which are a problem worldwide, belong to the type A virus.

인플루엔자 바이러스의 표면에는 헤마글루티닌(hemagglutinin, HA)과 뉴라미니데이즈(neuraminidase, NA)라는 두 가지 단백질이 존재하는데, 헤마글루티닌은 16종이 있고 뉴라미니데이즈는 9종이 있으므로 15×9=144 종류의 인플루엔자 바이러스가 발생할 수 있다. 조류에서의 인플루엔자 감염은 주로 H5형이나 H7형 및 H9형에 관련되며, 3종류의 헤마글루티닌(H1, H2, H3)과 2가지 형태의 뉴라미니데이즈(N1과 N2)만이 인간에서 인플루엔자 감염을 일으키므로 원칙적으로 인간은 조류인플루엔자에 감염되지 않았다. 그러나 최근에는 조류 인플루엔자 바이러스가 유전자 재조합 과정을 거치지 않고 직접 사람에게 전파된 예도 발생하고 있다. There are two proteins on the surface of the influenza virus: hemagglutinin (HA) and neuraminidase (NA) .There are 16 types of hemagglutinin and 9 types of neuraminidase, so 15 × 9 = 144 types of influenza viruses can occur. Influenza infections in birds are mainly related to H5, H7 and H9 types, with only three types of hemagglutinin (H1, H2, H3) and two types of neuraminidase (N1 and N2) in humans. As a rule, humans are not infected with avian influenza. Recently, however, avian influenza viruses have been transmitted directly to humans without undergoing genetic recombination.

조류 인플루엔자는 닭과 오리, 칠면조 등 가금류를 접촉하는 것 이외에도 야생조류와 우리나라에 온 철새들을 통해서 빠르게 전파된다. 조류 인플루엔자 바이러스는 조류 인플루엔자가 발생한 동남아로부터 주기적으로 유입되어 전파되며 특히 봄철 황사를 통해 중국으로부터도 전염이 가능하다. 세계적으로 문제가 되고 있는 동물의 바이러스 질환인 조류 인플루엔자는 국내에서 1996년 이후 발생해 530만 마리의 닭, 오리가 도살되는 등 1,500억 원 이상의 직접 피해가 발생하였으며, 아시아에서도 조류 인플루엔자를 통해 2억 마리 이상의 축산물이 도살되어 양계산업 의 경제적 손실이 막대하다. Avian influenza spreads quickly through wild birds and migratory birds that come to Korea, in addition to contacting poultry such as chickens, ducks and turkeys. Avian influenza virus is periodically introduced and spread from Southeast Asia, where avian influenza has occurred, and can be transmitted from China through spring yellow dust. Avian influenza, a global viral disease of animals, has been incurred since 1996 in Korea, killing 5.3 million chickens and ducks, causing more than 150 billion won in direct damage. More than 10 livestock are slaughtered, causing huge economic losses for the poultry industry.

돼지 인플루엔자 바이러스(Swine influenza virus)는 1918년에 처음으로 보고되었으며 보통 돼지는 사람이 가지고 있는 인플루엔자 수용체(N-acetylneuraminic acid α2,6 galactose)와 조류들이 갖고 있는 인플루엔자 수용체(N-acetylneuraminic acid α2,3 galactose)를 동시에 가지고 있어 조류 인플루엔자 바이러스가 돼지의 몸 안에서 재조합(reassortment) 또는 적응(adaptation)을 통하여 사람에게 감염될 수 있도록 바이러스 혼합용기(mixing vessels)의 역할을 한다고 알려지고 있다. The swine influenza virus was reported for the first time in 1918. Usually, swine has a human influenza receptor (N-acetylneuraminic acid α2,6 galactose) and avian influenza receptor (N-acetylneuraminic acid α2,3). It is known to have a galactose, which acts as a virus mixing vessel for the avian influenza virus to infect humans through reassortment or adaptation in pigs.

2009년 멕시코에서 처음 발병하여 전 세계로 퍼지고 있는 신종플루(Novel flu)는 돼지 인플루엔자 바이러스인 H1N1이 돼지에게 감염되어 인간에게 전염이 가능한 질환으로 변이된 것으로 추정된다. 신종플루는 기본적으로 감기처럼 고열, 기침 등의 증상이 나타나는데 현재 상태보다 인간에게 치명적인 바이러스로 변할 가능성이 존재한다. 세계보건기구(WHO)가 집계하는 신종플루의 감염자 수는 2009년 10월 초까지 그 수가 34만 3200명에 달하였고, 사망자는 4000명을 넘어섰으며, 현재 세계보건기구는 신종플루의 현황을 6단계인 대유행 상태로 격상하였다. 신종플루의 일반적인 증상은 일반 독감과 구별하기가 매우 어렵다. 신종플루는 일반 독감과 비슷하게 발열, 인후통, 기침, 콧물 또는 코막힘의 증상을 보이고 있으며, 최근의 신종플루 관련 보고에 의하면 일반독감보다 심한 치명적인 폐 손상을 유발하는 특징을 보이고 있으므로 신종플루의 예방 및 치료는 매우 중요한 문제이다. 따라서 신종플루를 예방하기 위하여 백신의 확보가 필수적이며 신종플루가 급격하게 확대 되기 전에 백신을 생산하여 국가적으로 접종할 필요가 있다. 그러나, 예방적 차원의 국가적 백신 대책으로 매번 항원변이가 일어나는 RNA 바이러스를 모두 예방하는 백신을 만드는 것은 불가능에 가깝다. 따라서 조류 및 돼지 인플루엔자, 신종플루 또는 최악의 발병 가능성인 조류 인플루엔자와 신종플루가 섞인 새로운 병원체의 발생에 대비하기 위하여 이를 예방하고 치료할 수 있는 치료제의 개발은 필수적이다. The Novel flu, which was first introduced in Mexico in 2009 and is spreading around the world, is thought to be a disease that can be transmitted to humans by the swine flu virus H1N1. Swine flu is basically like a cold, high fever, cough, etc. There is a possibility that the virus becomes more lethal than humans. The number of people infected with the H1N1 flu recorded by the World Health Organization (WHO) reached 34,200 by the beginning of October 2009, and the death toll exceeded 4,000. Upgraded to a pandemic phase. Common symptoms of swine flu are very difficult to distinguish from the common flu. Swine flu shows symptoms of fever, sore throat, cough, runny nose or stuffy nose, similar to the common flu, and recent reports related to swine flu show more severe fatal lung damage than the common flu. Treatment is a very important problem. Therefore, it is necessary to secure a vaccine to prevent the H1N1 flu, and it is necessary to produce the vaccine and inoculate nationally before the H1N1 flu spread rapidly. However, it is almost impossible to make a vaccine that prevents all RNA viruses that produce antigenic variation every time as a preventive national vaccine. Therefore, in order to prepare for the development of avian and swine influenza, swine flu or a new pathogen mixed with the worst possible avian influenza and swine flu, it is necessary to develop a therapeutic agent that can prevent and treat it.

현재 조류 및 돼지 인플루엔자, 신종플루의 유일한 치료제는 바이러스 기원의 뉴라미니데이즈에 선택적인 저해물질로 개발된 경구용 치료제인 타미플루(oseltamivir phosphate)와 흡입형인 리렌자(zanamivir) 등이다. 경구용 치료제로서 많이 사용하고 있는 타미플루의 부작용으로는 오심, 구토, 신경계나 정신계의 이상이 보고되었으며, 일본의 경우 타미플루를 승인 후 확인된 소아환자의 사망예가 15건이 될 정도로 부작용을 갖고 있다. 또한, 경구용 치료제로 사용되고 있는 타미플루에 대한 내성 바이러스가 발병할 경우를 대비하여야 한다. 최근에 이미 신종플루의 확산에 치명적인 타미플루에 대한 내성 바이러스의 출현이 보고되고 있으며, 타미플루 내성 바이러스의 인간 대 인간 전염조차도 발견되고 있는 실정이다. 따라서 조류 및 돼지 인플루엔자와 신종플루에 대한 바이러스 치료제의 개발은 인간의 보건안전에 필수적인 사항이며, 특히 대유행을 앞두고 있는 조류 및 돼지 인플루엔자와 신종플루와의 전쟁에 있어서 더욱 필요하다.Currently, the only treatments for avian and swine influenza and swine flu are oralamivir phosphate, oral inhaled zanamivir, which is an oral therapeutic agent developed as a selective inhibitor of neuraminidase of viral origin. Side effects of Tamiflu, which is widely used as an oral treatment, have been reported such as nausea, vomiting, nervous or psychological problems, and in Japan, there are 15 cases of death in pediatric patients confirmed after Tamiflu approval. In addition, it should be prepared for the development of resistant virus against Tamiflu, which is used as an oral treatment. Recently, the emergence of Tamiflu-resistant virus, which is fatal to the spread of swine flu, has been reported, and even human-to-human transmission of Tamiflu-resistant virus has been found. Therefore, the development of virus treatments against avian and swine influenza and swine flu is essential for human health and safety, especially in the war against the pandemic avian and swine flu and swine flu.

바이러스의 감염 및 증식과정을 살펴보면 바이러스는 세포에 감염 후 세포내에서 새로운 바이러스를 만들고 다른 세포로 전파되기 위하여 세포 외부에 존재하 는 시알릭산(siliac acid)을 바이러스가 만든 뉴라미니데이즈를 이용하여 절단하는 것이 필요하다. 타미플루 내성 조류 인플루엔자 바이러스는 보통 타미플루가 결합하는 타미플루의 수용체 단백질의 아미노산을 변화시키는 3개의 유전적 변이(Arg292Lys, Asn274Ser, His294Tyr)를 통해 발생하는 것으로 알려지고 있다. 3곳의 유전적 변이 중 타미플루 내성 조류 인플루엔자 바이러스의 변종으로 가장 많이 발현하는 294의 His가 Tyr으로 변화한 바이러스의 경우는 타미플루의 소수성 잔기(hydrophobic residue)가 타미플루 수용체에 결합하지 못하게 변이된 경우이다. 이는 미국과 유럽에서 2007~2008년 시즌에 10~25% 확률로 발견된 바이러스로서 향후의 신종플루에 대한 변이가능성에 대한 위험도를 증가시키고 있다. 따라서 이들 타미플루 내성 바이러스의 등장은 인간이 새로운 바이러스 치료제를 지속적으로 개발하여야 하는 당위성을 제공하고 있다. In the process of infection and proliferation of the virus, the virus breaks down sialic acid, which is present outside the cell, using neuraminidase made by the virus to make a new virus inside the cell and spread to other cells after infection. It is necessary to do Tamiflu-resistant avian influenza viruses are known to occur through three genetic variations (Arg292Lys, Asn274Ser, His294Tyr) that normally alter the amino acids of Tamiflu's receptor protein to which Tamiflu binds. Of the three genetic variants, the 294 His, the most highly expressed variant of the Tamiflu-resistant avian influenza virus, changes to Tyr when its hydrophobic residues do not bind to Tamiflu receptors. . It is a virus found in the United States and Europe with a 10-25% chance of being found in the 2007-2008 season, increasing the risk of future mutations. The emergence of these Tamiflu-resistant viruses therefore provides a justification for humans to continue developing new viral therapies.

본 발명에서는 조류 및 돼지 인플루엔자와 신종플루의 방어대책에 대한 시급성을 감안하여 효과가 확인되면 바로 적응이 가능한 식품 및 약용식물을 대상으로 하여 조류 및 돼지 인플루엔자와 신종플루에 대한 뉴라미니데이즈 저해물질을 탐색하였다. 일반적으로 새로운 성분의 약제를 개발하기 위해 기존 약제를 실험적으로 변형시키는 것보다는 전통 의학에서 사용되고 있는 천연물 약제들로부터 새로운 활성 성분을 찾는 것이 여러가지 면에서 장점이 많다. 특히 이러한 활성 성분들은 오랫동안 사용되어 왔기 때문에 약물들에 의한 독성 염려가 적다. 이러한 사실은 신종플루 치료제로서 사용되는 타미플루도 출발물질은 중국의 토착식물인 '스타아니스' 열매를 주원료로 개발한 것에서 확인할 수 있다. In the present invention, the neuraminidase inhibitors against avian and swine influenza and swine flu targeting the food and medicinal plants that can be adapted immediately if the effect is confirmed in view of the urgency against defense measures of avian and swine influenza and swine flu. Explored. In general, finding new active ingredients from natural medicines used in traditional medicine has many advantages over experimental modification of existing drugs to develop new ingredients of medicine. In particular, since these active ingredients have been used for a long time, there is little concern about toxicity due to drugs. This fact can be confirmed from the development of Tamifludo starting material, which is used as a treatment for swine flu, as the main ingredient of 'Staranis' fruit, an indigenous plant in China.

본 발명의 대상인 감초(Glycyrrhiza uralensis, Licorice)는 시베리아 동부와 중국 동북부가 원산인 콩과의 다년초로서 뿌리가 달기 때문에 감초라고 하며 약방의 감초라고 할 정도로 한방약에 거의 포함되는 중요한 생약으로 부작용에 대한 우려가 적다. 감초와 관계된 특허 및 문헌으로 감초 추출물을 이용한 경우는, "알레르기성 비염과 감기의 예방 및 치료용 건강식품 조성물 및 그 제조방법,(한국등록특허 제566542호)"에 감초가 언급되어 있으나 이는 여러 혼합물 중 하나를 언급한 것으로 추출물 중에서 활성을 보여주는 화합물을 분리하여 구조를 확인한 본 특허와는 관련성이 없다. Licorice that is the subject of the present invention ( Glycyrrhiza uralensis (Licorice) is a perennial herb that is native to eastern Siberia and northeastern China, and is called licorice because of its roots. It is an important herbal medicine that is almost included in herbal medicine. In the case of using licorice extract as a patent and literature related to licorice, licorice is mentioned in "Health food composition for preventing and treating allergic rhinitis and cold and its manufacturing method," (Korean Registered Patent No. 566542). It refers to one of the mixtures and is not related to this patent which identifies the structure by separating the compound showing activity in the extract.

감초에서 알려진 화합물을 이용한 특허의 경우, 본 발명에서 주장하는 화합물 4(리코칼콘 A)와 비슷한 리코칼콘 E를 이용한 특허로 "리코칼콘E 및 이를 포함하는 항암조성물(한국등록특허 제564811호)", "항혈전 효과를 나타내는 칼콘 유도체와 그를 포함하는 약학적 조성물 및 그의 제조방법(한국등록특허 제378091호)" 등이 있으나 바이러스 관련 특허는 없다. 최근 스틸벤 계열의 화합물인 레스베라트롤를 이용한 인플루엔자 바이러스에 대한 특허 "인플루엔자 바이러스 감염의 치료에 유용한 약제의 제조를 위한 레스베라트롤의 용도(한국공개특허 제2005-71627호)"가 있으나 본 발명의 내용 또한 다르다. In the case of a patent using a compound known in licorice, a patent using lyocacalcon E similar to compound 4 (lyocacalcon A) claimed in the present invention is "Ricocalcon E and an anticancer composition comprising the same (Korean Patent No. 564811)". , "Calcon derivatives exhibiting antithrombotic effect, pharmaceutical compositions comprising the same, and methods for preparing the same (Korean Patent No. 380981)", and the like, but there are no virus-related patents. Recently, there is a patent for influenza virus using a stilbene-based compound resveratrol, "the use of resveratrol for the manufacture of a medicament useful for the treatment of influenza virus infection (Korean Patent Publication No. 2005-71627)", but the content of the present invention is also different.

본 발명은 감초의 유기용매 추출액으로부터 칼콘 계열의 화합물을 순수 분리하고 이들 화합물 각각을 조류 및 돼지 인플루엔자 바이러스, 신종플루 및 타미플루 내성 신종플루 바이러스의 뉴라미니데이즈(His294Tyr)에 대하여 이들의 활성을 비교하여 본 발명의 화합물이 조류 및 돼지 인플루엔자, 신종플루에 대한 저해활성 이 있음을 확인하였다. The present invention purely isolates the chalcone-based compounds from the organic solvent extracts of licorice and compares these compounds with their activities against avian and swine influenza virus, swine flu and Tamiflu-resistant swine flu virus (His294Tyr). It was confirmed that the compounds of the present invention have inhibitory activity against avian and swine influenza and swine flu.

본 발명의 목적은 조류 및 돼지 인플루엔자 바이러스, 신종플루 및 타미플루 내성 신종플루의 뉴라미니데이즈를 저해하여 조류 인플루엔자와 신종플루 관련 질환에 예방과 치료 효과를 나타내는 감초로부터 순수하게 분리 정제하여 얻은 칼콘 계열의 화합물들을 각각 혹은 2개 이상 혼합하여 유효성분으로 함유하는 조성물을 제공함에 있다.An object of the present invention is a chalcone family obtained by purely isolated and purified from licorice, which prevents and treats avian and swine influenza virus, swine flu, and tamiflu-resistant swine flu neuraminidase, thereby showing prophylactic and therapeutic effects on avian influenza and swine flu-related diseases. The present invention provides a composition containing each or two or more compounds as an active ingredient.

본 발명자들은 상기와 같은 점을 감안하여 각종 자생식물 및 한약재를 채집하여 조류 및 돼지 인플루엔자 바이러스의 배양액을 사용하거나 신종플루 및 타미플루 내성 신종플루 바이러스의 뉴라미니데이즈를 클로닝한 후 이들을 세포 내로 도입하여 뉴라미니데이즈 효소에 대한 저해 작용을 조사하여 감초를 후보식물로 선정하였다. 이 후, 감초로부터 유기용매 알코올(메탄올, 에탄올, 프로판올 등) 또는 수용성 알코올에 의한 추출, 유기용매와 물의 분배, 칼럼크로마토그래피에 의한 방법 , 식물체 성분의 분리 추출에 이용되는 공지의 방법 등을 단독 또는 적합하게 조합하여 용이하게 얻을 수가 있다. 조추출물은 필요에 따라서 상법에 따라서 더욱 정제할 수 있다.In view of the above, the present inventors have collected various native plants and herbal medicines and used a culture solution of avian and swine influenza virus or cloned neuraminidase of swine flu and Tamiflu-resistant swine flu virus, and then introduced them into cells. Licorice was selected as a candidate plant by investigating the inhibitory effect on miniday enzyme. Subsequently, extraction with organic solvent alcohol (methanol, ethanol, propanol, etc.) or water-soluble alcohol from licorice, distribution of organic solvent and water, method by column chromatography, well-known methods used for separation extraction of plant components, etc. Or it can obtain easily by combining suitably. The crude extract can be further purified according to a commercial method as needed.

본 발명은 바람직하게 감초를 알코올로 추출한 후 크로마토그래피를 이용하여 순수 분리 정제하고 화학구조 및 물리화학적 특성규명을 통하여 구조를 확인한 다수의 칼콘계 화합물 중 하기 화학식 1로 표시되는 리코칼콘 F(화합물 1), 에치나 틴(화합물 2), 리코칼콘 D(화합물 3), 리코칼콘 A(화합물 4), 이소리크리티제닌(화합물 5), 리코아그로칼콘 A(화합물 6), 5-프레닐부테인(화합물 7) 및 칸조놀 C(화합물 8)이 바이러스 기원 뉴라미니데이즈, 타미플루 내성 뉴라미니데이즈에 저해 작용을 측정하는 방법으로 활성을 확인한 후 본 발명을 완성하였다. According to the present invention, licochalcone F (compound 1) represented by the following Chemical Formula 1 of a plurality of chalcone-based compounds obtained by extracting licorice with alcohol and separating and purifying pure water using chromatography and confirming the structure through chemical structure and physicochemical characterization ), Echinatin (Compound 2 ), Lycochalcone D (Compound 3 ), Lycochalcone A (Compound 4 ), Isocristygenin (Compound 5 ), Ricoagrochalcone A (Compound 6 ), 5-Phenylbutane ( The present invention was completed after the activity of compound 7 ) and cansonol C (compound 8 ) was confirmed by measuring the inhibitory effect on the virus-derived neuraminidase and Tamiflu-resistant neuraminidase.

Figure 112009065311795-pat00001
Figure 112009065311795-pat00001

본 발명은 상기한 화합물 중 적어도 하나의 화합물을 유효성분으로 포함하여 뉴라미니데이즈를 저해하여 조류 및 돼지 인플루엔자, 신종플루 관련 질환을 예방 또는 치료하는 것을 특징으로 한다.The present invention is characterized by including at least one compound of the above compounds as an active ingredient to inhibit neuraminidase to prevent or treat avian and swine influenza, swine flu-related diseases.

상기 화합물은 감초의 유기용매 추출액으로부터 칼콘 계열의 화합물을 순수 분리 분리 정제하는 단계; 상기 단계에서 얻은 칼콘계 화합물의 화학구조 및 물리화학적 특성을 조사하는 단계; 신종플루 바이러스의 뉴라미니데이즈, 타미플루 내성 신종플루 바이러스의 뉴라미니데이즈(His294Tyr)를 만드는 단계; 상기 칼콘 계열 화합물의 조류 인플루엔자 바이러스(H9N2)와 돼지 인플루엔자 바이러스(H1N1)의 뉴라미니데이즈 및 신종플루 바이러스와 타미플루 내성 신종플루 바이러스의 뉴라미니데이즈에 대한 저해 작용을 측정하는 단계를 통하여 활성이 존재함을 알았다.The compound is a step of separating and purifying pure chalcone-based compound from the organic solvent extract of licorice; Examining the chemical structure and physicochemical properties of the chalcone-based compound obtained in the step; Making neuraminidase of the swine flu virus, neuraminidase of the Tamiflu resistant swine flu virus (His294Tyr); Activity is measured through the step of measuring the inhibitory action of the avian influenza virus (H9N2) and swine influenza virus (H1N1) of the chalcone-based compound against the neuraminidase and the swine flu virus and the Tamiflu-resistant swine flu virus I knew.

본 발명에 따른 조류 인플루엔자 바이러스(H9N2)와 돼지 인플루엔자 바이러스(H1N1)의 뉴라미니데이즈 및 신종플루 바이러스와 타미플루 내성 신종플루 바이러스의 뉴라미니데이즈에 대한 저해 화합물은 감초로부터 유기용매(알코올, 알코올수용액, 에틸아세테이트, 에테르, 아세톤, 클로로포름 등)에 의한 추출, 헥산과 물의 분배, 디아이온 HP-20 레진과 같은 흡착수지 사용방법, 칼럼 크로마토그래피에 의한 방법 등 식물체 성분의 분리 추출에 이용되는 공지의 방법을 단독 또는 적합하게 조합하여 용이하게 얻을 수가 있다. 조추출물은 필요에 따라서 상법에 따라서 더욱 정제할 수 있다.Inhibitory compounds of avian influenza virus (H9N2) and swine influenza virus (H1N1) against neuraminidase and swine flu virus and Tamiflu-resistant swine flu virus neuraminidase from organic liquor from licorice (alcohol, alcohol aqueous solution, Known methods used for the separate extraction of plant components, such as extraction with ethyl acetate, ether, acetone, chloroform, etc., distribution of hexane and water, use of adsorption resins such as DIION HP-20 resin, method by column chromatography It can be obtained easily by combining single or suitably. The crude extract can be further purified according to a commercial method as needed.

조추출물은 필요에 따라서 상법에 따라서 더욱 정제할 수 있다. 본 발명에서 사용하는 크로마토그래피에는 실리카겔 칼럼 크로마토그래피(silica gel column chromatography), 엘에이취-20 칼럼 크로마토그래피(LH-20 column chromatography), 박층 크로마토그래피(TLC; thin layer chromatography) 및 고성능 액체 크로마토그래피(high performance liquid chromatography) 등이 이용될 수 있다.The crude extract can be further purified according to a commercial method as needed. The chromatography used in the present invention includes silica gel column chromatography, L-20 column chromatography, thin layer chromatography (TLC) and high performance liquid chromatography (TLC). high performance liquid chromatography) and the like.

본 발명에 따른 칼콘계 화합물은 콩과 식물인 감초로부터 쉽게 분리할 수 있을 뿐만 아니라 안정도도 높으므로 식품, 의약품의 첨가제로 이용할 수 있다.The chalcone-based compound according to the present invention can be easily separated from licorice, which is a legume, and also has high stability, and thus can be used as an additive for food and medicine.

본 발명에 따른 추출물을 포함하는 약학조성물은, 각각 통상의 방법에 따라 산제, 과립제, 정제, 캡슐제, 현탁액, 에멀젼, 시럽, 에어로졸 등의 경구형 제형, 외용제, 좌제 및 멸균 주사용액의 형태로 제형화하여 사용될 수 있다. 추출물을 포함하는 조성물에 포함될 수 있는 담체, 부형제 및 희석제로는 락토즈, 덱스트로즈, 수크로스, 솔비톨, 만니톨, 자일리톨, 에리스리톨, 말티톨, 전분, 아카시아 고무, 알지네이트, 젤라틴, 칼슘 포스페이트, 칼슘 실리케이트, 셀룰로즈, 메틸 셀룰로즈, 미정질 셀룰로스, 폴리비닐 피롤리돈, 물, 메틸히드록시벤조에이트, 프로필히드록시벤조에이트, 탈크, 마그네슘 스테아레이트 및 광물유를 들 수 있다. 제제화 할 경우에는 보통 사용하는 충진제, 증량제, 결합제, 습윤제, 붕해제, 계면활성제 등의 희석제 또는 부형제를 사용하여 조제된다. 경구투여를 위한 고형제제에는 정제, 환제, 산제, 과립제, 캡슐제 등이 포함되며, 이러한 고형제제는 상기 추출물에 적어도 하나 이상의 부형제 예를 들면, 전분, 탄산칼슘, 수크로스 또는 락토오스, 젤라틴 등을 섞어 조제된다. 또한 단순한 부형제 이외에 마그네슘 스테아레이트, 탈크 같은 윤활제들도 사용된다. 경구를 위한 액상 제제로는 현탁제, 내용액제, 유제, 시럽제 등이 해당되는데 흔히 사용되는 단순희석제인 물, 리퀴드 파라핀 이외 에 여러 가지 부형제, 예를 들면 습윤제, 감미제, 방향제, 보존제 등이 포함될 수 있다. 비경구 투여를 위한 제제에는 멸균된 수용액, 비수성용제, 현탁제, 유제, 동결건조 제제, 좌제가 포함된다. 비수성용제, 현탁제로는 프로필렌글리콜, 폴리에틸렌 글리콜, 올리브 오일과 같은 식물성 기름, 에틸올레이트와 같은 주사 가능한 에스테르 등이 사용될 수 있다. 좌제의 기제로는 위텝솔(witepsol), 마크로골, 트윈(tween) 61, 카카오지, 라우린지, 글리세로제라틴 등이 사용될 수 있다. Pharmaceutical compositions comprising extracts according to the invention, in the form of powders, granules, tablets, capsules, suspensions, emulsions, syrups, aerosols and the like, oral preparations, suppositories and sterile injectable solutions, respectively, according to conventional methods. Can be formulated and used. Examples of carriers, excipients and diluents that can be included in the composition containing the extract include lactose, dextrose, sucrose, sorbitol, mannitol, xylitol, erythritol, maltitol, starch, acacia rubber, alginate, gelatin, calcium phosphate, calcium silicate , Cellulose, methylcellulose, microcrystalline cellulose, polyvinylpyrrolidone, water, methylhydroxybenzoate, propylhydroxybenzoate, talc, magnesium stearate and mineral oil. When formulated, diluents or excipients such as fillers, extenders, binders, wetting agents, disintegrating agents and surfactants are usually used. Solid preparations for oral administration include tablets, pills, powders, granules, capsules, and the like, and the solid preparations include at least one excipient such as starch, calcium carbonate, sucrose or lactose, gelatin, and the like. Mix is prepared. In addition to simple excipients, lubricants such as magnesium stearate and talc are also used. Oral liquid preparations include suspensions, solvents, emulsions, and syrups, and may include various excipients, such as wetting agents, sweeteners, fragrances, and preservatives, in addition to commonly used simple diluents such as water and liquid paraffin. have. Formulations for parenteral administration include sterile aqueous solutions, non-aqueous solvents, suspensions, emulsions, lyophilized preparations, suppositories. As the non-aqueous solvent and suspending agent, propylene glycol, polyethylene glycol, vegetable oil such as olive oil, injectable ester such as ethyl oleate and the like can be used. As the base of the suppository, witepsol, macrogol, tween 61, cacao butter, laurin butter, glycerogelatin and the like can be used.

상기 활성성분의 투여량은 치료 받을 대상의 연령, 성별, 체중과, 치료할 특정 질환 또는 병리 상태, 질환 또는 병리 상태의 심각도, 투여경로 및 처방자의 판단에 따라 달라질 것이다. 이러한 인자에 기초한 투여량 결정은 당업자의 수준 내에 있으며, 일반적으로 투여량은 0.01㎎/㎏/일 내지 대략 2000㎎/㎏/일의 범위이다. 더 바람직한 투여량은 0.1㎎/㎏/일 내지 500㎎/㎏/일이다. 투여는 하루에 한번 투여할 수도 있고, 수회 나누어 투여할 수도 있다. 상기 투여량은 어떠한 면으로든 본 발명의 범위를 한정하는 것은 아니다. 본 발명의 추출물은 쥐, 가축, 인간 등의 포유동물에 다양한 경로로 투여될 수 있다. 투여의 모든 방식은 예상될 수 있는데, 예를 들면, 경구, 직장 또는 정맥, 근육, 피하, 자궁내 경막 또는 뇌혈관내 주사에 의해 투여될 수 있다. 본 발명의 추출물은 독성 및 부작용은 거의 없으므로 예방 목적으로 장기간 복용시에도 안심하고 사용할 수 있는 약제이다. The dosage of the active ingredient will vary depending on the age, sex and weight of the subject to be treated, the particular disease or pathology to be treated, the severity of the disease or pathology, the route of administration and the judgment of the prescriber. Dosage determination based on these factors is within the level of skill in the art and generally dosages range from 0.01 mg / kg / day to approximately 2000 mg / kg / day. More preferred dosage is 0.1 mg / kg / day to 500 mg / kg / day. Administration may be administered once a day or may be divided several times. The dosage does not limit the scope of the invention in any aspect. The extract of the present invention can be administered to mammals such as mice, livestock, humans, etc. by various routes. All modes of administration can be expected, for example, by oral, rectal or intravenous, intramuscular, subcutaneous, intrauterine dural or cerebrovascular injections. Since the extract of the present invention has little toxicity and side effects, it is a drug that can be used safely even when taken for long periods of time.

또한, 본 발명은 상기 감초 추출물 및 식품학적으로 허용 가능한 식품보조 첨가제를 포함하는 조류 및 돼지 인플루엔자와 신종플루 예방을 위한 건강 기능 식품을 제공한다. 본 발명의 건강기능식품은 정제, 캡슐제, 환제 또는 액제 등의 형 태를 포함하며, 본 발명의 화합물을 첨가할 수 있는 식품으로는, 예를 들어, 각종 식품류, 음료, 껌, 차, 비타민 복합제, 건강 기능성 식품류 등이 있다. 상세하게는, 본 발명은 감초 추출물을 유효성분으로 함유하는 추출물 및 식품학적으로 허용 가능한 식품보조 첨가제를 포함하는 신종플루 관련 질환의 예방과 치료용 건강 기능 식품을 제공한다. In addition, the present invention provides a dietary supplement for the prevention of algae and swine influenza and swine flu, including the licorice extract and food acceptable additives. The health functional food of the present invention includes the form of tablets, capsules, pills, or liquids, and the food to which the compound of the present invention can be added includes, for example, various foods, beverages, gums, teas, vitamins, and the like. Complex, health functional foods, and the like. In detail, the present invention provides a functional food for the prevention and treatment of swine flu-related diseases, including an extract containing licorice extract as an active ingredient and a food acceptable additive.

본 발명은 상기 감초 추출물 및 칼콘 화합물을 포함하는 동물질병의 예방 및 치료할 목적으로 사료첨가제 및 치료물질로 사용 가능하다. 본 발명의 사료첨가제 및 치료물질은 동물과 인간에게서 공통적으로 발병하는 뉴라미니데이즈 관련 인수공통성 질환인 세균 감염에 의한 감염성 장염 등에도 사용가능하며, 특히 신종플루, 조류 및 돼지 인플루엔자와 관련한 질환의 예방과 치료용 동물사료 첨가제, 동물약품을 제공한다. The present invention can be used as feed additives and therapeutic substances for the purpose of preventing and treating animal diseases including the licorice extract and the chalcone compound. The feed additive and the therapeutic substance of the present invention can be used for infectious enteritis caused by bacterial infection, which is a common common disease related to neuraminidase, which commonly occurs in animals and humans, and especially for preventing diseases related to swine flu, bird, and swine influenza. And animal feed additives for the treatment, animal drugs are provided.

본 발명에 따른 감초 추출물과 칼콘계 화합물은 조류 및 돼지 인플루엔자 바이러스 또는 신종플루 바이러스 기원 뉴라미니데이즈 및 타미플루 내성 신종플루 바이러스의 뉴라미니데이즈를 비경쟁적으로 저해하는 치료효과를 가지며 타미플루에 내성을 갖는 타미플루 내성 신종플루 바이러스에도 동일하게 뉴라미니데이즈를 저해할 수 있었다. Licorice extract and chalcone-based compounds according to the present invention have a therapeutic effect of non-competitively inhibiting neuraminidase of avian and swine influenza virus or swine flu virus neuraminidase and Tamiflu-resistant swine flu virus, and Tamiflu resistant to Tamiflu. Resistant H1N1 virus could similarly inhibit neuraminidase.

더욱이, 타미플루와 본 발명의 화합물을 조류 인플루엔자(H9N2), 돼지 인플루엔자(H1N1) 바이러스에 병용처리하였을 경우 타미플루의 사용량을 줄일 수 있었는데(본 특허에선 상기 결과는 나타내지 않음) 이러한 상승효과는 신종플루 바이러 스의 뉴라미니데이즈, 타미플루 내성 신종플루 바이러스의 뉴라미니데이즈에서도 비슷하게 작동하고 있음을 확인하였다. Moreover, when Tamiflu and the compound of the present invention were treated in combination with avian influenza (H9N2) and swine influenza (H1N1) viruses, the amount of Tamiflu could be reduced (the result is not shown in this patent). It has been confirmed that the neuraminidase of these species and the neuraminidase of the Tamiflu-resistant H1N1 virus have a similar function.

이로써 본 발명에 따른 감초 추출물과 이로부터 분리된 칼콘계 화합물은 조류 인플루엔자 바이러스와 돼지인플루엔자 바이러스, 신종플루 바이러스 및 타미플루 내성 신종플루 바이러스의 뉴라미니데이즈를 저해하여 조류 인플루엔자와 신종플루 관련 질환의 예방과 치료의 효과를 기대할 수 있다. Thus, licorice extract and chalcone-based compounds isolated therefrom inhibit the neuraminidase of avian influenza virus, swine influenza virus, swine flu virus, and Tamiflu-resistant swine flu virus to prevent avian influenza and swine flu-related diseases. The effectiveness of the treatment can be expected.

또한 오랫동안 한약 처방에서 여러 한약 재료의 약성을 중화하기 위하여 교미제로 사용하여 왔기에 안전성을 보장받을 수 있는 감초로부터 추출 분리 정제한 것이므로 세포 독성이 적어 의약품, 화장품, 건강식품, 동물사료, 동물약품 등에 매우 유용하게 사용 및 응용될 수 있다. In addition, since it has been used as a copulation agent to neutralize the medicinal properties of various Chinese medicine ingredients for a long time, it is extracted and purified from licorice which can guarantee safety. It can be very usefully used and applied.

이하 본 발명의 바람직한 실시예를 상세히 설명하기로 한다. 그러나, 본 발명은 여기서 설명되는 실시예에 한정되지 않고 다른 형태로 구체화될 수도 있다. 오히려, 여기서 소개되는 내용이 철저하고 완전해질 수 있도록 그리고 당업자에게 본 발명의 사상이 충분히 전달될 수 있도록 하기 위해 제공되는 것이다. Hereinafter, a preferred embodiment of the present invention will be described in detail. However, the present invention is not limited to the embodiments described herein and may be embodied in other forms. Rather, it is provided to ensure that the contents introduced herein are thorough and complete, and that the spirit of the present invention to those skilled in the art can fully convey.

<< 실시예Example 1 : 감초로부터 활성 화합물의 용매 추출조건의 검토> 1: Study on Solvent Extraction Conditions of Active Compounds from Licorice>

감초로부터 활성물질의 용매 추출정도를 비교하기 위하여, 증류수, 30 내지 100% 에탄올 수용액, 메탄올, 아세톤, 에틸아세테이트, 클로로포름의 용매를 사용하여 활성성분의 추출정도를 비교하기 위하여 감초 100g에 대해 상기 해당용매 300㎖을 사용하여 2시간 동안 3회에 걸쳐 초음파 추출한 후 추출액을 감압 농축하였 다. 추출된 추출물질의 양을 비교한 결과, 3.6g(아세톤)부터 32.5g(증류수)의 추출량을 보여 주었다. 이후 이들 추출물의 활성을 뉴라미니데이즈에 대한 활성정도를 비교하기 위하여 각각의 추출물을 최종농도 20μg/㎖의 농도로 하여 각각 추출물의 활성정도를 실시예 4-2의 바이러스 배양액과 실시예 6의 방법을 이용하여 측정하였다. 표 1에서 보여준 결과에서 볼 수 있는 바와 같이, 추출물은 50~100% 에탄올, 메탄올 추출액에서 활성이 좋았으나, 인체에게 허용되는 추출용매 및 각 용매조건에서 추출된 양과 활성정도를 비교하여 70% 에탄올 추출물을 최적 추출조건으로 설정하였다. To compare the degree of solvent extraction of the active substance from licorice, using the solvent of distilled water, 30-100% ethanol aqueous solution, methanol, acetone, ethyl acetate, chloroform to compare the extraction degree of the active ingredient with respect to licorice 100g Ultrasonic extraction was performed three times for 2 hours using 300 ml of solvent, and the extract was concentrated under reduced pressure. As a result of comparing the amount of the extracted extract, it was shown that the amount of extract from 3.6g (acetone) to 32.5g (distilled water). Then, in order to compare the activity of these extracts with respect to neuraminidase, each extract was prepared at the final concentration of 20 μg / ml, and the activity of each extract was determined using the virus culture medium of Example 4-2 and Example 6 Measured using. As can be seen from the results shown in Table 1, the extract was good in 50 ~ 100% ethanol, methanol extract, but 70% ethanol by comparing the amount and activity of the extraction solvent and the amount of solvents that are acceptable to the human body The extract was set to the optimum extraction conditions.

조건 Condition 추출량 Extraction amount 돼지 인플루엔자 바이러스 기원 뉴라미니데이즈에 대한 저해활성(20μg/㎖) Inhibitory activity against porcine influenza virus-derived neuraminidase (20 μg / mL) 30% 에탄올 30% ethanol 26.0g 26.0 g 19.3% 19.3% 50% 에탄올 50% ethanol 23.1g 23.1 g 36.9% 36.9% 70% 에탄올 70% ethanol 18.0g 18.0 g 38.5% 38.5% 90% 에탄올 90% ethanol 14.7g 14.7g 34.5% 34.5% 에탄올 ethanol 7.6g 7.6 g 35.1% 35.1% 메탄올 Methanol 11.5g 11.5 g 33.8% 33.8% 아세톤 Acetone 3.6g 3.6 g 5% 이하 5% less than 에틸아세테이트 Ethyl acetate 5.6g 5.6 g 12.4% 12.4% 클로로포름 chloroform 6.5g 6.5g 5% 이하 5% less than 증류수 Distilled water 32.5g 32.5 g 5% 이하 5% less than

<< 실시예Example 2 : 감초로부터 용매 추출물과  2: solvent extract from licorice 칼톤계Carlton 화합물의 분리> Isolation of Compounds>

감초의 건조된 뿌리 3㎏을 70% 에탄올 10ℓ를 사용하여 4시간 동안 3회 걸쳐 초음파 추출하였다. 상기 70% 에탄올 추출물(이하, 'A 분획'이라 칭함)을 감압 농축한 후 이 추출물 350g을 물(2ℓ)로 현탁한 후 n-헥산(2ℓ) 추출물(이하, 'B 분획'이라 칭함), 에틸 아세테이트(2ℓ) 추출물(이하, 'C 분획'이라 칭함), 부탄올(2ℓ) 추출물(이하, 'D 분획'이라 칭함)로 순차적으로 용매 분획한 다음 각각의 용매 분획의 감압농축물에 대하여 조류 인플루엔자 바이러스, 돼지 인플루엔자 바이러스 뉴라미니데이즈 활성을 측정한 결과, 에틸아세테이트 분획에서 강한 활성을 나타내었다. 3 kg of dried licorice root was sonicated three times for 4 hours using 10 L of 70% ethanol. The 70% ethanol extract (hereinafter referred to as 'A fraction') was concentrated under reduced pressure, and then 350 g of the extract was suspended with water (2 L), followed by n-hexane (2 L) extract (hereinafter referred to as 'B fraction'), Solvent fractionation was sequentially performed with ethyl acetate (2 L) extract (hereinafter referred to as the 'C fraction') and butanol (2 L) extract (hereinafter referred to as the 'D fraction'), followed by algae concentration under reduced pressure in each solvent fraction. Influenza virus and swine influenza virus neuraminidase activity was measured, and the ethyl acetate fraction showed strong activity.

에틸아세테이트 분획 50g을 헥산-아세톤 4:1 → 0:1의 용매 구배 조건으로 실리카겔 컬럼크로마토그래피를 실시하여 6개의 분획을 얻었다(fr.1~6). 이 분획들 중 강한 활성을 나타내는 분획 2(10.5g)를 세파덱스 LH-20(Sephadex LH-20) 레진에 로딩한 후 메탄올로 용출하여 화합물 4(리코칼콘 A) 6.2g을 얻을 수 있었다. 분획 3(4.5g)을 MeOH-H2O 혼합용매로 사용하여 5:5부터 10:0까지 순차적으로 증가시키는 조건을 사용하여 역상(RP-18) 컬럼크로마토그래피를 실시하여 다시 8개의 소분획을 얻었다(fr.3.1-3.8). 소분획 F3.2(120mg)를 MeOH-H2O(0-55min: 62% MeOH, 60min: 100% MeOH)을 사용하여 HPLC [YMC Pak C18 column 20×150mm; 4μm 입자 크기 3㎖/min; UV detection: 254nm]를 실시하여 화합물 2(에치나틴, 20㎎, tR = 25.0min), 화합물 7(5-프레닐부테인, 1.5㎎, tR = 50.0min)을 얻었다. 소분획 F3.3(250mg)을 MeOH-H2O (0-55min: 65% MeOH, 60min: 100% MeOH)을 사용하여 소분획 F3.2를 분리한 동일조건의 HPLC를 실시하여 화합물 3(리코칼콘 D, 17㎎, tR = 42.0min), 화합물 1(리코칼콘 F, 5.0㎎, tR = 50.0min)을 얻었으며, 소분획 F3.4(250mg)으로부터 사용한 메탄올의 용매를 68%까지 증가시켜 화합물 5(이소리크리티제닌, 18.0㎎, tR = 43.0min)과 화합물 6(리코아그로칼콘 A, 2.0㎎, tR = 48.0min)를 얻었다. 최종적으로 소분획 F3.6의 일부를 취하여 MeOH-H2O을 86% 사용한 조건에서 화합물 8(칸조놀 C, 4.0㎎, tR = 60.0min)를 얻었다(도 1 참조). 50 g of ethyl acetate fractions were subjected to silica gel column chromatography under a solvent gradient of hexane-acetone 4: 1 to 0: 1 to obtain 6 fractions (fr. 1 to 6). Among these fractions, Fraction 2 (10.5 g) showing strong activity was loaded onto Sephadex LH-20 (Sephadex LH-20) resin and eluted with methanol to obtain 6.2 g of Compound 4 (Licocalcon A). Reverse phase (RP-18) column chromatography was performed again under the condition that fraction 3 (4.5 g) was sequentially increased from 5: 5 to 10: 0 using MeOH-H 2 O mixed solvent. Was obtained (fr.3.1-3.8). Small fraction F3.2 (120 mg) was purified by HPLC [YMC Pak C 18 column 20 × 150 mm using MeOH—H 2 O (0-55 min: 62% MeOH, 60 min: 100% MeOH); 4 μm particle size 3 ml / min; UV detection: 254 nm] was carried out to obtain Compound 2 (Echinatin, 20 mg, t R = 25.0 min) and Compound 7 (5-prenylbutane, 1.5 mg, t R = 50.0 min). Small fraction F3.3 (250mg) with MeOH-H 2 O (0-55min: 65% MeOH, 60min: 100% MeOH) subjected to HPLC in the same conditions to release the small fraction F3.2 using Compound 3 ( Ricokalcon D, 17 mg, t R = 42.0 min), Compound 1 (Ricochalcon F, 5.0 mg, t R = 50.0 min) were obtained and 68% solvent of methanol used from small fraction F3.4 (250 mg) was obtained. Compound 5 (Isocristygenin, 18.0 mg, t R = 43.0 min) and Compound 6 (Ricoagrochalcon A, 2.0 mg, t R = 48.0 min) were obtained. Finally, a portion of subfraction F3.6 was taken to obtain compound 8 (canzonol C, 4.0 mg, t R = 60.0 min) under conditions using 86% MeOH-H 2 O (see FIG. 1).

상기 뉴라미니데이즈 활성은 실시예 6의 방법으로 확인하였고, 실시예 7과 표 2 및 표 3에 결과를 나타내었다.The neuraminidase activity was confirmed by the method of Example 6, the results are shown in Example 7 and Table 2 and Table 3.

<< 실시예Example 3 :  3: 칼콘계Calcon 화합물의 물리 화학적 특성 및 화학구조 분석> Physical and chemical properties and chemical structure analysis of compounds>

상기 실시예 2에서 감초로부터 분리된 8종 화합물의 구조를 분석하였다. 화합물의 화학적 구조를 ESI 질량분석기(Electrospray Ionization mass spectrometer)을 사용하여 얻은 분자량 및 핵자기 공명 분석의 1H 및 13C-NMR 분석 결과를 토대로 화합물의 구조를 분석하였다. In Example 2, the structure of 8 compounds isolated from licorice was analyzed. The chemical structure of the compound was analyzed based on 1 H and 13 C-NMR analysis of molecular weight and nuclear magnetic resonance analysis obtained using an ESI mass spectrometer.

그 결과, 구조 결정된 화합물은 상기 화학식 1에서 보여준 구조를 가졌으며, 분리된 화합물의 화학적 특성 및 화합물 1 내지 화합물 81H, 13C-NMR 결과값을 정리하여 하기에 표시하였다.As a result, the structure-determined compound had the structure shown in Formula 1 above, and summarized the chemical properties of the separated compound and the 1 H, 13 C-NMR results of the compound 1 to compound 8 are shown below.

리코칼콘 F(Licochalcone F, 화합물 1): Yellow needle; UV (MeOH) λmax nm (log ε): 260 (3.76), 380 (4.09); IR (KBr) max 3420, 2965, 1601, 1557, 1445, 1285, 1166cm-1 ; EI MS m/z (rel. int.): 354 ([M]+, 27), 349 (10), 324 (23), 323 (100), 137 (42); HREI MS m/z 354.1465 [M]+ (Calcd. for C21H22O5, 354.1467); 1H-NMR (CD3COCD3, 500 MHz) δ 7.98 (1H, d, J = 15.5Hz, H-β), 7.64 (1H, d, J = 15.5Hz, H-α), 7.60 (1H, d, J = 8.0Hz, H-6'), 7.58 (1H, s, H-6), 7.56 (1H, d, J = 8.0Hz, H-5'), 6.94 (1H, d, J = 2.1Hz, H-3'), 6.58 (1H, s, H-3), 6.30 (1H, dd, J = 17.0 and 11.0Hz, H-2"), 5.04 (1H, dd, J = 17.0 and 1.5Hz, H-3"), 4.99 (1H, dd, J = 11.0 and 1.5Hz, H-3"), 3.87 (3H, s, OCH3), 1.51 (6H, s, H-4", H-5"); 13C-NMR (CD3COCD3, 125 MHz) δ 188.5 (C=O), 159.9 (C-2', s), 159.8 (C-2, s), 150.5 (C-4, s), 148.7 (C-2", d), 145.8 (C-4', s), 139.8 (C-β, d), 132.5 (C-1', s), 129.4 (C-1, C-6' d), 127.6 (C-5, s), 122.7 (C-6, d), 119.7 (C-α, d), 116.1 (C-5', d), 115.6 (C-3', d), 110.9 (C-3", t), 101.1 (C-3, d), 56.0 (OCH3), 40.8 (C-1", s), 27.6 (C-4", C-5", q). Rico chalcone F (Licochalcone F, Compound 1 ): Yellow needle; UV (MeOH) λ max nm (log ε): 260 (3.76), 380 (4.09); IR (KBr) max 3420, 2965, 1601, 1557, 1445, 1285, 1166 cm −1 ; EI MS m / z (rel. Int.): 354 ([M] + , 27), 349 (10), 324 (23), 323 (100), 137 (42); HREI MS m / z 354.1465 [M] + ( Calcd . For C 21 H 22 O 5 , 354.1467); 1 H-NMR (CD 3 COCD 3 , 500 MHz) δ 7.98 (1H, d, J = 15.5 Hz, H-β), 7.64 (1H, d, J = 15.5 Hz, H-α), 7.60 (1H, d, J = 8.0 Hz, H-6 '), 7.58 (1H, s, H-6), 7.56 (1H, d, J = 8.0 Hz, H-5'), 6.94 (1H, d, J = 2.1 Hz, H-3 '), 6.58 (1H, s, H-3), 6.30 (1H, dd, J = 17.0 and 11.0 Hz, H-2 "), 5.04 (1H, dd, J = 17.0 and 1.5 Hz , H-3 "), 4.99 (1H, dd, J = 11.0 and 1.5 Hz, H-3"), 3.87 (3H, s, OCH 3 ), 1.51 (6H, s, H-4 ", H-5 13 ) C-NMR (CD 3 COCD 3 , 125 MHz) δ 188.5 (C = O), 159.9 (C-2 ', s), 159.8 (C-2, s), 150.5 (C-4, s ), 148.7 (C-2 ", d), 145.8 (C-4 ', s), 139.8 (C-β, d), 132.5 (C-1', s), 129.4 (C-1, C-6 'd), 127.6 (C-5, s), 122.7 (C-6, d), 119.7 (C-α, d), 116.1 (C-5', d), 115.6 (C-3 ', d) , 110.9 (C-3 ", t), 101.1 (C-3, d), 56.0 (OCH 3), 40.8 (C-1", s), 27.6 (C-4 ", C-5", q) .

에치나틴(Echinatin, 화합물 2): Yellow needle; UV λmax (MeOH): 236, 312, 369nm; EI-MS m/z: 270 [M]+ (21), 239 (100), 121 (20); 1H-NMR (CD3COCD3, 500 MHz) δ 8.03 (1H, d, J = 15.5Hz, H-β), 8.02 (2H, d, J = 8.5Hz, H-2', H-6'), 7.69 (1H, d, J = 8.0Hz, H-6), 7.68 (1H, d, J = 15.5Hz, H-α), 6.94 (2H, d, J = 8.5Hz, H-3', H-5'), 6.55 (1H, s, H-3), 6.51 (1H, d, J = 8.0Hz, H-5), 3.95 (3H, s, OCH3); 13C-NMR (CD3COCD3, 125 MHz) δ 188.5 (C=O), 162.3 (C-4', s), 162.1 (C-4, s), 161.4 (C-2, s), 139.3 (C-β, d), 131.8 (C-1', s), 131.6 (C-2', C-6', d), 131.2 (C-6, d), 119.6 (C-α, d), 116.8 (C-1, s), 116.7 (C-3', C-5', d), 108.9 (C-5, d), 99.9 (C-3, d), 56.0 (OCH3). Value or a tin (Echinatin, compound 2): Yellow needle; UV λ max (MeOH): 236, 312, 369 nm; EI-MS m / z : 270 [M] + (21), 239 (100), 121 (20); 1 H-NMR (CD 3 COCD 3 , 500 MHz) δ 8.03 (1H, d, J = 15.5 Hz, H-β), 8.02 (2H, d, J = 8.5 Hz, H-2 ', H-6' ), 7.69 (1H, d, J = 8.0 Hz, H-6), 7.68 (1H, d, J = 15.5 Hz, H-α), 6.94 (2H, d, J = 8.5 Hz, H-3 ', H-5 '), 6.55 ( 1H, s, H-3), 6.51 (1H, d, J = 8.0Hz, H-5), 3.95 (3H, s, OCH 3); 13 C-NMR (CD 3 COCD 3 , 125 MHz) δ 188.5 (C = O), 162.3 (C-4 ', s), 162.1 (C-4, s), 161.4 (C-2, s), 139.3 (C-β, d), 131.8 (C-1 ', s), 131.6 (C-2', C-6 ', d), 131.2 (C-6, d), 119.6 (C-α, d) , 116.8 (C-1, s), 116.7 (C-3 ', C-5', d), 108.9 (C-5, d), 99.9 (C-3, d), 56.0 (OCH 3 ).

리코칼콘 D(Licochalcone D, 화합물 3): Yellow needle; UV λmax (MeOH): 254, 359nm; EI-MS m/z: 354 [M]+ (9), 323 (100), 267 (12); 1H-NMR (CD3COCD3, 500 MHz) δ 7.95 (1H, d, J = 16.0Hz, β), 7.93 (1H, brs, H-2'), 7.88 (1H, d, J = 8.5Hz, H-6'), 7.70 (1H, d, J = 16.0Hz, H-α), 7.28 (1H, d, J = 8.0 Hz, H-6), 6.96 (1H, d, J = 8.5Hz, H-5'), 6.71 (1H, d, J = 8.0Hz, H-5), 5.38 (1H, m, H-2"), 3.86 (3H, s, OCH3), 3.39 (2H, d, J = 7.5Hz, H-1"), 1.74 (3H, s, H-4"), 1.73 (3H, s, H-5"); 13C-NMR (CD3COCD3, 125 MHz) δ 188.6 (C=O), 160.2 (C-4', s), 149.6 (C-4, s), 149.2 (C-2, s), 139.2 (C-3, s), 139.1 (C-β, d), 133.1 (C-1', s), 131.7 (C-6', d), 131.4 (C-3", s), 129.2 (C-3', s), 129.1 (C-2', d), 123.2 (C-2", d), 121.5 (C-1, s), 120.9 (C-α, d), 120.1 (C-6, d), 115.6 (C-5', d), 112.5 (C-5, d), 61.7 (OCH3), 25.9 (C-1", t), 25.9 (C-5", q), 17.9 (C-4", q). Rico chalcone D (Licochalcone D, compound 3): Yellow needle; UV λ max (MeOH): 254, 359 nm; EI-MS m / z : 354 [M] + (9), 323 (100), 267 (12); 1 H-NMR (CD 3 COCD 3 , 500 MHz) δ 7.95 (1H, d, J = 16.0 Hz, β), 7.93 (1H, brs, H-2 ′), 7.88 (1H, d, J = 8.5 Hz , H-6 '), 7.70 (1H, d, J = 16.0 Hz, H-α), 7.28 (1H, d, J = 8.0 Hz, H-6), 6.96 (1H, d, J = 8.5 Hz, H-5 '), 6.71 (1H, d, J = 8.0 Hz, H-5), 5.38 (1H, m, H-2 "), 3.86 (3H, s, OCH 3 ), 3.39 (2H, d, J = 7.5 Hz, H-1 "), 1.74 (3H, s, H-4"), 1.73 (3H, s, H-5 "); 13 C-NMR (CD 3 COCD 3 , 125 MHz) δ 188.6 (C = O), 160.2 (C-4 ', s), 149.6 (C-4, s), 149.2 (C-2, s), 139.2 (C-3, s), 139.1 (C-β, d), 133.1 (C-1 ', s), 131.7 (C-6', d), 131.4 (C-3 ", s), 129.2 (C -3 ', s), 129.1 (C-2', d), 123.2 (C-2 ", d), 121.5 (C-1, s), 120.9 (C-α, d), 120.1 (C-6 , d), 115.6 (C-5 ', d), 112.5 (C-5, d), 61.7 (OCH 3 ), 25.9 (C-1 ", t), 25.9 (C-5", q), 17.9 (C-4 ", q).

리코칼콘 A(Licochalcone A, 화합물 4): Yellow powder; UV λmax (MeOH): 378, 308nm; EI-MS m/z: 339 [M + 1]+, 323, 307, 216, 192, 121; 1H-NMR (CD3COCD3, 500 MHz) δ 8.03 (1H, d, J = 15.5Hz, H-β), 8.01 (2H, d, J = 8.5Hz, H-2', H-6'), 7.68 (1H, d, J = 15.5Hz, H-α), 7.63 (1H, s, H-6), 6.95 (2H, d, J = 8.5Hz, H-3', H-5'), 6.58 (1H, s, H-3), 6.30 (1H, dd, J = 17.5 and 11.0Hz, H-2"), 5.04 (1H, dd, J = 17.5 and 1.5Hz, H-3"), 4.98 (1H, dd, J = 11.0 and 1.5Hz, H-3"), 3.86 (3H, s, OCH3), 1.51 (6H, s, H-4", H-5"); 13C-NMR (CD3COCD3, 125 MHz) δ 188.5 (C=O), 162.2 (C-4', s), 160.0 (C-4, s), 159.8 (C-2, s), 148.7 (C-2", d), 140.1 (C-β, d), 131.8 (C-1', s), 131.6 (C-2', C-6', d), 129.3 (C-6, d), 127.6 (C-5', s), 119.6 (C-α, d), 116.4 (C-3', C-5', d), 115.9 (C-1, s)α, 110.1 (C-3", t), 101.1 (C-3, d), 56.0 (OCH3), 40.7 (C-1", s), 27.5 (C-4", C-5", q). Rico chalcone A (Licochalcone A, Compound 4): Yellow powder; UV λ max (MeOH): 378, 308 nm; EI-MS m / z : 339 [M + 1] + , 323, 307, 216, 192, 121; 1 H-NMR (CD 3 COCD 3 , 500 MHz) δ 8.03 (1H, d, J = 15.5 Hz, H-β), 8.01 (2H, d, J = 8.5 Hz, H-2 ', H-6' ), 7.68 (1H, d, J = 15.5 Hz, H-α), 7.63 (1H, s, H-6), 6.95 (2H, d, J = 8.5 Hz, H-3 ', H-5') , 6.58 (1H, s, H-3), 6.30 (1H, dd, J = 17.5 and 11.0 Hz, H-2 "), 5.04 (1H, dd, J = 17.5 and 1.5 Hz, H-3"), 4.98 (1H, doublet of doublets, J = 11.0 and 1.5Hz, H-3 "), 3.86 (3H, s, OCH 3 ), 1.51 (6H, s, H-4", H-5 "); 13 C-NMR (CD 3 COCD 3 , 125 MHz) δ 188.5 (C = O), 162.2 (C-4 ', s), 160.0 (C-4, s), 159.8 (C-2, s), 148.7 (C-2 ", d), 140.1 (C-β, d), 131.8 (C-1 ', s), 131.6 (C-2', C-6 ', d), 129.3 (C-6, d), 127.6 ( C-5 ', s), 119.6 (C-α, d), 116.4 (C-3', C-5 ', d), 115.9 (C-1, s) α, 110.1 (C-3 ", t ), 101.1 (C-3, d), 56.0 (OCH 3 ), 40.7 (C-1 ", s), 27.5 (C-4", C-5 ", q).

이소리크리티제닌(Isoliquiritigenin, 화합물 5): Yellow needle; ESI-MS m/z: 257[M+1]+, 255 [M 1]-; 1H-NMR (CD3COCD3, 500MHz) δ 13.60 (s, OH-2'), 8.12 (1H, d, J = 8.5Hz, H-6'), 7.84 (1H, d, J = 15.0Hz, H-β), 7.76 (1H, d, J = 15.0Hz, H-α), 7.73 (2H, d, J = 8.0Hz, H-2, H-6), 6.93 (2H, d, J = 8.0Hz, H-3, H-5), 6.47 (1H, d, J = 8.5Hz, H-5'), 6.38 (1H, brs, H-3'); 13C-NMR (CD3COCD3, 125MHz) δ 192.9 (C=O), 167.6 (C-4', s), 165.6 (C-2', s), 161.0 (C-4, s), 145.2 (C-β, d), 133.4 (C-6', s), 131.8 (C-2, C-6, d), 127.7 (C-1, s), 118.4 (C-α, d), 116.8 (C-3, C-5, d), 114.6 (C-1', s), 108.7 (C-5', d), 103 8 (C-3', d). Iso leakage utility angiogenin (Isoliquiritigenin, compound 5): Yellow needle; ESI-MS m / z : 257 [M + l] + , 255 [M 1] ; 1 H-NMR (CD 3 COCD 3 , 500 MHz) δ 13.60 (s, OH-2 '), 8.12 (1H, d, J = 8.5 Hz, H-6'), 7.84 (1H, d, J = 15.0 Hz , H-β), 7.76 (1H, d, J = 15.0 Hz, H-α), 7.73 (2H, d, J = 8.0 Hz, H-2, H-6), 6.93 (2H, d, J = 8.0 Hz, H-3, H-5), 6.47 (1H, d, J = 8.5 Hz, H-5 ′), 6.38 (1H, brs, H-3 ′); 13 C-NMR (CD 3 COCD 3 , 125 MHz) δ 192.9 (C = O), 167.6 (C-4 ', s), 165.6 (C-2', s), 161.0 (C-4, s), 145.2 (C-β, d), 133.4 (C-6 ', s), 131.8 (C-2, C-6, d), 127.7 (C-1, s), 118.4 (C-α, d), 116.8 (C-3, C-5, d), 114.6 (C-1 ', s), 108.7 (C-5', d), 103 8 (C-3 ', d).

리코아그로칼콘 A(Licoagrochalcone A, 화합물 6): Yellow powder; UV λmax (MeOH): 298, 382nm; EI-MS m/z: 324 [M]+ (73), 323 (31), 188 (32), 175 (100), 137 (87), 133 (51); 1H-NMR (CD3COCD3, 500 MHz) δ 8.10 (1H, d, J = 8.5Hz, H-6'), 7.79 (1H, d, J = 15.5Hz, H-β), 7.73 (1H, d, J = 15.5Hz, H-α), 7.62 (1H, brs, H-2), 7.58 (1H, d, J = 8.5Hz, H-6), 6.94 (1H, d, J = 8.5Hz, H-5), 6.48 (1H, d, J = 8.5Hz, H-5'), 6.37 (1H, brs, H-3'), 5.37 (1H, m, H-2"), 3.36 (2H, d, J = 7.2Hz, H-1"), 1.73 (6H, s, H-4", H-5"); 13C-NMR (CD3COCD3, 125 MHz) δ 192.8 (C=O), 167.3 (C-2', s), 165.6 (C-4', s), 158.7 (C-4, s), 145.6 (C-β, d), 133.3 (C-6', d), 132.9 (C-3", s), 131.9 (C-2, d), 129.7 (C-3, s), 129.3 (C-6, d), 127.7 (C-1, s), 123.4 (C-2", d), 118.1 (C-α, d), 116.3 (C-5, d), 114.5 (C-1', s), 108.7 (C-5', d), 103.8 (C-3', d), 29.1 (C-1", t), 25.9 (C-5", q), 17.9 (C-4", q). Rico Agrobacterium chalcone A (Licoagrochalcone A, Compound 6): Yellow powder; UV λ max (MeOH): 298, 382 nm; EI-MS m / z : 324 [M] + (73), 323 (31), 188 (32), 175 (100), 137 (87), 133 (51); 1 H-NMR (CD 3 COCD 3 , 500 MHz) δ 8.10 (1H, d, J = 8.5 Hz, H-6 ′), 7.79 (1H, d, J = 15.5 Hz, H-β), 7.73 (1H , d, J = 15.5 Hz, H-α, 7.62 (1H, brs, H-2), 7.58 (1H, d, J = 8.5 Hz, H-6), 6.94 (1H, d, J = 8.5 Hz , H-5), 6.48 (1H, d, J = 8.5 Hz, H-5 '), 6.37 (1H, brs, H-3'), 5.37 (1H, m, H-2 "), 3.36 (2H , d, J = 7.2 Hz, H-1 "), 1.73 (6H, s, H-4", H-5 "); 13 C-NMR (CD 3 COCD 3 , 125 MHz) δ 192.8 (C = O), 167.3 (C-2 ', s), 165.6 (C-4', s), 158.7 (C-4, s), 145.6 (C-β, d), 133.3 (C-6 ', d), 132.9 (C-3 ", s), 131.9 (C-2, d), 129.7 (C-3, s), 129.3 (C -6, d), 127.7 (C-1, s), 123.4 (C-2 ", d), 118.1 (C-α, d), 116.3 (C-5, d), 114.5 (C-1 ', s), 108.7 (C-5 ', d), 103.8 (C-3', d), 29.1 (C-1 ", t), 25.9 (C-5", q), 17.9 (C-4 ", q).

5- 프레닐부테인(5-Prenylbutein, 화합물 7): Amorphous powder; UV λmax (MeOH): 375nm; HRMS m/z 341.1318 [M + 1]+ (calcd for C20H21O5 341.1389); 1H-NMR (CD3COCD3, 500 MHz) δ13.99 (s, OH-2'), 7.98 (1H, d, J = 8.0Hz, H-6'), 7.77 (1H, d, J = 15.0Hz, H-β), 7.68 (1H, d, J = 15.0Hz, H-α), 7.35 (1H, d, J = 2.1Hz, H-2), 7.22 (1H, d, J = 2.1Hz, H-6), 6.91 (1H, d, J = 8.5Hz, H-5'), 6.53 (1H, brs, H-3'), 5.27 (1H, m, H-2"), 3.37 (2H, d, J = 7.0Hz, H-1"), 1.78 (3H, s, H-4"), 1.64 (3H, s, H-5"); 13C-NMR (CD3COCD3, 125 MHz) δ 193.1 (C=O), 164.8 (C-2', s), 162.6 (C-4', s), 149.1 (C-5, s), 146.4 (C-4, s), 145.4 (C-β, d), 131.6 (C-6', d), 130.4 (C-3", s), 128.4 (C-3, d), 123.5 (C-2, d), 123.4 (C-2", d), 121.0 (C-1, s), 118.7 (C-α, d), 116.4 (C-1', s), 116.1 (C-5', d), 116.0 (C-3', d), 114.5 (C-6, d), 25.9 (C-1", t), 22.3 (C-5", q), 18.6 (C-4", q). 5 frame nilbu heptane (5-Prenylbutein, Compound 7): Amorphous powder; UV λ max (MeOH): 375 nm; HRMS m / z 341.1318 [M + 1] + (calcd for C 20 H 21 O 5 341.1389); 1 H-NMR (CD 3 COCD 3 , 500 MHz) δ 13.99 (s, OH-2 ′), 7.98 (1H, d, J = 8.0 Hz, H-6 ′), 7.77 (1H, d, J = 15.0 Hz, H-β), 7.68 (1H, d, J = 15.0 Hz, H-α), 7.35 (1H, d, J = 2.1 Hz, H-2), 7.22 (1H, d, J = 2.1 Hz , H-6), 6.91 (1H, d, J = 8.5 Hz, H-5 '), 6.53 (1H, brs, H-3'), 5.27 (1H, m, H-2 "), 3.37 (2H , d, J = 7.0 Hz, H-1 "), 1.78 (3H, s, H-4"), 1.64 (3H, s, H-5 "); 13 C-NMR (CD 3 COCD 3 , 125 MHz) δ 193.1 (C = O), 164.8 (C-2 ', s), 162.6 (C-4', s), 149.1 (C-5, s), 146.4 (C-4, s), 145.4 (C-β, d), 131.6 (C-6 ', d), 130.4 (C-3 ", s), 128.4 (C-3, d), 123.5 (C -2, d), 123.4 (C-2 ", d), 121.0 (C-1, s), 118.7 (C-α, d), 116.4 (C-1 ', s), 116.1 (C-5' , d), 116.0 (C-3 ', d), 114.5 (C-6, d), 25.9 (C-1 ", t), 22.3 (C-5", q), 18.6 (C-4 ", q).

칸조놀 C(Kanzonol C, 화합물 8): Yellow oil; UV λmax (MeOH): 203, 340, 371, 375nm; EI-MS m/z: 393 [M + 1]+ (15), 392 [M]+ (49), 349 (50), 337 (16), 307 (20), 293 (12), 281 (6), 205 (25), 187 (25); 1H-NMR (CD3COCD3, 500 MHz) δ14.02 (s, OH-2'), 7.93 (1H, d, J = 8.5Hz, H-6'), 7.82 (1H, d, J = 15.5Hz, H-β), 7.72 (1H, d, J = 15.5Hz, H-α), 7.61 (1H, brs, H-2), 7.56 (1H, d, J = 8.0Hz, H-6), 6.94 (1H, d, J = 8.5Hz, H-5'), 6.53 (1H, d, J = 8.0Hz, H-5), 5.36 (1H, m, H-2"), 5.28 (1H, m, H-2'''), 3.36 (4H, d, J = 7.5Hz, H-1", H-1'''), 1.78 (3H, s, H-4"), 1.74 (3H, s, H-4'''), 1.72 (3H, s, H-5'''), 1.64 (3H, s, H-5"); 13C-NMR (CD3COCD3, 125 MHz) δ 193.1 (C=O), 164.8 (C-2', s), 162.6 (C-4', s), 158.6 (C-4, s), 145.4 (C-β, d), 132.9 (C-6', d), 131.8 (C-3", C- 3'''s), 130.3 (C-2, d), 129.7 (C-3, s), 129.5 (C-3', s), 129.2 (C-6, d), 127.8 (C-1, s), 123.4 (C-2", d), 123.3 (C-2''', d), 118.3 (C-α d), 116.3 (C-5, d), 114.5 (C-1', s), 108.0 (C-5', d), 25.9 (C-1", C-1''' t), 22.4 (C-5", C-5''' q), 17.9 (C-4''' q), 17.8 (C-4", q). Canzonol C (Compound 8 ): Yellow oil; UV λ max (MeOH): 203, 340, 371, 375 nm; EI-MS m / z: 393 [M + 1] + (15), 392 [M] + (49), 349 (50), 337 (16), 307 (20), 293 (12), 281 (6 ), 205 (25), 187 (25); 1 H-NMR (CD 3 COCD 3 , 500 MHz) δ 14.02 (s, OH-2 ′), 7.93 (1H, d, J = 8.5 Hz, H-6 ′), 7.82 (1H, d, J = 15.5 Hz, H-β), 7.72 (1H, d, J = 15.5 Hz, H-α), 7.61 (1H, brs, H-2), 7.56 (1H, d, J = 8.0 Hz, H-6) , 6.94 (1H, d, J = 8.5 Hz, H-5 '), 6.53 (1H, d, J = 8.0 Hz, H-5), 5.36 (1H, m, H-2 "), 5.28 (1H, m, H-2 '''), 3.36 (4H, d, J = 7.5 Hz, H-1 ", H-1'''), 1.78 (3H, s, H-4"), 1.74 (3H, s, H-4 '''), 1.72 (3H, s, H-5'''), 1.64 (3H, s, H-5 "); 13 C-NMR (CD 3 COCD 3 , 125 MHz) δ 193.1 (C = O), 164.8 (C-2 ', s), 162.6 (C-4', s), 158.6 (C-4, s), 145.4 (C-β, d), 132.9 (C-6 ', d), 131.8 (C-3 ", C-3''' s), 130.3 (C-2, d), 129.7 (C-3, s), 129.5 (C-3 ', s), 129.2 (C-6, d), 127.8 (C-1, s), 123.4 (C-2 ", d), 123.3 (C-2''', d), 118.3 (C-α d), 116.3 (C-5, d), 114.5 (C-1 ', s), 108.0 (C-5', d), 25.9 (C-1 ", C-1 '''t), 22.4 (C-5 ", C-5''' q), 17.9 (C-4 '''q), 17.8 (C-4", q).

<< 실시예Example 4 : 인플루엔자 바이러스의 준비>  4: Preparation of influenza virus

4-1. 조류 인플루엔자(H9N2) 바이러스4-1. Avian Influenza (H9N2) Virus

실험에 사용한 조류 인플루엔자 바이러스는 저병원성 조류 인플루엔자 바이러스인 A/chicken/Korea/01310/2001(H9N2)를 사용하였다. 이것을 10일령의 SPF(Specific-Pathogen Free) 수정란의 요막강(Allantoic Cavity)에 접종하고 2일 후 채독하여 바이러스를 신장 세포에 속하는 MDCK(Madin-Darby canine kidney)에 접종하여 5일간 배양하여 원심분리 후 상등액층의 배양액을 H9N2 기원의 바이러스 뉴라미니데이즈의 활성 측정에 사용하였다. The avian influenza virus used in the experiment was a low-pathogenic avian influenza virus A / chicken / Korea / 01310/2001 (H9N2). This was inoculated into the 10-day-old SPF (Specific-Pathogen Free) fertilized egg Allantoic Cavity, and 2 days later, the virus was inoculated into MDCK (Madin-Darby canine kidney) belonging to kidney cells and incubated for 5 days, followed by centrifugation. The culture of the supernatant layer was then used to measure the activity of viral neuraminidase of H9N2 origin.

4-2. 돼지인플루엔자(H1N1) 바이러스 4-2. Swine Flu Virus (H1N1) Virus

실험에 사용한 돼지 인플루엔자 바이러스는 중앙백신연구소의 돼지 인플루엔자 바이러스인 A/Sw/Kor/CAN1/04(H1N1, KCTC 11165BP)를 사용하였다. 이 바이러스를 10일령의 Specific-Pathogen Free(SPF) Egg 요막강(Allantoic Cavity)에 접종하고 2일 후 채독하여 씨드 바이러스(seed virus)를 증식시켰다. 이후 배양된 씨드 바이러스를 SPF 달걀의 요막강에 재접종하여 바이러스 배양액을 얻은 후 H1N1 기원의 바이러스 뉴라미니데이즈의 활성 측정에 사용하였다. The swine influenza virus used in the experiment was A / Sw / Kor / CAN1 / 04 (H1N1, KCTC 11165BP), a swine influenza virus from the Central Vaccine Institute. The virus was inoculated into 10-day-old Specific-Pathogen Free (SPF) Egg Allantoic Cavity and harvested 2 days later to propagate the seed virus. The cultured seed virus was then reinoculated into the lumen cavity of SPF eggs to obtain a virus culture, and then used to measure the activity of viral neuraminidase of H1N1 origin.

<< 실시예Example 5 :  5: 뉴라미니데이즈Neuraminidays 클로닝Cloning >>

신종플루 바이러스는 전염성이 강하고 감염될 경우에는 질환으로 사망할 가능성이 높기 때문에 일차적으로 신종플루 바이러스 자체를 이용하여 효과가 있는 활성물질을 검색하고 확인하기보다는 신약의 표적이 되는 신종플루 바이러스의 뉴라미니데이즈만을 동물 세포주에서 발현시켜서 신약 후보 물질의 활성을 검증하는 방법을 사용하였다. 신종플루 바이러스의 뉴라미니데이즈 유전자서열을 NCBI의 유전자은행으로부터 확인하여 신종플루 바이러스의 뉴라미니데이즈를 클로닝(cloning)하였으며, 타미플루에 내성을 가지는 신종플루 바이러스의 뉴라미니데이즈 점 돌연변이체를 인위적으로 제작하여 천연물의 활성 탐색에 사용하였다. 이하 클로닝에 사용된 각 염기서열은 다음과 같다. The H1N1 virus is highly contagious and is highly likely to die of disease if infected. Therefore, the H1N1 virus is primarily used as a target for new drugs rather than identifying and identifying active substances that are effective. Only Days was expressed in animal cell lines to validate the activity of drug candidates. The neuraminidase gene sequence of the H1N1 virus was confirmed from the NCBI gene bank, and cloned the neuraminidity of the H1N1 virus, and artificially produced a neuraminidism point mutant of the H1N1 virus was resistant to Tamiflu. Was used to explore the activity of natural products. Hereinafter, each base sequence used for cloning is as follows.

* 사용된 신종플루 뉴라미니데이즈 펩타이드 서열 *Swine Flu Neuraminidase Peptide Sequences Used

5-1. 신종플루(H1N1) 바이러스의 뉴라미니데이즈 펩타이드 서열5-1. Neuraminidase Peptide Sequences of Swine Flu (H1N1) Virus

MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSNRPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDKMNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSNRPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK

5-2. 타미플루에 내성을 가지는 신종플루 바이러스의 뉴라미니데이즈 펩타이드5-2. Neuraminidase Peptide of Swine Flu Virus Resistant to Tamiflu

밑줄 처진 부분이 점돌연변이에 의해서 바뀌는 부분임 (H → Y)Underlined part is changed by point mutation (H → Y)

MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNY Y YEECSCYPDSSEITCVCRDNWHGSNRPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNY Y YEECSCYPDSSEITCVCRDNWHGSNRPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK

상기의 서열로 각각의 유전자를 클로닝 한 후 신종플루 바이러스의 뉴라미니데이즈에 해당하는 유전자를 PCR 증폭 방법을 이용하였고, 증폭된 산물은 인비트로젠(Invitrogen)사의 pcDNA3.1/V5-His Topo 벡터에 클로닝하였다. 클로닝의 확인은 제한효소 절단(restriction enzyme cutting)을 통해서 일차적으로 확인하고, 염기서열 분석법(DNA sequencing)을 통해서 최종 확인하였다. 또한, 타미플루에 내성을 가지는 뉴라미니데이즈를 문헌조사를 통해 중간의 히스티딘(Histidine) 아미노산을 티로신(Tyrosine)으로 치환함으로써 획득하였다. 사용한 방법은 PCR을 이용하는 퀵체인지(Quick change)방법을 이용하였다. 이 방법은 치환하려고 하는 부분에 해당하는 올리고뉴클레오티드(oligonucleotide)를 제작한 후, PCR 효소를 사용하여 플라스미드를 시험관 내에서 증폭시켰으며, 기존의 염기서열을 가진 플라스미드를 제거하기 위해서 메틸레이션(methylation)되어 있는 플라스미드만 절단하는 DpnI 효소를 처리하였다. 돌연변이가 일어난 플라스미드는 박테리아에서 증폭하였으며, 염기서열 분석법(DNA sequencing)을 통해서 아미노산 치환을 최종 확인하여 실험에 사용하였다.After cloning each gene with the above sequence, a PCR amplification method was performed on the gene corresponding to the neuraminidase of the H1N1 virus, and the amplified product was pcDNA3.1 / V5-His Topo vector of Invitrogen. Cloned into. Cloning was confirmed primarily through restriction enzyme cutting and finally confirmed by DNA sequencing. In addition, Neuraminidase resistant to Tamiflu was obtained by substituting the histidine amino acid with Tyrosine in the literature. The method used was a quick change method using PCR. This method produced an oligonucleotide corresponding to the portion to be replaced, and then amplified the plasmid in vitro using a PCR enzyme. DpnI enzyme that cleaves only the plasmids was treated. The mutated plasmid was amplified in bacteria and used for the experiment by finally confirming amino acid substitution through DNA sequencing.

<< 실시예Example 6 :  6: 뉴라미니데이즈의Of neuraminidays 활성 측정> Active measurement>

뉴라미니데이즈 활성은 정확한 저해율을 측정하기 위하여 메이어(Myers) 등이 고안한 방법을 변경하여 사용하였다. 각각의 뉴라미니데이즈가 포함된 샘플에 0.04 M sodium acetate 완충액(pH 5.0) 20㎕와 0.04mM 4-methylumbelliferyl-α-D-N-acetylneuraminic acid(Sigma M8639) 80㎕를 혼합하여 10분간 반응시킨 후 0.1 M glycine-NaOH 완충액 100㎕을 첨가하여 반응을 중지시킨 후 형광광도계를 이용하여 360nm/440nm에서의 형광차이를 이용하여 활성을 측정하였다. 이 때 타미플루, 화합물이나 각각의 용매 및 분획 추출물은 세포에 미리 처리하거나 바이러스를 배양할 때 같이 투여되어 활성억제가 되도록 하였다(화합물을 샘플에 직접 처리하려면 상기 형광 반응에 1㎕의 화합물을 넣으면 된다). 또한, 시료의 발광도를 보정하기 위하여 측정 발광도를 A, 시료를 녹인 용매의 발광도를 C, 시료 혼합액의 발광도를 B로 하여 저해율을 계산하였다.The neuraminidase activity was used by modifying the method devised by Myers et al. In order to measure the exact inhibition rate. Each 20 μl of 0.04 M sodium acetate buffer (pH 5.0) and 80 μl of 0.04 mM 4-methylumbelliferyl-α-DN-acetylneuraminic acid (Sigma M8639) were mixed with each neuraminidase sample for 10 minutes, followed by 0.1 M After the reaction was stopped by adding 100 μl of glycine-NaOH buffer, activity was measured using a fluorescence difference at 360 nm / 440 nm using a fluorescence spectrometer. At this time, Tamiflu, the compound, or each solvent and fraction extract were pretreated in the cell or administered together when culturing the virus to be activated (in order to process the compound directly on the sample, 1 μl of the compound was added to the fluorescence reaction). ). In addition, in order to correct the luminescence of the sample, the inhibition rate was calculated using A as the measured luminescence, C as the luminescence of the solvent in which the sample was dissolved, and B as the luminescence of the sample mixture.

저해율 : {C-(A-B)/C}×100Inhibition Rate: {C- (A-B) / C} × 100

화합물의 Kinetic 연구를 위하여 4-methoxyumbelliferone의 농도를 반응을 중지시키기 위하여 넣는 0.1M glycine-NaOH buffer를 첨가하기 전에 측정되었으며, Sigmaplot 11.0(SPCC Inc., Chicago, IL)에서 계산하였다. 또한 효소의 가역반응을 측정하기 위하여, 효소와 저해물질이 들어간 반응액을 희석하는 방법을 사용하여 측정하였다. For kinetic studies of the compounds, the concentration of 4-methoxyumbelliferone was measured before adding 0.1M glycine-NaOH buffer to stop the reaction and calculated in Sigmaplot 11.0 (SPCC Inc., Chicago, IL). In addition, in order to measure the reversible reaction of the enzyme, it was measured using a method of diluting the reaction solution containing the enzyme and the inhibitor.

<< 실시예Example 7 : 바이러스 배양액을 이용한  7: virus culture 뉴라미니데이즈의Of neuraminidays 활성 측정> Active measurement>

바이러스 기원의 뉴라미니데이즈 활성을 측정하기 위하여 조류 인플루엔자 바이러스(H9N2)와 돼지 인플루엔자 바이러스(H1N1)에서 유래한 바이러스 배양액으로부터 뉴라미니데이즈 활성을 측정하는 방법을 사용하였다. To measure neuraminidase activity of viral origin, a method of measuring neuraminidase activity from virus cultures derived from avian influenza virus (H9N2) and swine influenza virus (H1N1) was used.

바이러스 배양액을 이용한 뉴라미니데이즈의 활성은 실시예 4-1 및 실시예 4-2의 바이러스 배양액을 이용하여 실시예 6의 방법으로 측정하였고 에탄올 추출물의 각 분획 및 화합물 1 내지 화합물 8을 사용하여 뉴라미니데이즈의 활성을 측정한 결과 표 2와 표 3에 나타내었다. 표 2에서 보여준 바와 같이 에탄올 추출물 및 용매 분획물의 뉴라미니데이즈에 대한 활성정도를 비교하기 위하여 각각의 추출물을 최종농도 20㎍/㎖의 농도로 바이러스 배양액으로부터 얻은 뉴라미니데이즈에 대한 각각 추출물의 활성정도를 측정하였다. 표 2에서 보여준 결과에서 볼 수 있는 바와 같이, 추출물은 70% 에탄올 추출물과 에틸아세테이트 분획에서 활성이 우수함을 확인하였다. The activity of neuraminidase using a virus culture was measured by the method of Example 6 using the virus cultures of Examples 4-1 and 4-2, and each fraction of the ethanol extract and neurai using Compound 1 to Compound 8 were used. As a result of measuring the activity of mini-day is shown in Table 2 and Table 3. As shown in Table 2, in order to compare the activity of ethanol extracts and solvent fractions against neuraminidase, the extract activity of each extract against neuraminidase obtained from virus culture at the final concentration of 20 µg / ml. Was measured. As can be seen from the results shown in Table 2, the extract was confirmed to have excellent activity in the 70% ethanol extract and ethyl acetate fraction.

조건 Condition 조류 인플루엔자 바이러스 (H9N2)의 뉴라미니데이즈에 대한 저해활성(20μg/㎖) Inhibitory Activity of Avian Influenza Virus (H9N2) on Neuraminidase (20 μg / mL) 돼지 인플루엔자 바이러스 (H1N1)의 뉴라미니데이즈에 대한 저해활성(20μg/㎖)Inhibitory Activity of Porcine Influenza Virus (H1N1) on Neuraminidase (20 μg / mL) A 분획 (70% 에탄올 추출물) A fraction (70% ethanol extract) 36.2 % 36.2% 37.6 % 37.6% B 분획 (헥산 추출물) B fraction (hexane extract) -  - - - C 분획 (에틸아세테이트 추출물) C fraction (ethyl acetate extract) 28.5 % 28.5% 32.7 % 32.7% D 분획 (부탄올 추출물) D fraction (butanol extract) - - - -

표 3에서 볼 수 있는 바와 같이 타미플루는 조류 인플루엔자 바이러스 기원의 뉴라미니데이즈에 대한 저해활성(12.05±1.00nM)이 돼지 인플루엔자 바이러스 기원의 뉴라미니데이즈에 대한 저해활성(96.89±7.41nM) 보다 좋음을 확인할 수 있었다. 이러한 결과는 타미플루가 조류 인플루엔자에 선택적으로 작용하며 돼지 인플루엔자나 신종플루에 대한 활성이 적을 수 있음을 예시한다. 그러나, 본 특허의 화합물 1 내지 화합물 8은 표 3에서 보여주는 바와 같이 조류 인플루엔자 및 돼지 인플루엔자 바이러스 기원의 뉴라미니데이즈에게 둘 다 비슷한 농도에서 저해함을 확인하였다. As shown in Table 3, Tamiflu showed that the inhibitory activity (12.05 ± 1.00 nM) against neuraminidase of avian influenza virus origin was better than the inhibitory activity against neuraminidase of swine influenza virus origin (96.89 ± 7.41 nM). I could confirm it. These results illustrate that Tamiflu acts selectively on avian influenza and may be less active against swine flu or swine flu. However, compounds 1 to 8 of the present patents were found to inhibit both neuraminidase of avian influenza and swine influenza virus origin at similar concentrations as shown in Table 3.

타미플루는 조류 인플루엔자의 뉴라미니데이즈 단백질 구조를 확인한 후 활성잔기에 선택적으로 결합하는 화합물을 합성하여 만든 것이다. 즉, 타미플루는 뉴라미니데이즈의 경쟁적 저해제(competitive inhibitor)로 활성잔기에 작용한다. 그러나, 최근 타미플루에 대한 내성 바이러스는 타미플루가 작용하는 활성잔기를 변형시키는 방법을 사용하여 내성작용을 획득하였다. 발명자들은 칼콘 계열의 화합물의 저해양식을 결정하기 위하여 활성화합물 중 하나인 리코칼콘 A(화합물 4)의 농도를 변화시키는 방법을 사용하여 저해형식을 검토하였다. 감초의 주 화합물 중 하나인 리코칼킨 A(화합물 4)는 비경쟁적 저해제로 돼지 인플루엔자 바이러스 기원의 뉴라미니데이즈를 가역적으로 저해한다. 이러한 결과는 칼콘 계열의 화합물이 비경쟁적으로 뉴라미니데이즈에 작용하므로 내성 바이러스의 등장에도 불구하고 단독, 혹은 타미플루와 병용하여 광범위하게 사용할 수 있음을 확인시켜 준다. Tamiflu is made by synthesizing compounds that selectively bind to active residues after confirming the neuraminidase protein structure of avian influenza. Tamiflu acts as an active residue as a competitive inhibitor of neuraminidase. However, recently, viruses resistant to Tamiflu have obtained resistance by using a method of modifying the active residue on which Tamiflu acts. The inventors used one of the active compounds to determine the inhibition pattern of the chalcone family of compounds. Inhibitory form was examined using a method of varying the concentration of Lycochalcone A (Compound 4 ). Lycokalkin A (Compound 4), one of the main compounds of licorice, reversibly inhibits neuraminidase of swine influenza virus origin as a noncompetitive inhibitor. These results confirm that the chalcone-based compound acts non-competitively on neuraminidase and thus can be widely used alone or in combination with Tamiflu despite the emergence of resistant viruses.

조건 Condition 조류 인플루엔자 바이러스 (H9N2)의 뉴라미니데이즈에 대한 IC50 측정값 IC 50 Measurements for Neuraminidase of Avian Influenza Virus (H9N2) 돼지 인플루엔자 바이러스 (H1N1)의 뉴라미니데이즈에 대한 IC50 측정값IC 50 Measurements for Neuraminidase of Swine Influenza Virus (H1N1) 화합물 1 (μg/㎖)Compound 1 (μg / ml) 52.16±11.12 52.16 ± 11.12 37.68±3.18 37.68 ± 3.18 화합물 2 (μg/㎖)Compound 2 (μg / ml) 5.70±0.55  5.70 ± 0.55 5.81±0.41  5.81 ± 0.41 화합물 3 (μg/㎖)Compound 3 (μg / ml) 35.22±8.21 35.22 ± 8.21 28.62±5.68 28.62 ± 5.68 화합물 4 (μg/㎖)Compound 4 (μg / ml) 17.99±0.98  17.99 ± 0.98 19.10±2.10  19.10 ± 2.10 화합물 5 (μg/㎖)Compound 5 (μg / ml) 9.70±0.38 9.70 ± 0.38 8.41±0.39 8.41 ± 0.39 화합물 6 (μg/㎖)Compound 6 (μg / ml) 56.92±3.12 56.92 ± 3.12 51.59±2.77 51.59 ± 2.77 화합물 7 (μg/㎖)Compound 7 (μg / ml) 35.50±1.43  35.50 ± 1.43 25.87±2.04  25.87 ± 2.04 화합물 8 (μg/㎖)Compound 8 (μg / ml) 39.96±0.59 39.96 ± 0.59 75.38±14.47 75.38 ± 14.47 타미플루 (nM) Tamiflu (nM) 12.05±1.00 12.05 ± 1.00 96.89±7.41 96.89 ± 7.41

<< 실시예Example 8 :  8 : 뉴라미니데이즈를Neuraminidays 직접 발현하는 세포의 파쇄액에서  In the lysate of cells that express directly 뉴라미니데이즈의Of neuraminidays 활성 측정> Active measurement>

신종플루 바이러스 및 타미플루 내성 신종플루 바이러스의 뉴라미니데이즈를 직접 발현하는 세포파괴액에서 뉴라미니데이즈의 활성을 측정하기 위해 인간 신장세포인 HEK293T 세포에 0.25%의 트립신(trypsin)을 처리하여 모은 후, 상층액을 제거한 뒤 우혈청이 제거된 DMEM 배지로 현탁하였다. 그리고 우혈청이 포함되지 않는 DMEM 100㎕에 3㎕의 리포펙타민(Lipofectamin, Invitrogen, Inc)을 세포 현탁액에 점적한 후 천천히 섞어 15분간 실온에 방치하였다. 이후, 신종플루 바이러스의 뉴라미니데이즈(실시예 5-1), 타미플루 내성 신종플루 바이러스의 뉴라미니데이즈(실시예 5-2)를 발현하는 플라스미드를 트랜스펙션(transfection, DNA를 동물 세포에 유입하는 방법)하기 위하여 미세 원침 튜브에 30초에 걸쳐 1㎍씩의 각각의 플라스미드를 천천히 점적하면서 혼합하여 실온에서 다시 15분간 방치하였다. 리포펙타민과 DNA-플라스미드의 혼합액과 HEK293T 세포주를 천천히 섞어 현탁액 상태로 20분간 실온에서 배양한 후 35 mm 배양용기에 분주하고 CO2 배양기에서 24시간 동안 배양하였다. HEK293T 세포를 PBS로 2회 세척하고 각각의 배양용기에 500㎕의 추출용액을 가하여 세포를 파괴한 뒤 14,000rpm에서 5분간 원심분리 하였고, 얻어진 상층액을 실시예 6의 방법을 이용하여 뉴라미니데이즈 활성 실험에 사용하였다.In order to measure the activity of neuraminidase in cell disruption cells expressing the neuraminidase of the H1N1 virus and the Tamiflu-resistant H1N1 virus, human kidney kidney HEK293T cells were treated with 0.25% trypsin and collected. The supernatant was removed and then suspended in DMEM medium free of bovine serum. 3 μl of lipofectamine (Lipofectamin, Invitrogen, Inc) was added to 100 μl of DMEM without bovine serum, and the mixture was slowly mixed and allowed to stand at room temperature for 15 minutes. Subsequently, transfection of the plasmids expressing the neuraminidase of the swine flu virus (Example 5-1) and the neuraminidase of the Tamiflu-resistant swine flu virus (Example 5-2) was performed by transfection (DNA) into animal cells. Method), each plasmid of 1 µg was slowly added dropwise to the microneedle tube over 30 seconds, and left for 15 minutes at room temperature. The mixture of lipofectamine and DNA-plasmid and HEK293T cell line were slowly mixed and incubated at room temperature in suspension for 20 minutes, then aliquoted in a 35 mm culture vessel and incubated in a CO 2 incubator for 24 hours. HEK293T cells were washed twice with PBS, 500 μl of extract solution was added to each culture vessel, and the cells were disrupted and centrifuged at 14,000 rpm for 5 minutes. The obtained supernatant was purified by using the method of Example 6 Used for activity experiment.

표 4는 감초 추출물로부터 분리한 칼콘계 화합물 1 내지 화합물 8 중 바이러스 기원의 뉴라미니데이즈에 대한 활성이 강하며 주성분인 화합물 2(에치나틴), 화합물 4(리코칼콘 A) 및 화합물 5(이소리크리티제닌)를 대상으로 신종플루 바이러스의 뉴라미니데이즈와 타미플루 내성 신종플루 바이러스의 뉴라미니데이즈에 대하여 활성을 측정한 결과이다. 측정 결과 칼콘계 화합물 화합물 2(에치나틴), 화합물 4(리코칼콘 A) 및 화합물 5(이소리크리티제닌)는 신종플루 바이러스의 뉴라미니데이즈와 타미플루 내성 신종플루 바이러스의 뉴라미니데이즈에 대하여 비슷한 농도인 2.49±0.14~5.42±0.28㎍/㎖ 농도에서 활성이 50% 정도로 저해되었다. 그러나, 타미플루는 신종플루 바이러스의 뉴라미니데이즈에 대하여 75nM 정도에서 IC50 값을 보여 주었으나, 인위적으로 발생시킨 타미플루 내성 신종플루 바이러스의 뉴라미니데이즈에 대하여 20μM 에서 IC50 값을 보일 정도로 활성이 적었다. 이는 타미플루 내성 신종플루 바이러스의 뉴라미니데이즈의 발생시 위험도를 보여주는 것으로, 감초로부터의 칼콘계 화합물 2(에치나틴), 화합물 4(리코칼콘 A) 및 화합물 5(이소리크리티제닌)는 신종플루 바이러스의 뉴라미니데이즈와 타미플루 내성 신종플루 바이러스의 뉴라미니데이즈에 대한 사용 가능성을 나타낸다. Table 4 shows compounds 2 (Echinatin), which are active and active against neuraminidase of viral origin, among the chalcone compounds 1 to 8 isolated from licorice extract, It is the result of having measured the activity with respect to the neuraminidase of the swine flu virus and the neuraminidase of the Tamiflu-resistant swine flu virus about the compound 4 (Ricochalcon A) and the compound 5 (Isocristygenin). Measurement result chalcone-based compound 2 (Echinatin), Compound 4 (Ricocalcon A) and Compound 5 (Isoricrigeninine) were similar concentrations of 2.49 ± 0.14 to 5.42 ± 0.28 μg / ml for the neuraminidase of the H1N1 virus and neuraminidase of the Tamiflu-resistant H1N1 virus. Activity was inhibited by 50%. However, Tamiflu showed an IC 50 value at about 75 nM against neuraminidase of swine flu virus, but Tamiflu was less active to show IC 50 value at 20 μM against artificially generated neuraminidase of Tamiflu resistant flu. . This shows the risk in the development of neuraminidase of the Tamiflu-resistant H1N1 virus, including chalcone compound 2 (echinatin) from licorice, Compound 4 (Ricochalcon A) and Compound 5 (Isocristygenin) show the potential for use against neuraminidase of the H1N1 virus and neuraminidase of the Tamiflu-resistant H1N1 virus.

조건 Condition 신종플루(novel influenza) 바이러스의 뉴라미니데이즈에 대한 IC50 IC 50 for neuraminidase of novel influenza virus 타미플루 내성 바이러스의 신종플루 뉴라미니데이즈에 대한 IC50 IC 50 for swine flu neuraminidase of Tamiflu resistant virus 화합물 2 (㎍/㎖) Compound 2 (μg / ml) 3.48±0.05  3.48 ± 0.05 3.42±0.56  3.42 ± 0.56 화합물 4 (㎍/㎖) Compound 4 (ug / ml) 2.49±0.14 2.49 ± 0.14 2.19±0.06 2.19 ± 0.06 화합물 5 (㎍/㎖) Compound 5 (ug / ml) 5.42±0.28 5.42 ± 0.28 4.20±0.12 4.20 ± 0.12 타미플루 Tamiflu 75nM 75nM > 20μM  > 20 μM

<< 실시예Example 9 : 바이러스 배양액을 이용한  9: virus culture 타미플루와Tamifluwa 에치난틴의Echinanthin 병용 사용으로  In combination use 뉴라미니데이즈의Of neuraminidays 활성 측정>  Active measurement>

실시예 7에서 확인한 돼지 인플루엔자 바이러스의 뉴라미니데이즈에 대한 타미플루의 50% 저해율은 96.89±7.41nM이었고, 조류 인플루엔자 바이러스의 뉴라미니데이즈에 대한 타미플루의 50% 저해율은 12.05±1.00nM로 타미플루는 경쟁적 저해제로 확인되었다. 실시예 7에서 확인된 결과로 본 발명의 화합물 중 하나인 에치나틴(화합물 2)은 비경쟁적 저해제(noncompetitive inhibitor, 도 2 참조)로 돼지 인플루엔자에 대하여 50% 저해율을 보이는 농도가 19.09±2.10㎍/㎖이었다. 경쟁적 저해제는 뉴라미니데이즈 효소가 화합물과 결합하는 효소 작용점(active pocket)에서 작용하므로 비경쟁적 저해제로서 뉴라미니데이즈 효소의 다른 부위에서 작용하는 에치나틴(화합물 2)을 첨가한다면 타미플루의 활성을 증가시킬 수 있다는 가정하에 에치나틴(화합물 2)을 이용하여 타미플루의 저해율을 계산하였다. The 50% inhibition rate of Tamiflu against neuraminidase of the swine influenza virus identified in Example 7 was 96.89 ± 7.41nM, and the 50% inhibition rate of Tamiflu against neuraminidase of the avian influenza virus was 12.05 ± 1.00nM and Tamiflu was a competitive inhibitor It was confirmed. As a result confirmed in Example 7 Echinatin (Compound 2 ) is one of the compounds of the present invention is a non-competitive inhibitor (noncompetitive inhibitor, see Figure 2) shows a concentration of 50% inhibition against swine influenza 19.09 ± 2.10㎛ / Ml. Competitive inhibitors act at the active pocket where the neuraminidase enzyme binds to the compound, so adding non-competitive inhibitors of echinatin (compound 2 ) acting at other sites of the neuraminidase enzyme increases Tamiflu activity. The inhibition rate of Tamiflu was calculated using echinatin (Compound 2 ) under the assumption that it could be.

이를 위해 감초로부터 나온 에치나틴(화합물 2)의 농도를 5μM로 고정한 후 실시예 4-1 및 실시예 4-2의 바이러스 배양액을 이용하여 돼지 인플루엔자 바이러스와 조류 인플루엔자 바이러스 기원의 뉴라미니데이즈에 대한 타미플루의 50% 저해율을 실시예 6의 방법으로 측정한 결과, 돼지 인플루엔자 바이러스에 대한 타미플루의 50% 저해율은 4.91±1.81nM로 측정되어 타미플루과 에치나틴(화합물 2)을 병용시 타미플루의 활성을 약 20배 정도 증가시킬 수 있었으며, 조류 인플루엔자 바이러스의 경우 약 10배 정도 활성을 증가시킬 수 있었다. 현재 신종플루나 조류 인플루엔자의 대유행에 대하여 권장되고 있는 치료방법으로 타미플루 단독, 타미플루와 아만타딘(주로 rimantidine, 리만티딘), 잔나비르 등의 처방이 권장되고 있는 실정이나 아만타딘 계열은 높은 독성을 갖고 있다. 따라서 칼콘 계열의 화합물과 타미플루의 병용 치료법은 내성 바이러스 치료에 효과적인 전략이다. 표 5는 에치나틴(화합물 2) 5μM과 병행한 타미플루 농도(nM)에 따른 조류 인플루엔자, 돼지 인플루엔자 바이러스의 뉴라미니데이즈 활성 저해율을 나타낸 것이다. To this end, the concentration of echinatin (compound 2 ) from licorice was fixed at 5 μM, and then the virus cultures of Examples 4-1 and 4-2 were used for the neuraminidase of swine influenza virus and avian influenza virus origin. As a result of measuring the 50% inhibition rate of Tamiflu by the method of Example 6, the 50% inhibition rate of Tamiflu against swine influenza virus was measured to be 4.91 ± 1.81nM, and the activity of Tamiflu when Tamiflu and Echinatin (Compound 2 ) were used in combination was weak. It could be increased 20-fold, and about 10-fold increased activity for avian influenza virus. Currently recommended treatment for the pandemic of swine flu or avian influenza, Tamiflu alone, Tamiflu and amantadine (primarily rimantidine, rimantidine), Jannavir, etc., and the Amantadine series are highly toxic. Therefore, the combination therapy of chalcone-based compounds and Tamiflu is an effective strategy for the treatment of resistant virus. Table 5 shows the inhibition rate of neuraminidase activity of avian influenza and swine influenza viruses according to Tamiflu concentration (nM) in parallel with 5 μM of echinatin (Compound 2 ).

뉴라미니데이즈 종류 Neuraminidays Types 에치나틴 5μM과 병행한 타미플루 농도 Tamiflu concentration in parallel with 5 μM echinatin 0.12nM 0.12 nM 0.48nM 0.48 nM 1.9nM 1.9 nM 7.8nM 7.8 nM 31.3nM  31.3 nM 125nM 125 nM 조류 인플루엔자 바이러스 (H9N2)의 뉴라미니데이즈 활성 저해율(%)  Inhibition of Neuraminidase Activity of Avian Influenza Virus (H9N2) (%) 30.1 30.1 46.1% 46.1% 54.5% 54.5% 65.7% 65.7% 78.7% 78.7% 96.9% 96.9% 돼지 인플루엔자 바이러스 (H1N1)의 뉴라미니데이즈 활성 저해율(%)  Inhibition of Neuraminidase Activity of Porcine Influenza Virus (H1N1) (%) 23.6% 23.6% 30.5% 30.5% 45.8% 45.8% 58.7% 58.7% 65.7% 65.7% 79.5% 79.5%

<< 실시예Example 10 : 조류 및 돼지 인플루엔자 바이러스에 대한 적혈구응집시험> 10: hemagglutination test for avian and swine influenza viruses>

분리된 화합물들의 항바이러스 활성을 측정하기 위하여 조류 인플루엔자 바이러스(H9N2)와 돼지 인플루엔자 바이러스(H1N1)를 이용하여 측정하였다. 신장 세포에 속하는 MDCK(Madin-Darby canine kidney) 세포를 계대 배양하여 300,000세포/㎖로 부유한 후, 96-웰 플레이트에 웰당 100㎕/well씩 분주한 뒤 37℃ CO2 배양기에서 1일간 배양한 후 104 TCID50/㎖로 희석된 조류 및 돼지 인플루엔자 바이러스를 감염시키고 37℃ CO2 배양기에서 1시간 동안 반응시킨다. 이후, 감염된 세포를 PBS로 3회 세척한 뒤 화합물을 최종농도 10㎍/㎖이 되도록 희석하여 3개 웰에 각각 분주하고 37℃ CO2 배양기에서 5일간 배양하였다. 양성대조군으로서 타미플루를 동일한 농도로 첨가하고, 음성대조군은 조류 및 돼지 인플루엔자 바이러스만 감염시켜 비교 평가하였다. 바이러스가 숙주세포에 유착하면 특정 적혈구의 응집을 일으키므로 세포 배양액 중에 존재하는 바이러스를 간접적으로 정량하는 방법 중의 하나인 적혈구응집시험(HA; Hemagglutination assay)을 실시하여 활성을 평가하여 표 6에 나타내었다. In order to measure the antiviral activity of the isolated compounds was measured using avian influenza virus (H9N2) and porcine influenza virus (H1N1). Subdivided MDCK (Madin-Darby canine kidney) cells belonging to renal cells, suspended at 300,000 cells / ml, and 100 μl / well per well were dispensed into 96-well plates, followed by incubation for 1 day in a 37 ° C. CO 2 incubator. It is then infected with avian and swine influenza virus diluted to 10 4 TCID 50 / ml and reacted for 1 hour in a 37 ℃ CO 2 incubator. Thereafter, the infected cells were washed three times with PBS, and then the compounds were diluted to a final concentration of 10 µg / ml, respectively, divided into three wells, and incubated in a 37 ° C. CO 2 incubator for 5 days. Tamiflu was added at the same concentration as a positive control, and the negative control was only evaluated by infecting avian and swine influenza viruses. When the virus adheres to the host cell, specific erythrocytes are aggregated, and thus, the activity is evaluated by performing a hemagglutination assay (HA), which is one of the methods of indirectly quantifying the virus present in the cell culture. .

표 6의 결과를 보면 적혈구 응집시험의 결과 뉴라미니데이즈를 저해하는 칼콘계 화합물 2(에치나틴), 화합물 4(리코칼콘 A) 및 화합물 5(이소리크리티제닌)가 적혈구 응집을 저해함을 확인하였으며, 동일 농도로 사용한 타미플루도 적혈구 응집을 저해함을 확인하였다. Table 6 shows the results of the erythrocyte agglutination test, chalcone-based compound 2 (Echinatin), which inhibits neuraminidase, It was confirmed that Compound 4 (Ricochalcon A) and Compound 5 (Isoricristinein) inhibited hemagglutination, and Tamiflu also inhibited hemagglutination.

조건 Condition 적혈구 응집반응에 의한 화합물의 항바이러스 활성도 Antiviral Activity of Compounds by Hemagglutination 조류 인플루엔자 바이러스 (H9N2) Avian Influenza Virus (H9N2) 돼지 인플루엔자 바이러스 (H1N1) Swine Influenza Virus (H1N1) A 분획 (에탄올 추출물) A fraction (ethanol extract) 없음(+) None (+) 없음(+) None (+) B 분획 (헥산 추출물) B fraction (hexane extract) 없음(-) none(-) 없음(-) none(-) C 분획 (에틸아세테이트 추출물) C fraction (ethyl acetate extract) 있음(+)  Yes (+) 있음(+) Yes (+) D 분획 (부탄올 추출물) D fraction (butanol extract) 없음(-) none(-) 없음(-) none(-) 화합물 2  Compound 2 있음(+)  Yes (+) 있음(+) Yes (+) 화합물 4 Compound 4 있음(+)  Yes (+) 있음(+) Yes (+) 화합물 5 Compound 5 있음(+)  Yes (+) 있음(+) Yes (+) 타미플루  Tamiflu 있음(+)  Yes (+) 있음(+) Yes (+)

<< 실시예Example 11: 독성실험> 11: Toxicity test

11-1. 급성독성11-1. Acute Toxicity

감초로부터 추출된 70% 에탄올 추출물과 에틸아세테이트 활성분획을 단기간에 과량을 섭취하였을 시 급성적(24시간 이내)으로 동물체내에 미치는 독성을 조사하고, 치사율을 결정하기 위하여 본 실험을 수행하였다. 일반적인 마우스인 ICR 마우스 계통 20 마리를 대조군은 10마리, 실험군은 10마리씩 배정하였다. 대조군에는 30% PEG-400만을 투여하고, 실험군은 감초로부터 추출된 에틸아세테이트 활성분획을 2.0g/㎏(일반적인 동물실험에서 사용되는 양의 50배 정도)의 농도로 경구 투여하였다. 투여 24시간 후에 각각의 치사율을 조사한 결과, 대조군과 2.0g/㎏ 농도의 감초 70% 에탄올 추출물과 화합물 1 내지 화합물 8을 함유한 에틸아세테이트 활성분획을 투여한 실험군에서는 모두 생존하였다. This study was conducted to investigate the toxicity of acutely (within 24 hours) to the animal body and to determine the mortality rate when excessive intake of 70% ethanol extract and ethyl acetate activity fraction extracted from licorice. Twenty ICR mouse strains, which are common mice, were assigned to 10 control groups and 10 experimental groups. Only 30% PEG-400 was administered to the control group, and the experimental group was orally administered with an ethyl acetate activity fraction extracted from licorice at a concentration of 2.0 g / kg (about 50 times the amount used in general animal experiments). As a result of investigating each mortality after 24 hours, all of the control group and the experimental group administered the ethyl acetate activity fraction containing the licorice 70% ethanol extract and the compounds 1 to 8 at 2.0 g / kg concentration survived.

11-2 . 실험군 및 대조군의 장기 및 조직 독성 실험11-2. Long-term and tissue toxicity experiments in experimental and control groups

장기 독성 실험은 C57BL/6J 생쥐를 대상으로 동물의 각 장기(조직)에 미치는 영향을 조사하기 위하여 화합물 1 내지 화합물 8을 함유한 70% 에탄올 추출물을 투여한 실험군과 용매만을 투여한 대조군의 동물들로부터 8주 후 혈액을 채취하여 GPT(glutamate-pyruvate transferase) 및 BUN(Blood Urea Nitrogen)의 혈액 내 농도를 Select E(Vital Scientific NV, Netherland) 기기를 이용하여 측정하였다. 그 결과, 간독성과 관계있는 것으로 알려진 GPT와 신장독성과 관계있는 것으로 알려진 BUN의 경우, 대조군과 비교하여 실험군은 별다른 차이를 보이지 않았다. 또한, 각 동물로부터 간과 신장을 정취하여 통상적인 조직절편 제작과정을 거쳐 광학현미경으로 조직학적 관찰을 시행하였으며 특이한 이상이 관찰되지 않았다. In the long-term toxicity experiment, C57BL / 6J mice were treated with 70% ethanol extract containing Compound 1 to Compound 8 and the control group only solvent to examine the effect on each organ (tissue) of the animal. Blood was collected after 8 weeks from the blood concentrations of glutamate-pyruvate transferase (GPT) and blood urea nitrogen (BUN) were measured using a Select E (Vital Scientific NV, Netherland) instrument. As a result, in the case of GPT, which is known to be related to hepatotoxicity, and BUN, which is known to be related to nephrotoxicity, there was no difference in the experimental group compared to the control group. In addition, liver and kidneys were removed from each animal, and histological observations were performed by optical microscopy through a conventional tissue fabrication process. No abnormalities were observed.

<< 사용예Example 1 : 약학적  1: Pharmaceutical 제제예Formulation example >>

1-1. 정제의 제조1-1. Manufacture of tablets

본 발명에 따른 실시예 1 감초의 70% 에탄올 추출물 또는 이로부터 분리된 화합물 각각 200g을 락토오스 175.9g, 감자전분 180g 및 콜로이드성 규산 32g과 혼합하였다. 이 혼합물에 10% 젤라틴 용액을 첨가시킨 후, 분쇄해서 14 메쉬체를 통과시켰다. 이것을 건조시키고 여기에 감자전분 160g, 활석 50g 및 스테아린산 마그네슘 5g을 첨가해서 얻은 혼합물을 정제로 만들었다. Example 1 according to the present invention 200 g of 70% ethanol extract of licorice or a compound isolated therefrom was mixed with 175.9 g lactose, 180 g potato starch and 32 g colloidal silicic acid. 10% gelatin solution was added to the mixture, which was then ground and passed through a 14 mesh sieve. It was dried and the mixture obtained by adding 160 g of potato starch, 50 g of talc and 5 g of magnesium stearate was made into a tablet.

1-2. 주사액제의 제조1-2. Preparation of Injection

본 발명에 따른 실시예 1 감초의 70% 에탄올 추출물 또는 이로부터 분리된 화합물 각각 1g, 염화나트륨 0.6g 및 아스코르브산 0.1g을 증류수에 용해시켜서 100㎖를 만들었다. 이 용액을 병에 넣고 20℃에서 30분간 가열하여 멸균시켰다.Example 1 according to the present invention 1 g, 70 g ethanol extract of licorice or a compound isolated therefrom, 0.6 g sodium chloride and 0.1 g ascorbic acid were dissolved in distilled water to make 100 ml. The solution was bottled and sterilized by heating at 20 ° C. for 30 minutes.

<< 사용예Example 2 : 식품  2: food 제조예Production Example >>

2-1. 조리용 양념의 제조2-1. Preparation of Cooking Seasonings

본 발명에 따른 실시예 1의 감초 70% 에탄올 추출물 또는 이로부터 분리된 화합물 각각 0.2~10 중량부로 건강 증진용 조리용 양념을 제조하였다.Licorice 70% ethanol extract of Example 1 according to the present invention 0.2 to 10 parts by weight of each compound isolated from it was prepared for health promotion cooking seasoning.

11-2. 밀가루 식품의 제조11-2. Manufacture of Flour Food

본 발명에 따른 실시예 1의 감초 70% 에탄올 추출물 또는 이로부터 분리된 화합물 각각 0.1~5.0 중량부를 밀가루에 첨가하고, 이 혼합물을 이용하여 빵, 케이크, 쿠키, 크래커 및 면류를 제조하여 건강 증진용 식품을 제조하였다.Licorice 70% ethanol extract of Example 1 according to the present invention or 0.1 to 5.0 parts by weight of each compound isolated therefrom is added to the flour, using the mixture to prepare bread, cake, cookies, crackers and noodles for health promotion Food was prepared.

2-3. 2-3. 스프soup 및 육즙( And juicy ( graviesgravies )의 제조Manufacturing

본 발명에 따른 실시예 1의 감초 70% 에탄올 추출물 또는 이로부터 분리된 화합물 각각 0.1~1.0 중량부를 스프 및 육즙에 첨가하여 건강 증진용 육가공 제품, 면류의 수프 및 육즙을 제조하였다.The licorice 70% ethanol extract of Example 1 according to the present invention, or 0.1 to 1.0 parts by weight of each of the compounds separated therefrom were added to soups and broth to prepare meat products for health promotion, soups and broths of noodles.

2-4. 유제품(2-4. dairy product( dairydairy productsproducts )의 제조Manufacturing

본 발명에 따른 실시예 1의 감초 70% 에탄올 추출물 또는 이로부터 분리된 화합물 각각 0.1~1.0 중량부를 우유에 첨가하고, 상기 우유를 이용하여 버터 및 아이스크림과 같은 다양한 유제품을 제조하였다.Licorice 70% ethanol extract of Example 1 according to the present invention, or 0.1 to 1.0 parts by weight of each compound isolated therefrom was added to milk, and various dairy products such as butter and ice cream were prepared using the milk.

<< 사용예Example 3 : 음료  3: drink 제조예Production Example >>

3-1. 3-1. 야채쥬스Vegetable Juice 제조 Produce

본 발명에 따른 실시예 1의 감초 70% 에탄올 추출물 또는 이로부터 분리된 화합물 각각 0.5g을 토마토 또는 당근 쥬스 1,000㎖에 가하여 건강 증진용 야채쥬스를 제조하였다.0.5 g of each of the licorice 70% ethanol extract of Example 1 or the compound isolated therefrom was added to 1,000 ml of tomato or carrot juice to prepare vegetable juice for health promotion.

3-2. 3-2. 과일쥬스Fruit juice 제조 Produce

본 발명에 따른 실시예 1의 감초 70% 에탄올 추출물 또는 이로부터 분리된 화합물 각각 0.1g을 사과 또는 포도 쥬스 1,000㎖에 가하여 건강 증진용 과일쥬스를 제조하였다.Health promotion fruit juice was prepared by adding 0.1 g of the licorice 70% ethanol extract of Example 1 or the compound isolated therefrom to 1,000 ml of apple or grape juice according to the present invention.

<< 사용예Example 4 : 사료첨가제  4: feed additive 제조예Production Example >>

본 발명에 따른 실시예 1의 감초 70% 에탄올 추출물 또는 이로부터 분리된 화합물 각각 10.0g을 부형제를 50.0g에 섞어 사료첨가제를 제조하였다. 그러나, 그 배합비를 임의로 변형 실시하여도 무방하며, 통상의 사료조성물 제조방법에 따라 상기의 성분을 혼합하여 제조에 사용할 수 있다.10.0 g of each of the licorice 70% ethanol extract of Example 1 or a compound isolated therefrom according to the present invention was prepared by mixing an excipient with 50.0 g of a feed additive. However, the compounding ratio may be arbitrarily modified, and the above components may be mixed and used in production according to a conventional feed composition production method.

<< 사용예Example 5 : 소독물의 제조> 5: Preparation of Disinfectants>

본 발명에 따른 실시예 1의 감초 70% 에탄올 추출물 또는 이로부터 분리된 화합물 각각 3.0g을 첨가한 후 정제수를 1,000㎖에 가하여 무 방부제용 천연 소독제를 제조하였다.Licorice 70% ethanol extract of Example 1 according to the present invention or 3.0 g of each compound isolated therefrom was added, and purified water was added to 1,000 ml to prepare a natural disinfectant for preservatives.

도 1은 감초로부터 분리한 활성 칼콘 계열의 화합물을 분리하여 구조를 확인한 후, HPLC 상에서 나타나는 피크와 화합물을 도시한 HPLC 분석 스펙트럼을 나타낸 것이다. Figure 1 shows the HPLC analysis spectrum showing the peak and the compound appearing on the HPLC after confirming the structure by separating the active chalcone-based compounds isolated from licorice.

도 2는 에치나틴(화합물 2, 직선 그래프의 화합물 농도:μM)이 비경쟁적 저해제로 돼지 인플루엔자 바이러스 기원의 뉴라미니데이즈를 저해함을 나타낸 것이다. FIG. 2 shows that Echinatin (Compound 2 , compound concentration in μM) inhibits neuraminidase of swine influenza virus origin as a noncompetitive inhibitor.

Claims (12)

감초(Glycyrrhiza uralensis)를 에탄올 또는 메탄올 중에서 선택된 1종 이상의 추출용매 또는 이들 추출용매의 수용액으로 추출하여 칼콘 화합물인 리코칼콘 F(Licochacone F), 에치나틴(Echicnatin), 리코칼콘 D(Licochalcon D), 리코칼콘 A(Licochalcone A), 이소리크리티제닌(,Isoliquiritigenin), 리코아그로칼콘 A(Licoagrochalcone A), 5-프레닐부테인(5-Prenylbutein), 칸조놀 C(Kanzonol C)의 화합물 중 적어도 한 가지 이상 포함된 것을 특징으로 하는 조류 및 돼지 인플루엔자와 신종플루 관련 질환의 예방 또는 치료용 감초 추출물. Licorice ( Glycyrrhiza uralensis ) is extracted with at least one extraction solvent selected from ethanol or methanol or an aqueous solution of these extraction solvents, and is a chalcone compound, such as ricochacone F, echinnatin, and ricochalcon D. , At least one of the compounds of Licochalcone A, Isoliquiritigenin, Licoagrochalcone A, 5-Prenylbutein, Kanzonol C Licorice extract for the prevention or treatment of avian and swine influenza and swine flu-related diseases, characterized in that it contains more than a branch. 제 1 항에 있어서, The method of claim 1, 추출용매는 50 내지 100% 에탄올 수용액인 것을 특징으로 하는 조류 및 돼지 인플루엔자와 신종플루 관련 질환의 예방 또는 치료용 감초 추출물.Extraction solvent is licorice extract for the prevention or treatment of avian and swine influenza and swine flu-related diseases, characterized in that 50 to 100% ethanol aqueous solution. 제 1 항의 감초 추출물을 포함하는 것을 특징으로 하는 조류 및 돼지 인플루엔자와 신종플루 관련 질환의 예방 또는 개선용 건강기능식품.A dietary supplement for the prevention or improvement of avian and swine influenza and swine flu-related diseases, comprising the licorice extract of claim 1. 제 3 항에 있어서,        The method of claim 3, wherein 상기 건강기능식품은 드링크제, 육류, 소세지, 빵, 캔디류, 스넥류, 면류, 아이스크림을 포함한 낙농제품, 스프, 이온음료 등을 포함한 음료수, 알코올 음료 및 비타민 복합제를 포함한 영양 공급용 제품으로 구성되는 군으로부터 선택되는 것을 특징으로 하는 건강기능식품. The health food from the group consisting of nutritional products, including drinks, meat, sausages, bread, candy, snacks, noodles, dairy products including ice cream, beverages, soups, ionic beverages, alcoholic beverages and vitamin complexes Health functional food, characterized in that selected. 제 1 항의 감초 추출물을 유효성분으로 포함하고 약제학적으로 허용 가능한 담체 또는 부형제를 함유하는 조류 및 돼지 인플루엔자와 신종플루 관련 질환의 예방 또는 치료용 약학조성물.A pharmaceutical composition for preventing or treating avian and swine influenza and swine flu-related diseases, comprising the licorice extract of claim 1 as an active ingredient and containing a pharmaceutically acceptable carrier or excipient. 삭제delete 제 1 항의 감초 추출물과 타미플루를 유효성분으로 포함하고 약제학적으로 허용 가능한 담체 또는 부형제를 함유하는 조류 및 돼지 인플루엔자와 신종플루 관련 질환의 예방 또는 치료용 약학조성물.A pharmaceutical composition for preventing or treating avian and swine influenza and swine flu-related diseases, comprising the licorice extract of claim 1 and Tamiflu as an active ingredient and a pharmaceutically acceptable carrier or excipient. 리코칼콘 F, 에치나틴, 리코칼콘 D, 리코칼콘 A, 이소리크리티제닌, 리코아그로칼콘 A, 5-프레닐부테인, 칸조놀 C의 화합물 중 적어도 한 가지 이상 포함된 것을 특징으로 하는 조류 및 돼지 인플루엔자와 신종플루 관련 질환의 예방 또는 치료용 약학조성물.Algae characterized in that it comprises at least one or more of the compounds of ricokalcon F, echinatin, ricochalcon D, ricokalcon A, isosricrigenin, ricoagrocalcon A, 5-prenylbutane, canzonol C and A pharmaceutical composition for preventing or treating swine influenza and swine flu-related diseases. 삭제delete 제 8 항의 화합물과 타미플루를 유효성분으로 포함하고 약제학적으로 허용 가능한 담체 또는 부형제를 함유하는 조류 및 돼지 인플루엔자와 신종플루 관련 질환의 예방 또는 치료용 약학조성물.A pharmaceutical composition for preventing or treating avian and swine influenza and swine flu-related diseases, comprising the compound of claim 8 and Tamiflu as an active ingredient and a pharmaceutically acceptable carrier or excipient. 제 1 항의 감초 추출물을 유효성분으로 포함하고 약제학적으로 허용 가능한 담체 또는 부형제를 함유하는 조류 및 돼지 인플루엔자와 신종플루 질환의 예방 또는 치료용 동물약품 및 사료 첨가제.Animal drug and feed additive for the prevention or treatment of avian and swine influenza and swine flu disease comprising the licorice extract of claim 1 as an active ingredient and a pharmaceutically acceptable carrier or excipient. 제 1 항의 감초 추출물을 유효성분으로 포함하고 약제학적으로 허용 가능한 담체 또는 부형제를 함유하는 조류 및 돼지 인플루엔자와 신종플루 관련 질환의 예방 또는 치료용 천연소독제.A natural antiseptic agent for preventing or treating avian and swine influenza and swine flu-related diseases, comprising the licorice extract of claim 1 as an active ingredient and a pharmaceutically acceptable carrier or excipient.
KR1020090101628A 2009-10-26 2009-10-26 Antiviral agents with inhibitory activities on on avian and swine influenza virus or novel influenza virus by compounds isolated from glycyrrhiza uralensis KR100950445B1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
KR1020090101628A KR100950445B1 (en) 2009-10-26 2009-10-26 Antiviral agents with inhibitory activities on on avian and swine influenza virus or novel influenza virus by compounds isolated from glycyrrhiza uralensis

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
KR1020090101628A KR100950445B1 (en) 2009-10-26 2009-10-26 Antiviral agents with inhibitory activities on on avian and swine influenza virus or novel influenza virus by compounds isolated from glycyrrhiza uralensis

Publications (1)

Publication Number Publication Date
KR100950445B1 true KR100950445B1 (en) 2010-04-02

Family

ID=42219433

Family Applications (1)

Application Number Title Priority Date Filing Date
KR1020090101628A KR100950445B1 (en) 2009-10-26 2009-10-26 Antiviral agents with inhibitory activities on on avian and swine influenza virus or novel influenza virus by compounds isolated from glycyrrhiza uralensis

Country Status (1)

Country Link
KR (1) KR100950445B1 (en)

Cited By (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR101189823B1 (en) * 2009-11-23 2012-10-10 한국생명공학연구원 Composition for prevention and treatment of influenza virus and composition for inhibiting the activity of neuraminidase comprising polyphenol compounds
WO2012144854A3 (en) * 2011-04-21 2013-03-07 경희대학교 산학협력단 Novel uses of licochalcone a
KR101322851B1 (en) * 2011-10-12 2013-10-28 강병곤 Composition comprising herbal extracts for inhibiting growth of Newcastle disease virus or Avian Influenza virus
CN103405402A (en) * 2013-02-01 2013-11-27 中国人民解放军军事医学科学院放射与辐射医学研究所 New use of 5-(1,1-dimethylallyl propyl)-4,4'-dihydroxyl-2-methoxyl chalcone
WO2015111904A1 (en) * 2014-01-21 2015-07-30 한국생명공학연구원 Composition for preventing or treating influenza virus infection comprising curcuminoid-based compound and licorice extract or fraction thereof
KR20220076565A (en) 2020-11-30 2022-06-08 서울대학교산학협력단 Composition for preventing or treating influenza virus infection comprising Angelica dahurica, Curcuma longa and Resina Pini extract
KR20220102695A (en) 2021-01-13 2022-07-21 서울대학교산학협력단 Composition for preventing or treating avian influenza virus infection comprising Angelica dahurica, Curcuma longa and Resina Pini extracts
KR20240045546A (en) 2022-09-30 2024-04-08 (주)예스킨 Anti-influenza viral agent

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2004041260A1 (en) 2002-11-06 2004-05-21 Sigma-Tau Industrie Farmaceutiche Riunite S.P.A. Use of resveratrol for the preparation of a medicament useful for the treatment of influenza virus infections

Patent Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2004041260A1 (en) 2002-11-06 2004-05-21 Sigma-Tau Industrie Farmaceutiche Riunite S.P.A. Use of resveratrol for the preparation of a medicament useful for the treatment of influenza virus infections

Cited By (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR101189823B1 (en) * 2009-11-23 2012-10-10 한국생명공학연구원 Composition for prevention and treatment of influenza virus and composition for inhibiting the activity of neuraminidase comprising polyphenol compounds
WO2012144854A3 (en) * 2011-04-21 2013-03-07 경희대학교 산학협력단 Novel uses of licochalcone a
KR101322851B1 (en) * 2011-10-12 2013-10-28 강병곤 Composition comprising herbal extracts for inhibiting growth of Newcastle disease virus or Avian Influenza virus
CN103405402A (en) * 2013-02-01 2013-11-27 中国人民解放军军事医学科学院放射与辐射医学研究所 New use of 5-(1,1-dimethylallyl propyl)-4,4'-dihydroxyl-2-methoxyl chalcone
WO2015111904A1 (en) * 2014-01-21 2015-07-30 한국생명공학연구원 Composition for preventing or treating influenza virus infection comprising curcuminoid-based compound and licorice extract or fraction thereof
KR20220076565A (en) 2020-11-30 2022-06-08 서울대학교산학협력단 Composition for preventing or treating influenza virus infection comprising Angelica dahurica, Curcuma longa and Resina Pini extract
KR20220102695A (en) 2021-01-13 2022-07-21 서울대학교산학협력단 Composition for preventing or treating avian influenza virus infection comprising Angelica dahurica, Curcuma longa and Resina Pini extracts
KR20240045546A (en) 2022-09-30 2024-04-08 (주)예스킨 Anti-influenza viral agent

Similar Documents

Publication Publication Date Title
KR101021830B1 (en) Antiviral agents with inhibitory activities on avian and swine influenza virus or novel influenza virus by compounds isolated from cleistocalyx operculatus
KR100950445B1 (en) Antiviral agents with inhibitory activities on on avian and swine influenza virus or novel influenza virus by compounds isolated from glycyrrhiza uralensis
KR100962334B1 (en) Antiviral agents with inhibitory activities on avian and swine influenza virus or novel influenza virus by compounds isolated from curcurma longa
KR101077920B1 (en) Composition for prevention and treatment of influenza virus and composition for inhibiting the activity of neuraminidase comprising extracts of Turmeric
KR101317318B1 (en) A composition comprising the extract of Galla Rhois or the compounds isolated therefrom showing inhibiting activity of novel influenza, avian influenza, or SARS syndrome
KR101782532B1 (en) A composition comprising extract of Angelica dahurica or furanocoumarins isolated therefrom for preventing or treating Avian influenza, Swine influenza or Corona virus
KR101334143B1 (en) Composition comprising extract of polygala karensium or xanthone compounds isolated therefrom for treating or preventing cold, avian influenza, swine influenza or novel influenza
KR101612051B1 (en) Composition for prevention or treatment of coronavirus infection comprising extracts of Salvia miltiorrhiza
KR101271601B1 (en) Composition for Prevention or Treatment of Disease Originated from Influenza Virus
KR101976528B1 (en) Composition comprising extract of Undaria pinnatifida for preventing or treating of Corona virus
KR20150055683A (en) Composition comprising ginsenosides for treating or preventing Cold, Avian influenza, or Swine influenza
KR101189823B1 (en) Composition for prevention and treatment of influenza virus and composition for inhibiting the activity of neuraminidase comprising polyphenol compounds
KR20100114674A (en) Composition for inhibiting the activity of neuraminidase and pharmaceutical composition for prevention and treatment of influenza viral diseases comprising extracts of cudrania tricuspidata
US10136663B2 (en) Curcuminoid-based compound/stevioside-containing complex for the prevention and treatment of an influenza virus infection
KR101427096B1 (en) Composition comprising extract of Dryopteris crassirhizoma or phloroglucinol derivatives isolated therefrom for treating or preventing Corona virus related disease
US20120046353A1 (en) Cleistocalyx operculatus-derived compounds having inhibitory activities against avian and swine influenza viruses or novel influenza virus
KR20150095605A (en) Composition comprising ginsenosides for treating or preventing Cold, Avian influenza, or Swine influenza
KR20210133861A (en) Composition for preventing or treating swine influenza virus disease comprising Resina Pini extract or diterpenoids isolated therefrom as active ingredients
KR101115063B1 (en) Composition for prevention and treatment of influenza virus and composition for inhibiting the activity of neuraminidase
KR20150086928A (en) Composition for prevention or treatment of influenza virus infection comprising curcuminoid and licorice extracts or fraction thereof
KR101636606B1 (en) Composition comprising polyphenols from the fruiting bodies of Phellinus baumii for preventing or treating of influenza virus infection
KR101189822B1 (en) Composition for inhibiting the activity of neuraminidase and composition for prevention and treatment of influenza viral diseases comprising coumarin compounds
KR102583001B1 (en) Composition for preventing or treating severe acute respiratory syndrome- corona virus infection comprising Chlorella sp. extract or pheophytinized fraction or pyphyrins or carotenones isolated therefrom as active ingredients
EP4151226A1 (en) Coronavirus therapeutic agent comprising zanthoxylum piperitum leaf extract as active ingredient
KR20160143628A (en) Composition for prevention or treatment of influenza virus infection comprising curcuminoid and licorice extracts or fraction thereof

Legal Events

Date Code Title Description
A201 Request for examination
A302 Request for accelerated examination
E902 Notification of reason for refusal
E701 Decision to grant or registration of patent right
GRNT Written decision to grant
FPAY Annual fee payment

Payment date: 20130131

Year of fee payment: 4

FPAY Annual fee payment

Payment date: 20140225

Year of fee payment: 5

FPAY Annual fee payment

Payment date: 20150303

Year of fee payment: 6

FPAY Annual fee payment

Payment date: 20160226

Year of fee payment: 7

FPAY Annual fee payment

Payment date: 20180226

Year of fee payment: 9

FPAY Annual fee payment

Payment date: 20190226

Year of fee payment: 10

FPAY Annual fee payment

Payment date: 20200226

Year of fee payment: 11