KR101334143B1 - Composition comprising extract of polygala karensium or xanthone compounds isolated therefrom for treating or preventing cold, avian influenza, swine influenza or novel influenza - Google Patents
Composition comprising extract of polygala karensium or xanthone compounds isolated therefrom for treating or preventing cold, avian influenza, swine influenza or novel influenza Download PDFInfo
- Publication number
- KR101334143B1 KR101334143B1 KR1020120062490A KR20120062490A KR101334143B1 KR 101334143 B1 KR101334143 B1 KR 101334143B1 KR 1020120062490 A KR1020120062490 A KR 1020120062490A KR 20120062490 A KR20120062490 A KR 20120062490A KR 101334143 B1 KR101334143 B1 KR 101334143B1
- Authority
- KR
- South Korea
- Prior art keywords
- compound
- influenza
- swine
- polygala
- extract
- Prior art date
Links
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/335—Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin
- A61K31/35—Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin having six-membered rings with one oxygen as the only ring hetero atom
- A61K31/352—Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin having six-membered rings with one oxygen as the only ring hetero atom condensed with carbocyclic rings, e.g. methantheline
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23K—FODDER
- A23K20/00—Accessory food factors for animal feeding-stuffs
- A23K20/10—Organic substances
- A23K20/116—Heterocyclic compounds
- A23K20/121—Heterocyclic compounds containing oxygen or sulfur as hetero atom
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23L—FOODS, FOODSTUFFS, OR NON-ALCOHOLIC BEVERAGES, NOT COVERED BY SUBCLASSES A21D OR A23B-A23J; THEIR PREPARATION OR TREATMENT, e.g. COOKING, MODIFICATION OF NUTRITIVE QUALITIES, PHYSICAL TREATMENT; PRESERVATION OF FOODS OR FOODSTUFFS, IN GENERAL
- A23L29/00—Foods or foodstuffs containing additives; Preparation or treatment thereof
- A23L29/03—Organic compounds
- A23L29/035—Organic compounds containing oxygen as heteroatom
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K36/00—Medicinal preparations of undetermined constitution containing material from algae, lichens, fungi or plants, or derivatives thereof, e.g. traditional herbal medicines
- A61K36/18—Magnoliophyta (angiosperms)
- A61K36/185—Magnoliopsida (dicotyledons)
- A61K36/69—Polygalaceae (Milkwort family)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2236/00—Isolation or extraction methods of medicinal preparations of undetermined constitution containing material from algae, lichens, fungi or plants, or derivatives thereof, e.g. traditional herbal medicine
- A61K2236/30—Extraction of the material
- A61K2236/33—Extraction of the material involving extraction with hydrophilic solvents, e.g. lower alcohols, esters or ketones
Abstract
Description
본 발명은 폴리갈라 카렌시움(Polygala karensium) 추출물 및 이로부터 분리된 잔톤(xanthones)계 화합물을 함유하는 감기, 조류 인플루엔자, 돼지 인플루엔자 또는 신종플루의 예방 또는 치료용 조성물에 관한 것이다. The present invention relates to a composition for the prevention or treatment of cold, avian influenza, swine influenza or swine flu containing Polygala karensium extract and xanthones-based compounds isolated therefrom.
인플루엔자 바이러스는 '오르소믹소'과에 속하는 RNA 바이러스(Orthomyxovirus)로서 A, B, C형으로 분류된다. A형은 사람에게 주로 감염이 확인되며 B, C형에 비하여 돼지, 기타 포유류 및 다양한 야생조류에서 감염이 확인되고 있는 바이러스이다. 최근, 전 세계적으로 문제가 되고 있는 조류 인플루엔자(Avian influenza), 돼지 인플루엔자(Swine influenza) 및 신종플루(Novel flu) 등은 모두 A형 바이러스에 속한다.Influenza viruses are orthomyxoviruses belonging to the orthomyxo family and are classified into types A, B and C. Type A is a virus that has been confirmed mainly in humans and has been confirmed in pigs, other mammals, and various wild birds compared to types B and C. Recently, Avian influenza, swine influenza and Novel flu, which are a problem worldwide, belong to the type A virus.
인플루엔자 바이러스의 표면에는 헤마글루티닌(hemagglutinin, HA)과 뉴라미니데이즈(neuraminidase, NA)라는 두 가지 단백질이 존재하는데, HA는 16종이 있고 NA는 9종이 있으므로 16×9=144 종류의 인플루엔자 바이러스가 발생할 수 있다. 조류에서의 인플루엔자 감염은 주로 H5형이나 H7형 및 H9형에 관련되며, 3종류의 헤마글루티닌(H1, H2, H3)과 2가지 형태의 뉴라미니데이즈(N1과 N2)만이 인간에서 인플루엔자 감염을 일으키므로 원칙적으로 인간은 조류 인플루엔자에 감염되지 않았다. 그러나 최근의 조류 인플루엔자는 조류의 인플루엔자 바이러스가 유전자 재조합 과정을 거치지 않고 직접 사람에게 전파된 예도 발생하고 있다.There are two proteins on the surface of the influenza virus: hemagglutinin (HA) and neuraminidase (NA) .There are 16 types of HA and 9 types of NA, so 16 × 9 = 144 types of influenza viruses May occur. Influenza infections in birds are mainly related to H5, H7 and H9 types, with only three types of hemagglutinin (H1, H2, H3) and two types of neuraminidase (N1 and N2) in humans. In principle, humans are not infected with avian influenza, as it causes infection. Recently, however, avian influenza has occurred in which avian influenza virus is directly transmitted to humans without undergoing genetic recombination.
조류 인플루엔자는 닭과 오리, 칠면조 등 가금류를 접촉하는 것 이외에도 야생조류와 우리나라에 온 철새들을 통해서 빠르게 전파된다. 조류 인플루엔자 바이러스는 조류 인플루엔자가 발생한 동남아로부터 주기적으로 유입되어 전파되며 특히 봄철 황사를 통해 중국으로부터도 전염이 가능하다. 세계적으로 문제가 되고 있는 동물의 바이러스 질환인 조류 인플루엔자는 국내에서 1996년 이후 발생해 530만 마리의 닭, 오리가 도살되는 등 1,500억 원 이상의 직접 피해가 발생하였으며, 아시아에서도 조류 인플루엔자를 통해 2억 마리 이상의 축산물이 도살되어 양계산업의 경제적 손실이 막대하다.Avian influenza spreads quickly through wild birds and migratory birds that come to Korea, in addition to contacting poultry such as chickens, ducks and turkeys. Avian influenza virus is periodically introduced and spread from Southeast Asia, where avian influenza has occurred, and can be transmitted from China through spring yellow dust. Avian influenza, a global viral disease of animals, has been incurred since 1996 in Korea, killing 5.3 million chickens and ducks, causing more than 150 billion won in direct damage. More than 10 livestock are slaughtered, causing huge economic losses for the poultry industry.
돼지 인플루엔자(Swine influenza)는 1918년에 처음으로 보고되었으며 보통 돼지는 사람이 가지고 있는 인플루엔자 수용체(N-acetylneuraminic acid α2,6 galactose)와 조류들이 갖고 있는 인플루엔자 수용체(N-acetylneuraminic acid α2,3 galactose)를 동시에 가지고 있어 조류 인플루엔자 바이러스가 돼지의 몸 안에서 재조합(reassortment) 또는 적응(adaptation)을 통하여 사람에게 감염될 수 있는 바이러스 혼합용기(mixing vessels)의 역할을 한다고 알려져 있다. Swine influenza was reported for the first time in 1918. Usually, swine has a human influenza receptor (N-acetylneuraminic acid α2,6 galactose) and algae's influenza receptor (N-acetylneuraminic acid α2,3 galactose). It is known that avian influenza virus acts as a virus mixing vessel that can infect humans through reassortment or adaptation in pigs.
2009년 멕시코에서 처음 발병하여 전세계로 퍼지고 있는 신종플루(Novel influenza)는 돼지 인플루엔자 바이러스인 H1N1이 돼지에게 감염되어 인간에게 전염이 가능한 질환으로 변이된 것으로 추정된다. 신종플루는 기본적으로 감기처럼 고열, 기침 등의 증상이 나타나는데 현재 상태보다 인간에게 치명적인 바이러스로 변할 가능성이 존재한다. 세계보건기구(WHO)가 집계하는 신종플루의 감염자 수는 2009년 10월 초까지 그 수가 34만 3200명에 달하였고, 사망자는 4000명을 넘어섰으며, 2010년 세계보건기구는 신종플루의 현황을 6단계인 대유행 상태로 격상하였다. 신종플루의 일반적인 증상은 일반 독감과 구별하기가 매우 어렵다. 신종플루는 일반 독감과 비슷하게 발열, 인후통, 기침, 콧물 또는 코막힘의 증상을 보이고 있으며, 최근의 신종플루 관련 보고에 의하면 일반독감보다 심한 치명적인 폐 손상을 유발하는 특징을 보이고 있으므로 신종플루의 예방 및 치료는 매우 중요한 문제이다. 따라서 신종플루를 예방하기 위하여 백신의 확보가 필수적이나 예방적 차원의 국가적 백신 대책으로 매번 항원변이가 일어나는 RNA 바이러스를 모두 예방하는 백신을 만드는 것은 불가능에 가깝다. 따라서 조류 인플루엔자, 돼지 인플루엔자, 신종플루 또는 최악의 발병 가능성인 조류 인플루엔자와 신종플루가 섞인 새로운 병원체의 발생에 대비하기 위하여 이를 예방하고 치료할 수 있는 치료제의 개발은 필수적이다. Novel influenza, the first influenza in Mexico in 2009 and spreading around the world, is believed to have been infected with swine influenza virus H1N1, a disease that can be transmitted to humans. Swine flu is basically like a cold, high fever, cough, etc. There is a possibility that the virus becomes more lethal than humans. The number of people infected with the H1N1 flu recorded by the World Health Organization (WHO) reached 34,200 by the beginning of October 2009, and the death toll exceeded 4,000. Upgraded to the sixth pandemic. Common symptoms of swine flu are very difficult to distinguish from the common flu. Swine flu shows symptoms of fever, sore throat, cough, runny nose or stuffy nose, similar to the common flu, and recent reports related to swine flu show more severe fatal lung damage than the common flu. Treatment is a very important problem. Therefore, it is necessary to secure a vaccine to prevent the H1N1 flu, but as a preventive national vaccine, it is almost impossible to make a vaccine that prevents all the RNA viruses that occur every time. Therefore, in order to prepare for the development of avian influenza, swine influenza, swine flu, or a new pathogen mixed with the worst possible avian influenza and swine flu, it is necessary to develop a treatment that can prevent and treat it.
현재 조류 인플루엔자, 돼지 인플루엔자, 신종플루의 유일한 치료제는 바이러스 기원의 뉴라미니데이즈에 선택적인 저해물질로 개발된 경구용 치료제인 타미플루(oseltamivir phosphate)와 흡입형인 리렌자(zanamivir) 등이다. 경구용 치료제로서 많이 사용하고 있는 타미플루의 부작용으로는 오심, 구토, 신경계나 정신계의 이상이 보고되었으며, 일본의 경우 타미플루를 승인 후 확인된 소아환자의 사망예가 15건이 될 정도로 부작용을 갖고 있다. 또한, 경구용 치료제로 사용되고 있는 타미플루에 대한 내성 바이러스가 발병할 경우를 대비하여야 한다. 최근에 이미 신종플루의 확산에 치명적인 타미플루에 대한 내성 바이러스의 출현이 보고되고 있으며, 타미플루 내성 바이러스의 인간 대 인간 전염조차도 발견되고 있는 실정이다. 따라서 조류 인플루엔자, 돼지 인플루엔자 및 신종플루에 대한 바이러스 치료제의 개발은 인간의 보건안전에 필수적인 사항이다. Currently, the only treatments for avian influenza, swine influenza and swine flu are oralamisol (oseltamivir phosphate), an oral therapeutic agent developed as a selective inhibitor of neuraminidase of viral origin, and inhalable zanamivir. Side effects of Tamiflu, which is widely used as an oral treatment, have been reported such as nausea, vomiting, nervous or psychological problems, and in Japan, there are 15 cases of death in pediatric patients confirmed after Tamiflu approval. In addition, it should be prepared for the development of resistant virus against Tamiflu, which is used as an oral treatment. Recently, the emergence of Tamiflu-resistant virus, which is fatal to the spread of swine flu, has been reported, and even human-to-human transmission of Tamiflu-resistant virus has been found. Therefore, the development of viral treatments for avian influenza, swine influenza and swine flu is essential for human health and safety.
한편, 감기는 인플루엔자 바이러스로 인해 발생하는 가장 흔한 질병으로서, 통상적인 인플루엔자 바이러스(influenza virus) A형, B형, C형, 아데노 바이러스(adenovirus), 코로나 바이러스(corona virus), 라이노 바이러스(rhinovirus), RS 바이러스(respiratory syncytial virus) 등의 다양한 원인이 있어 치료나 예방, 백신 제조 등이 쉽지 않은 질병에 속한다. 따라서, 감기를 일으킬 수 있는 다양한 바이러스를 효과적으로 치료할 수 있는 치료제의 개발이 시급한 상황이다. On the other hand, the common cold caused by influenza virus is the common influenza virus (type A, B, C, adenovirus, corona virus (corona virus), rhinovirus (rhinovirus) , RS virus (respiratory syncytial virus) due to a variety of causes, such as disease is difficult to treat, prevent, vaccine manufacturing. Therefore, there is an urgent need to develop a therapeutic agent that can effectively treat various viruses that can cause colds.
바이러스의 감염 및 증식과정을 살펴보면 바이러스는 세포에 감염 후 세포내에서 새로운 바이러스를 만들고 다른 세포로 전파되기 위하여 세포 외부에 존재하는 시알릭산(siliac acid)을 바이러스가 만든 뉴라미니데이즈를 이용하여 절단하는 것이 필요하다. 타미플루 내성 조류 인플루엔자 바이러스는 보통 타미플루가 결합하는 타미플루의 수용체 단백질의 아미노산을 변화시키는 3개의 유전적 변이(Arg292Lys, Asn274Ser, His294Tyr)를 통해 발생하는 것으로 알려지고 있다. 3개의 유전적 변이 중 타미플루 내성 조류 인플루엔자 바이러스의 변종으로 가장 많이 발현하는 294의 His가 Tyr으로 변화한 바이러스의 경우는 타미플루의 소수성 잔기(hydrophobic residue)가 타미플루 수용체에 결합하지 못하게 변이된 경우이다. 이는 미국과 유럽에서 2007~2008년 시즌에 10~25% 확률로 발견된 바이러스로서 향후의 신종플루에 대한 변이가능성에 대한 위험도를 증가시키고 있다. 따라서 이들 타미플루 내성 바이러스의 등장은 인간이 새로운 바이러스 치료제를 지속적으로 개발하여야 하는 당위성을 제공하고 있다. In the process of infection and proliferation of the virus, the virus breaks down sialic acid, which is external to the cell, using neuraminidase made by the virus in order to create a new virus in the cell after infection and spread to other cells. It is necessary. Tamiflu-resistant avian influenza viruses are known to occur through three genetic variations (Arg292Lys, Asn274Ser, His294Tyr) that normally alter the amino acids of Tamiflu's receptor protein to which Tamiflu binds. Among the three genetic variants, 294 His, the most highly expressed variant of the Tamiflu-resistant avian influenza virus, changed to Tyr when the hydrophobic residues of Tamiflu did not bind to Tamiflu receptors. It is a virus found in the United States and Europe with a 10-25% chance of being found in the 2007-2008 season, increasing the risk of future mutations. The emergence of these Tamiflu-resistant viruses therefore provides a justification for humans to continue developing new viral therapies.
본 발명에서는 감기, 조류 인플루엔자, 돼지 인플루엔자 및 신종플루의 방어대책에 대한 시급성을 감안하여 효과가 확인되면 바로 적응이 가능한 식품 및 약용식물을 대상으로 하여 감기, 조류 인플루엔자, 돼지 인플루엔자 및 신종플루에 대한 뉴라미니데이즈 저해물질을 탐색하였다. 일반적으로 새로운 성분의 약제를 개발하기 위해 기존 약제를 실험적으로 변형시키는 것보다는 전통 의학에서 사용되고 있는 천연물 약제들로부터 새로운 활성 성분을 찾는 것이 여러가지 면에서 장점이 많다. 특히 이러한 활성 성분들은 오랫동안 사용되어 왔기 때문에 약물들에 의한 독성 염려가 적다. 이러한 사실은 신종플루 치료제로서 사용되는 타미플루도 출발물질은 중국의 토착식물인 '스타아니스' 열매를 주원료로 개발한 것에서 확인할 수 있다. In the present invention, a cold, bird influenza, swine flu and swine flu against swine flu, swine flu, swine flu, and swine flu Neuraminidase inhibitors were searched. In general, finding new active ingredients from natural medicines used in traditional medicine has many advantages over experimental modification of existing drugs to develop new ingredients of medicine. In particular, since these active ingredients have been used for a long time, there is little concern about toxicity due to drugs. This fact can be confirmed from the development of Tamifludo starting material, which is used as a treatment for swine flu, as the main ingredient of 'Staranis' fruit, which is an indigenous plant in China.
폴리갈라(Polygala) 속의 식물은 약 500여종이 존재하며, 기억상실증, 감기, 기관지염, 신경쇠약 등에 효과가 있으며, 특히 폴리갈라 속 식물에 함유된 트리테르페노이드 사포닌과 잔톤계 화합물들은 다양한 생물학적 활성이 있는 것으로 알려져 있다(Phytochemistry Reviews, 2005, 4, 139~149 ; Phytochemistry 2008, 69, 1617~1624 ; Chem. Pharm. Bull., 2002, 50, 1499~1501 ; Nat. Prod. 2006, 69, 1305~1309 ; Planta Med., 2008, 74, 133~141).There are about 500 species of plants in the Polygala genus, and they are effective in amnesia, colds, bronchitis, and nervous breakdown. Especially, the triterpenoid saponins and xanthone compounds in the plants of Polygala genus have various biological activities. (Phytochemistry Reviews, 2005, 4, 139-149; Phytochemistry 2008, 69, 1617-1624; Chem. Pharm. Bull., 2002, 50, 1499-1501; Nat. Prod. 2006, 69, 1305 1309; Planta Med., 2008, 74, 133-141).
본 발명에서는 폴리갈라 카렌시움으로부터 잔톤 계열의 화합물을 분리하여 상기 폴리갈라 카렌시움 추출물과 이들 화합물이 조류 인플루엔자 바이러스, 돼지 인플루엔자 바이러스, 신종플루 바이러스 및 타미플루 내성 신종플루 바이러스의 뉴라미니데이즈를 저해함을 확인하였다. In the present invention, by separating the Xanthone-based compounds from polygala carenium, the polygala carenium extract and these compounds inhibit the neuraminidase of avian influenza virus, swine influenza virus, swine flu virus and Tamiflu-resistant swine flu virus It was confirmed.
본 발명의 목적은 폴리갈라 카렌시움(Polygala karensium) 추출물 및 이로부터 분리된 잔톤(xanthones)계 화합물을 함유하는 감기, 조류 인플루엔자, 돼지 인플루엔자 또는 신종플루의 예방 또는 치료용 조성물을 제공하는 데에 있다. The object of the present invention is Polygala To provide a composition for the prevention or treatment of cold, avian influenza, swine influenza or swine flu containing karensium ) extract and xanthones-based compounds isolated therefrom.
본 발명은 하기 화학식 1의 1,3-다이하이드록시잔톤(1,3-dihydroxyxanthone, 화합물 1), 1,7-다이하이드록시잔톤(1,7-dihydroxyxanthone, 화합물 2), 1,7-다이하이드록시-4-메톡시잔톤(1,7-dihydroxy-4-methoxyxanthone, 화합물 3), 1,3,7-트라이하이드록시잔톤(1,3,7-trihydroxyxanthone, 화합물 4), 및, 1,2,3,5-테트라하이드록시잔톤(1,2,3,5-tetrahydroxyxanthone, 화합물 5)으로 이루어진 군에서 선택되는 1종 이상의 잔톤계 화합물이 포함된 폴리갈라 카렌시움(Polygala karensium) 추출물을 함유하는 감기, 조류 인플루엔자, 돼지 인플루엔자 또는 신종플루의 예방 또는 치료용 조성물에 관한 것이다. 1,3-dihydroxyxanthone (Compound 1 ), 1,7-dihydroxyxanthone (1,7-dihydroxyxanthone, Compound 2 ), 1,7-di Hydroxy-4-methoxyxanthone (1,7-dihydroxy-4-methoxyxanthone, compound 3 ), 1,3,7-trihydroxyxanthone (1,3,7-trihydroxyxanthone, compound 4 ), and, 1, 2,3,5-tetrahydroxyxanthone (1,2,3,5-tetrahydroxyxanthone, compound 5 ) containing at least one xanthone-based compound selected from the group consisting of Polygala ( Polygala) karensium ) relates to a composition for the prevention or treatment of colds, avian influenza, swine influenza or swine flu.
[화학식 1][Formula 1]
상기 폴리갈라 카렌시움 추출물은 물, 탄소수 1 내지 4개의 저급 알코올, 아세톤, 에틸아세테이트, 클로로포름 또는 이들의 혼합용매로 추출하여 제조할 수 있다. The polygala calenium extract may be prepared by extracting with water, lower alcohol having 1 to 4 carbon atoms, acetone, ethyl acetate, chloroform or a mixed solvent thereof.
또한, 본 발명은 상기 화학식 1의 1,3-다이하이드록시잔톤(화합물 1), 1,7-다이하이드록시잔톤(화합물 2), 1,7-다이하이드록시-4-메톡시잔톤(화합물 3), 1,3,7-트라이하이드록시잔톤(화합물 4), 및, 1,2,3,5-테트라하이드록시잔톤(화합물 5)으로 이루어진 군에서 선택되는 1종 이상의 잔톤계 화합물을 함유하는 감기, 조류 인플루엔자, 돼지 인플루엔자 또는 신종플루의 예방 또는 치료용 조성물에 관한 것이다.In addition, the present invention is 1,3-dihydroxyxanthone (Compound 1 ), 1,7-dihydroxyxanthone (Compound 2 ), 1,7-dihydroxy-4-methoxyxanthone (Compound 3 ) containing 1,3,7-trihydroxyxanthone (compound 4 ), and one or more xanthene compounds selected from the group consisting of 1,2,3,5-tetrahydroxyxanthone (compound 5 ) It relates to a composition for the prevention or treatment of colds, avian influenza, swine influenza or swine flu.
본 발명은 또한, 상기 화학식 1의 1,3-다이하이드록시잔톤(화합물 1), 1,7-다이하이드록시잔톤(화합물 2), 1,7-다이하이드록시-4-메톡시잔톤(화합물 3), 1,3,7-트라이하이드록시잔톤(화합물 4), 및, 1,2,3,5-테트라하이드록시잔톤(화합물 5)으로 이루어진 군에서 선택되는 1종 이상의 잔톤계 화합물이 포함된 폴리갈라 카렌시움 추출물을 함유하는 감기, 조류 인플루엔자, 돼지 인플루엔자 또는 신종플루의 예방 또는 개선용 건강기능식품을 제공한다. The present invention also provides 1,3-dihydroxyxanthone (Compound 1 ), 1,7-dihydroxyxanthone (Compound 2 ), 1,7-dihydroxy-4-methoxyxanthone (Compound 1 ) 3 ), 1,3,7-trihydroxyxanthone (compound 4 ), and 1,2,3,5-tetrahydroxyxanthone (compound 5 ) include one or more xanthone compounds selected from the group consisting of Done It provides a dietary supplement for the prevention or amelioration of a cold, avian influenza, swine influenza or swine flu containing polygala calenium extract.
한편, 본 발명은 상기 폴리갈라 카렌시움 추출물 및 이로부터 분리된 잔톤계 화합물을 함유하는 동물약품이나 사료 첨가제를 제공한다. 또한, 본 발명에서는 상기 폴리갈라 카렌시움 추출물 및 이로부터 분리된 잔톤계 화합물을 함유하는 천연소독제를 제공할 수도 있다. On the other hand, the present invention provides an animal drug or feed additive containing the polygala carenium extract and the xanthone-based compound separated therefrom. In addition, the present invention may provide a natural antiseptic agent containing the polygala carenium extract and a xanthone compound separated therefrom.
이하 본 발명을 자세하게 설명한다.Hereinafter, the present invention will be described in detail.
본 발명의 폴리갈라 카렌시움 추출물은, 폴리갈라 카렌시움 중량의 2~50배(w/v)의 물, 탄소수 1 내지 4개의 저급 알코올, 아세톤, 에틸아세테이트, 클로로포름 또는 이들의 혼합용매로 추출하여 제조할 수 있다. 상기 저급 알코올은 에탄올, 메탄올, 프로판올, 이소프로판올 및 부탄올 중에서 선택될 수 있다.Polygalar carenium extract of the present invention, 2 to 50 times (w / v) water of polygalar carnsium, lower alcohol having 1 to 4 carbon atoms, acetone, ethyl acetate, chloroform or a mixed solvent thereof Can be prepared by extraction. The lower alcohol may be selected from ethanol, methanol, propanol, isopropanol and butanol.
또한, 본 발명의 폴리갈라 카렌시움 추출물을 유기용매(알코올, 알코올 수용액, 에틸아세테이트, 아세톤, 클로로포름 등)에 의한 추출, 헥산과 물의 분배, 디아이온 HP-20 레진과 같은 흡착수지 사용방법, 칼럼크로마토그래피에 의한 방법 등 식물체 성분의 분리 추출에 이용되는 공지된 방법을 단독 또는 적합하게 조합하여 본 발명의 활성 화합물을 용이하게 얻을 수가 있다. In addition, the extract of the polygala carenium extract of the present invention by an organic solvent (alcohol, aqueous alcohol solution, ethyl acetate, acetone, chloroform, etc.), hexane and water distribution, method of using adsorption resin, such as diion HP-20 resin, The active compound of the present invention can be easily obtained by combining alone or suitably a known method used for separation extraction of plant components, such as by column chromatography.
바람직하게는, 상기 폴리갈라 카렌시움 추출물에 상기 추출물 중량의 2~50배(w/v)의 n-헥산, 에틸아세테이트, n-부탄올 등을 순차적으로 가하여 이를 정제 분획한 뒤, 크로마토그래피 등을 이용하여 항바이러스 활성이 있는 화합물들을 분리할 수 있다. Preferably, 2-50 times (w / v) of n-hexane, ethyl acetate, n-butanol, and the like are sequentially added to the polygalar carenium extract to purify and fractionate it, followed by chromatography. It can be used to isolate the compounds having antiviral activity.
본 발명에서 사용하는 크로마토그래피에는 실리카겔 칼럼 크로마토그래피(silica gel column chromatography), 엘에이취-20 칼럼 크로마토그래피(LH-20 column chromatography), 박층 크로마토그래피(TLC; thin layer chromatography) 및 고성능 액체 크로마토그래피(high performance liquid chromatography) 등이 이용될 수 있다.Chromatography used in the present invention includes silica gel column chromatography, LH-20 column chromatography, thin layer chromatography (TLC) and high performance liquid chromatography high performance liquid chromatography, etc.) can be used.
본 발명의 폴리갈라 카렌시움 추출물 및 이로부터 분리된 잔톤계 화합물의 활성 측정은, 폴리갈라 카렌시움을 물, 탄소수 1 내지 4개의 저급 알코올, 아세톤, 에틸아세테이트, 클로로포름 또는 이들의 혼합용매로 추출한 후 에틸아세테이트로 분획하는 단계; 잔톤계 화합물을 크로마토그래피를 이용하여 순수 분리 정제하는 단계; 분리된 활성 화합물의 화학구조를 통해 잔톤계 화합물을 확인하는 단계; 및, 상기 잔톤계 화합물의 조류 인플루엔자 바이러스(H9N2), 돼지 인플루엔자 바이러스(H1N1), 신종플루 바이러스(H1N1) 뉴라미니데이즈 및 타미플루 내성 신종플루 바이러스(H1N1)의 뉴라미니데이즈에 대한 저해 작용을 측정하는 단계;를 통해 확인할 수 있다. Determination of the activity of the polygala carenium extract of the present invention and the xanthone-based compound isolated therefrom is performed by using the polygala carenium as water, lower alcohol having 1 to 4 carbon atoms, acetone, ethyl acetate, chloroform or a mixed solvent thereof. Extracting and fractionating with ethyl acetate; Separating and purifying the xanthone compound using pure chromatography; Identifying a xanthone compound through the chemical structure of the separated active compound; And measuring the inhibitory effect of the xanthone compound against avian influenza virus (H9N2), swine influenza virus (H1N1), swine flu virus (H1N1) neuraminidase and tamilflu resistant swine flu virus (H1N1). Step; can be confirmed through.
본 발명에 따른 폴리갈라 카렌시움 추출물 및 이로부터 분리된 잔톤계 화합물을 포함하는 약학 조성물은, 각각 통상의 방법에 따라 산제, 과립제, 정제, 캡슐제, 현탁액, 에멀젼, 시럽, 에어로졸 등의 경구형 제형, 외용제, 좌제 및 멸균 주사용액의 형태로 제형화하여 사용될 수 있다. 상기 폴리갈라 카렌시움 추출물 및 이로부터 분리된 잔톤계 화합물을 포함하는 조성물에 포함될 수 있는 담체, 부형제 및 희석제로는 락토즈, 덱스트로즈, 수크로스, 솔비톨, 만니톨, 자일리톨, 에리스리톨, 말티톨, 전분, 아카시아 고무, 알지네이트, 젤라틴, 칼슘 포스페이트, 칼슘 실리케이트, 셀룰로즈, 메틸 셀룰로즈, 미정질 셀룰로스, 폴리비닐 피롤리돈, 물, 메틸히드록시벤조에이트, 프로필히드록시벤조에이트, 탈크, 마그네슘 스테아레이트 및 광물유를 들 수 있다. 제제화 할 경우에는 보통 사용하는 충진제, 증량제, 결합제, 습윤제, 붕해제, 계면활성제 등의 희석제 또는 부형제를 사용하여 조제된다. 경구투여를 위한 고형제제에는 정제, 환제, 산제, 과립제, 캡슐제 등이 포함되며, 이러한 고형제제는 상기 폴리갈라 카렌시움 추출물 및 이로부터 분리된 잔톤계 화합물에 적어도 하나 이상의 부형제 예를 들면, 전분, 탄산칼슘, 수크로스 또는 락토오스, 젤라틴 등을 섞어 조제된다. 또한 단순한 부형제 이외에 마그네슘 스테아레이트, 탈크 같은 윤활제들도 사용된다. 경구를 위한 액상 제제로는 현탁제, 내용액제, 유제, 시럽제 등이 해당되는데 흔히 사용되는 단순 희석제인 물, 리퀴드 파라핀 이외에 여러 가지 부형제, 예를 들면 습윤제, 감미제, 방향제, 보존제 등이 포함될 수 있다. 비경구 투여를 위한 제제에는 멸균된 수용액, 비수성용제, 현탁제, 유제, 동결건조 제제, 좌제가 포함된다. 비수성용제, 현탁제로는 프로필렌글리콜, 폴리에틸렌 글리콜, 올리브 오일과 같은 식물성 기름, 에틸올레이트와 같은 주사 가능한 에스테르 등이 사용될 수 있다. 좌제의 기제로는 위텝솔(witepsol), 마크로골, 트윈(tween) 61, 카카오지, 라우린지, 글리세로제라틴 등이 사용될 수 있다. The pharmaceutical composition comprising the polygalal carenium extract according to the present invention and the xanthone-based compound isolated therefrom is orally prepared according to a conventional method such as powder, granule, tablet, capsule, suspension, emulsion, syrup, aerosol, and the like. It may be used in the form of a dosage form, an external preparation, a suppository, and a sterile injectable solution. Carriers, excipients and diluents that may be included in the composition comprising the polygala carenium extract and the xanthone-based compound isolated therefrom include lactose, dextrose, sucrose, sorbitol, mannitol, xylitol, erythritol, maltitol, Starch, acacia rubber, alginate, gelatin, calcium phosphate, calcium silicate, cellulose, methyl cellulose, microcrystalline cellulose, polyvinyl pyrrolidone, water, methylhydroxybenzoate, propylhydroxybenzoate, talc, magnesium stearate and Mineral oil. In the case of formulation, a diluent or excipient such as a filler, an extender, a binder, a wetting agent, a disintegrant, or a surfactant is usually used. Solid preparations for oral administration include tablets, pills, powders, granules, capsules, and the like, and such solid preparations include at least one excipient, for example, in the polygala carenium extract and the xanthone-based compound separated therefrom. Starch, calcium carbonate, sucrose or lactose, gelatin and the like are mixed and prepared. In addition to simple excipients, lubricants such as magnesium stearate and talc are also used. Oral liquid preparations include suspensions, solvents, emulsions, and syrups, and may include various excipients, such as wetting agents, sweeteners, fragrances, and preservatives, in addition to commonly used simple diluents such as water and liquid paraffin. . Formulations for parenteral administration include sterilized aqueous solutions, non-aqueous solutions, suspensions, emulsions, freeze-dried preparations, and suppositories. Examples of the suspending agent include propylene glycol, polyethylene glycol, vegetable oil such as olive oil, injectable ester such as ethyl oleate, and the like. Examples of suppository bases include witepsol, macrogol, tween 61, cacao butter, laurin, glycerogelatin, and the like.
상기 폴리갈라 카렌시움 추출물 및 이로부터 분리된 잔톤계 화합물의 투여량은 치료받을 대상의 연령, 성별, 체중과, 치료할 특정 질환 또는 병리 상태, 질환 또는 병리 상태의 심각도, 투여경로 및 처방자의 판단에 따라 달라질 것이다. 이러한 인자에 기초한 투여량 결정은 당업자의 수준 내에 있으며, 일반적으로 투여량은 0.01㎎/㎏/일 내지 대략 2000㎎/㎏/일의 범위이다. 더 바람직한 투여량은 0.1㎎/㎏/일 내지 500㎎/㎏/일이다. 투여는 하루에 한번 투여할 수도 있고, 수회 나누어 투여할 수도 있다. 상기 투여량은 어떠한 면으로든 본 발명의 범위를 한정하는 것은 아니다. 본 발명의 폴리갈라 카렌시움 추출물 및 이로부터 분리된 잔톤계 화합물은 쥐, 가축, 인간 등의 포유동물에 다양한 경로로 투여될 수 있다. 투여의 모든 방식은 예상될 수 있는데, 예를 들면, 경구, 직장 또는 정맥, 근육, 피하, 자궁내 경막 또는 뇌혈관내 주사에 의해 투여될 수 있다. 본 발명의 폴리갈라 카렌시움 추출물 및 이로부터 분리된 잔톤계 화합물은 독성 및 부작용은 거의 없으므로 예방 목적으로 장기간 복용시에도 안심하고 사용할 수 있는 약제이다. The dosage of the polygalar carenium extract and the xanthone-based compound isolated therefrom is determined by the age, sex and weight of the subject to be treated, the specific disease or pathology to be treated, the severity of the disease or pathology, the route of administration and the judgment of the prescriber. Will depend on. Dosage determinations based on these factors are within the level of ordinary skill in the art and generally the dosage ranges from 0.01 mg / kg / day to approximately 2000 mg / kg / day. A more preferable dosage is 0.1 mg / kg / day to 500 mg / kg / day. The administration may be carried out once a day or divided into several times. The dose is not intended to limit the scope of the invention in any way. Polygala carenium extract of the present invention and the xanthone-based compound isolated therefrom can be administered to mammals such as rats, livestock, humans and the like by various routes. All modes of administration may be expected, for example, by oral, rectal or intravenous, intramuscular, subcutaneous, intra-uterine dural or intracerebral injection. Polygala carenium extract of the present invention and the xanthone-based compound isolated therefrom is almost no toxicity and side effects, so it is a drug that can be used safely even for long-term administration for the purpose of prevention.
또한, 본 발명은 상기 폴리갈라 카렌시움 추출물 및 식품학적으로 허용 가능한 식품보조 첨가제가 포함된 감기, 조류 인플루엔자, 돼지 인플루엔자 및 신종플루 예방을 위한 건강기능식품을 제공한다. 본 발명의 건강기능식품은 정제, 캡슐제, 환제 또는 액제 등의 형태를 포함하며, 본 발명의 추출물을 첨가할 수 있는 식품으로는, 예를 들어, 각종 식품류, 음료, 껌, 차, 비타민 복합제, 건강기능성식품류 등이 있다. In addition, the present invention provides a dietary supplement for the prevention of cold, avian influenza, swine influenza and swine flu, including the polygala calenium extract and food supplements. The health functional food of the present invention includes forms such as tablets, capsules, pills, and liquids. Examples of the foods to which the extract of the present invention can be added include various foods, beverages, gums, tea, vitamins , And health functional foods.
한편, 본 발명은 상기 폴리갈라 카렌시움 추출물 및 이로부터 분리된 잔톤계 화합물을 함유하는 동물약품이나 사료 첨가제를 제공한다. 상기 동물약품이나 사료 첨가제는 동물과 인간에게서 공통적으로 발병하는 뉴라미니데이즈 관련 인수공통성 질환인 세균 감염에 의한 감염성 장염 등에도 사용가능하다. On the other hand, the present invention provides an animal drug or feed additive containing the polygala carenium extract and the xanthone-based compound separated therefrom. The animal drugs and feed additives can also be used for infectious enteritis caused by bacterial infection, which is a common common disease related to neuraminidase, which commonly occurs in animals and humans.
또한, 본 발명에서는 상기 폴리갈라 카렌시움 추출물 및 이로부터 분리된 잔톤계 화합물을 함유하는 천연소독제를 제공할 수도 있다. In addition, the present invention may provide a natural antiseptic agent containing the polygala carenium extract and a xanthone compound separated therefrom.
본 발명은 폴리갈라 카렌시움(Polygala karensium) 추출물 및 이로부터 분리된 잔톤계 화합물을 함유하는 감기, 조류 인플루엔자, 돼지 인플루엔자 또는 신종플루의 예방 또는 치료용 조성물에 관한 것이다. 상기 조성물은 상기 폴리갈라 카렌시움 추출물 및 이로부터 분리된 잔톤계 화합물은 조류 인플루엔자, 돼지 인플루엔자, 바이러스, 신종플루 바이러스, 타미플루 내성 신종플루 바이러스의 뉴라미니데이즈를 비선택적으로 저해하는 효과가 뛰어나 감기, 조류 인플루엔자, 돼지 인플루엔자, 신종플루 관련 질환의 치료제로 사용될 수 있으며, 화장품, 건강식품, 동물사료, 동물약품 산업 등에도 응용될 수 있다. The present invention relates to a composition for the prevention or treatment of cold, avian influenza, swine influenza or swine flu, containing Polygala karensium extract and xanthone-based compounds isolated therefrom. The composition of the polygala carenium extract and the xanthone-based compound isolated therefrom is excellent in the effect of non-selectively inhibiting the neuraminididae of avian influenza, swine influenza, virus, swine flu virus, Tamiflu-resistant swine flu virus Can be used as a treatment for avian influenza, swine influenza, swine flu-related diseases, and can be applied to cosmetics, health food, animal feed, animal medicine industry, and the like.
도 1은 폴리갈라 카렌시움으로부터 분리한 화합물 1~5를 분석한 HPLC 스펙트럼 결과를 나타낸다.
도 2는 본 발명의 화합물 1~5에 대한 조류 인플루엔자 바이러스, 돼지 인플루엔자 바이러스, 신종플루, 타미플루 내성 신종플루 바이러스의 인플루엔자의 뉴라미니데이즈 억제 활성을 확인한 결과를 나타낸다.
도 3A는 본 발명의 화합물 3이 비경쟁적 저해제로 H1N1의 뉴라미니데이즈를 저해함을 나타내는 Lineweaver Burk plots 그림이며, 도 3B는 Dixon plot 그림이다.
도 4는 세포병변효과 회복 어세이 결과를 나타내는 것으로서, 도 4A는 바이러스를 본 발명의 화합물 1~5가 5㎍/㎖로 처리된 MDCK 세포의 세포 생존률이 50% 내외로 회복되는 것을 나타내며, 도 4B는 본 발명의 화합물 3을 농도별로 MDCK 세포에 처리하였을 때의 세포 생존율을 나타내며, 도 4C는 돼지 인플루엔자 바이러스가 처리된 세포에 본 발명의 화합물 3을 5㎍/㎖로 처리했을 때 세포형태가 타미플루가 처리된 세포와 유사해지는 것을 나타낸다.FIG. 1 shows the HPLC spectral results obtained by analyzing
Figure 2 shows the results confirming the neuraminidase inhibitory activity of the influenza of avian influenza virus, swine influenza virus, swine flu, Tamiflu-resistant swine flu virus against the
FIG. 3A is a Lineweaver Burk plots plot showing that
4 shows the results of the cell lesion effect recovery assay, FIG. 4A shows that the virus survival of MDCK cells treated with 5 to 5 μg / ml of the
이하 본 발명의 바람직한 실시예를 상세히 설명하기로 한다. 그러나, 본 발명은 여기서 설명되는 실시예에 한정되지 않고 다른 형태로 구체화될 수도 있다. 오히려, 여기서 소개되는 내용이 철저하고 완전해질 수 있도록 그리고 당업자에게 본 발명의 사상을 충분히 전달하기 위해 제공하는 것이다. Hereinafter, preferred embodiments of the present invention will be described in detail. However, the present invention is not limited to the embodiments described herein but may be embodied in other forms. Rather, these embodiments are provided so that this disclosure will be thorough and complete, and will fully convey the concept of the invention to those skilled in the art.
<실시예 1 : 폴리갈라 카렌시움으로부터 활성 화합물의 용매 추출조건 확인> <Example 1: Confirmation of Solvent Extraction Conditions of Active Compounds from Polygalar Carencium>
폴리갈라 카렌시움은 2010년 베트남의 라오까이(Lao Cai) 주에서 채취하였으며, 폴리갈라 카렌시움의 뿌리를 건조한 후, 상기 건조된 뿌리를 본 발명에 이용하였다. 상기 폴리갈라 카렌시움의 뿌리 건조물 10g을 증류수, 에탄올, 메탄올, 아세톤, 에틸아세테이트, 클로로포름 등의 용매 50㎖을 사용하여 4시간 동안 3회에 걸쳐 환류 추출하였다. 이 후, 고형분을 제거한 추출액을 감압 농축하여 각 추출물 당 0.7~1.5g의 추출물을 얻었다(단, 물 추출물은 90℃에서 8시간 추출한 후 여액을 동결건조함). 그리고, 실시예 4-2의 돼지 인플루엔자 바이러스 배양액과 실시예 6의 방법을 이용하여 각각의 추출물(최종농도 20㎍/㎖)의 뉴라미니데이즈에 대한 활성을 확인하였고 이에 대한 결과는 표 1에 나타내었다. 표 1의 결과를 참고하면, 폴리갈라 카렌시움의 추출액은 모든 조건에서 그 활성이 모두 좋았으나, 메탄올 또는 에탄올 추출물의 활성이 가장 높아 이를 최적 추출조건으로 설정하였다. Polygala Karensium was collected in Lao Cai province, Vietnam in 2010. After drying the roots of Polygala Karensium, the dried roots were used in the present invention. 10 g of the root dry matter of the polygalar carenium was refluxed three times for 4 hours using 50 ml of a solvent such as distilled water, ethanol, methanol, acetone, ethyl acetate, chloroform, and the like. Thereafter, the extract was removed under reduced pressure, and the extract was concentrated under reduced pressure to obtain 0.7-1.5 g of extract per extract (however, the water extract was extracted at 90 ° C. for 8 hours and then the filtrate was lyophilized). In addition, the activity of each extract (final concentration of 20 µg / ml) against neuraminidase was confirmed using the swine influenza virus culture solution of Example 4-2 and the method of Example 6, and the results are shown in Table 1 below. It was. Referring to the results of Table 1, the extract of Polygala carensium was good activity under all conditions, but the activity of the methanol or ethanol extract was the highest and set this as the optimum extraction conditions.
조건 (20㎍/㎖)
Condition (20 µg / ml)
뉴라미니데이즈에 대한 저해활성 Of swine influenza virus (H1N1) compared to untreated group
Inhibitory Activity against Neuraminidase
<< 실시예Example 2 : 2 : 폴리갈라Poligala 카렌시움Karensium 추출물로부터 From the extract 잔톤계Xanthone 화합물의 분리> Separation of compounds >
폴리갈라 카렌시움의 건조된 뿌리 2kg에 메탄올 4ℓ를 가하여 실온에서 추출하였으며, 이 과정을 총 3회 수행하였다. 상기 추출물은 감압농축하여 건조물로 제조하였고, 건조된 메탄올 추출물(230.0g)을 2ℓ의 물에 현탁시킨 후, 각각 1.5ℓ씩의 n-헥산, 에틸아세테이트, n-부탄올로 순차적으로 분획하였다. 각각의 분획단계는 3번 반복하였다. 4 kg of methanol was added to 2 kg of dried roots of polygalar carenium and extracted at room temperature. This process was performed a total of three times. The extract was concentrated under reduced pressure to prepare a dried product. The dried methanol extract (230.0 g) was suspended in 2 L of water, and each fraction was sequentially partitioned into 1.5 L of n-hexane, ethyl acetate, and n-butanol. Each fractionation step was repeated three times.
각각의 용매분획에 대하여 조류 인플루엔자 바이러스, 돼지 인플루엔자 바이러스 및 타미플루 내성 신종플루 바이러스의 뉴라미니데이즈 활성을 측정한 결과, 에틸 아세테이트 분획물 및 부탄올 분획물의 활성이 좋았으며 그 중 에틸 아세테이트 분획물이 보다 강한 활성(IC50=38.24±2.78㎍/㎖)을 나타내었다. 뉴라미니데이즈 활성은 실시예 4-2의 돼지 인플루엔자 바이러스 배양액을 이용하여 실시예 6의 방법을 통해 확인하였다. The neuraminidase activity of the avian influenza virus, the swine influenza virus, and the Tamiflu-resistant swine flu virus were measured for each solvent fraction, and the ethyl acetate fraction and butanol fraction showed better activity. IC 50 = 38.24 ± 2.78 μg / ml). Neuraminidase activity was confirmed by the method of Example 6 using the swine influenza virus culture of Example 4-2.
상기 에틸아세테이트 분획물(46.0g)은 TLC 기반의 실리카겔 컬럼(10×25cm; 63200μm particle size)으로 크로마토그래피(n-hexane/EtOAc 9:1→1:9[각 2.5ℓ]의 농도 구배로 용출)를 하여 6개의 소분획물(F1~F6)을 얻었다. 이 중에서 다시 돼지 인플루엔자 바이러스의 뉴라미니데이즈에 대한 억제 활성이 좋은 F2(5.2g), F4(4.8g), F5(6.7g)에 대해 추가적인 분획을 수행하였다. F2 소분획물은 RP-18 컬럼(5×30cm; 4063μm particle size) 및 MeOH/H2O(3:1→10:1) 농도 구배 용출 조건을 이용하여 6개의 소분획물(F2.1F2.6)을 얻었으며, 이 중에서 F2.3(120㎎) 소분획물을 HPLC[Optima Pak C18 column (10×250㎜, 10μm particle size, RS Tech, Korea); mobile phase MeOH in H2O containing 0.1% HCO2H (065min: 64% MeOH, 6570min: 64100% MeOH, 7080min: 100% MeOH); flow rate 2㎖/min; UV detection at 205 and 254nm]를 이용하여 화합물 1(tR=45.5min, 5.5㎎)을 분리하였다. The ethyl acetate fraction (46.0 g) was chromatographed on a TLC-based silica gel column (10 × 25 cm; 63200 μm particle size) and eluted with a concentration gradient of n-hexane / EtOAc 9: 1 → 1: 9 [2.5 L]. 6 small fractions (F1 to F6) were obtained. Among them, additional fractions were performed for F2 (5.2 g), F4 (4.8 g) and F5 (6.7 g) which have good inhibitory activity against neuraminidase of swine influenza virus. F2 subfractions were divided into 6 subfractions (F2.1F2.6) using RP-18 column (5 × 30 cm; 4063 μm particle size) and MeOH / H 2 O (3: 1 → 10: 1) gradient elution conditions. Among them, the F2.3 (120 mg) subfraction was purified by HPLC [Optima Pak C18 column (10 × 250 mm, 10 μm particle size, RS Tech, Korea); mobile phase MeOH in H 2 O containing 0.1% HCO 2 H (065 min: 64% MeOH, 6570 min: 64100% MeOH, 7080 min: 100% MeOH); flow
소분획물 F2.4(560㎎)에서는 Sephadex LH-20 컬럼(4×25cm) 및 메탄올을 이용한 용출 조건을 이용하여 화합물 2(145.0㎎)를 분리하였다.In small fraction F2.4 (560 mg), Compound 2 (145.0 mg) was isolated using a Sephadex LH-20 column (4 × 25 cm) and elution conditions with methanol.
소분획물 F4에서는 RP-18 컬럼(5×30cm; 4063μm particle size) 및 MeOH/H2O(1:1→10:1)의 농도 구배 용출 조건을 이용하여 7개의 소분획물을 얻었다(F4.1F4.7). 이 중 F4.4 소분획물(160.0㎎)을 HPLC(055 min: 50% MeOH, 60 min: 100% MeOH)을 수행하여 화합물 3(tR = 51.0min, 22.0㎎)을 분리하였다. 소분획물 F5를 Sephadex LH-20 컬럼(7×30cm) 및 메탄올 용출 조건을 이용하여 4개의 소분획물(F5.1F5.4)을 얻었고, 이 중에서 F5.2 소분획물(180.0㎎)에서 HPLC (045min: 45% MeOH, 50min: 100% MeOH)를 이용하여 화합물 4(tR = 43.0 min, 11.0㎎)를 분리하였다. 소분획물 F5.3(160.0㎎)에서 다시 HPLC(055min: 66% MeOH, 60min: 100% MeOH)를 수행하여 화합물 5(tR = 50.0min, 8.5㎎)를 분리하였다. 상기 화합물 1~5에 대한 HPLC 스펙트럼 결과는 도 1과 같다. In small fraction F4, seven small fractions were obtained using RP-18 column (5 × 30 cm; 4063 μm particle size) and concentration gradient elution conditions of MeOH / H 2 O (1: 1 → 10: 1) (F4.1F4 .7). F4.4 small fraction (160.0 mg) was purified by HPLC (055 min: 50% MeOH, 60 min: 100% MeOH) to separate compound 3 (tR = 51.0 min, 22.0 mg). Small fraction F5 was obtained from four fractions (F5.1F5.4) using a Sephadex LH-20 column (7 × 30 cm) and methanol elution conditions, of which HPLC (045 min) was performed on F5.2 small fraction (180.0 mg). : 45% MeOH, 50min: 100% MeOH) was used to separate compound 4 (tR = 43.0 min, 11.0 mg). Compound 5 (tR = 50.0 min, 8.5 mg) was isolated by HPLC (055 min: 66% MeOH, 60 min: 100% MeOH) again in small fraction F5.3 (160.0 mg). HPLC spectra of the
* 도 1의 HPLC 조건* HPLC conditions of FIG. 1
YMCC18 column : 250×4.6mm ID, particle size 6μm, Japan YMCC18 column: 250 × 4.6mm ID, particle size 6μm, Japan
wavelengths : 205nm(blue line), 254nm(red line)wavelengths: 205 nm (blue line), 254 nm (red line)
Elution : MeOH in H2O (040min : 50% MeOH; 4045min : 50100% MeOH; 4555min : 100% MeOH) at flow rate of 1㎖/minElution: MeOH in H 2 O (040min: 50% MeOH; 4045min: 50100% MeOH; 4555min: 100% MeOH) at flow rate of 1ml / min
<< 실시예Example 3 : 3: 잔톤계Xanthone 화합물의 물리 화학적 특성 및 화학구조 분석> Physical and chemical properties and chemical structure analysis of compounds>
실시예Example 3-1. 1,3- 3-1. 1,3- 다이하이드록시잔톤Dihydroxyxanthone (화합물 1) (Compound 1)
1,3-dihydroxyxanthone, yellow needles, mp 259260℃1,3-dihydroxyxanthone, yellow needles, mp 259260 ℃
UV (MeOH) λ max 238, 325nmUV (MeOH) λ max 238, 325 nm
EIMS m/z 228[M]+ EIMS m / z 228 [M] +
1H-NMR (500MHz, acetone-d 6) δ H 12.90 (s, OH-1), 8.20 (1H, d, J=8.5Hz, H-8), 7.84 (1H, t, J=8.0Hz, H-6), 7.53 (1H, d, J=8.5Hz, H-5), 7.46 (1H, t, J=8.0Hz, H-7), 6.44 (1H, s, H-4), 6.27 (1H, s, H-2) 1 H-NMR (500 MHz, acetone- d 6 ) δ H 12.90 (s, OH-1), 8.20 (1H, d, J = 8.5 Hz, H-8), 7.84 (1H, t, J = 8.0 Hz, H-6), 7.53 (1H, d, J = 8.5 Hz, H-5), 7.46 (1H, t, J = 8.0 Hz, H-7), 6.44 (1H, s, H-4), 6.27 ( 1H, s, H-2)
13C-NMR (125MHz, acetone-d 6)δ C 181.4 (C-9), 166.6 (C-3), 164.8 (C-1), 158.9 (C-4a), 156.9 (C-10a), 136.4 (C-6), 126.4 (C-7), 125.2 (C-8), 120.5 (C-8a), 118.6 (C-5), 103.9 (C-9a), 99.1 (C-2), 94.9 (C-4). 13 C-NMR (125 MHz, acetone- d 6 ) δ C 181.4 (C-9), 166.6 (C-3), 164.8 (C-1), 158.9 (C-4a), 156.9 (C-10a), 136.4 (C-6), 126.4 (C-7), 125.2 (C-8), 120.5 (C-8a), 118.6 (C-5), 103.9 (C-9a), 99.1 (C-2), 94.9 ( C-4).
실시예Example 3-2. 1,7- 3-2. 1,7- 다이하이드록시잔톤Dihydroxyxanthone (화합물 2) (Compound 2)
1,7-dihydroxyxanthone, yellow needles, mp 195-196℃1,7-dihydroxyxanthone, yellow needles, mp 195-196 ℃
UV (MeOH) λ max 232, 309nm UV (MeOH) λ max 232, 309 nm
EIMS m/z 228[M]+ EIMS m / z 228 [M] +
1H-NMR (500MHz, acetone-d 6) δ H 12.71 (s, OH-1), 7.68 (1H, t, J=8.5Hz, H-3), 7.58 (1H, d, J=2.5Hz, H-8), 7.50 (1H, d, J=8.5Hz, H-5), 7.40 (1H, dd, J=8.5, 2.5Hz, H-6), 6.97 (1H, d, J=8.5Hz, H-4), 6.74 (1H, d, J=8.5Hz, H-2) 1 H-NMR (500 MHz, acetone- d 6 ) δ H 12.71 (s, OH-1), 7.68 (1H, t, J = 8.5 Hz, H-3), 7.58 (1H, d, J = 2.5 Hz, H-8), 7.50 (1H, d, J = 8.5 Hz, H-5), 7.40 (1H, dd, J = 8.5, 2.5 Hz, H-6), 6.97 (1H, d, J = 8.5 Hz, H-4), 6.74 (1H, d, J = 8.5 Hz, H-2)
13C-NMR (125MHz, acetone-d 6) δ C 182.9 (C-9), 162.7 (C-1), 157.3 (C-4a), 154.9 (C-7), 151.0 (C-10a), 126.1 (C-6), 121.8 (C-8), 120.2 (C-5), 110.5 (C-2), 109.1 (C-8a, C-9a), 107.8 (C-4) 13 C-NMR (125 MHz, acetone- d 6 ) δ C 182.9 (C-9), 162.7 (C-1), 157.3 (C-4a), 154.9 (C-7), 151.0 (C-10a), 126.1 (C-6), 121.8 (C-8), 120.2 (C-5), 110.5 (C-2), 109.1 (C-8a, C-9a), 107.8 (C-4)
실시예Example 3-3. 1,7- 3-3. 1,7- 다이하이드록시Dihydroxy -4--4- 메톡시잔톤Methoxyxanthone (화합물 3) (Compound 3)
1,7-dihydroxy-4-methoxyxanthone, yellow needles, mp 239-240℃1,7-dihydroxy-4-methoxyxanthone, yellow needles, mp 239-240 ° C
UV (MeOH) λ max 236, 324nmUV (MeOH) λ max 236, 324 nm
EIMS m/z 258 [M]+ EIMS m / z 258 [M] +
1H-NMR (500MHz, acetone-d 6) δ H 12.11 (s, OH-1), 7.58 (1H, s, H-8), 7.56 (1H, d, J=8.5Hz, H-5), 7.42 (2H, d, J=8.5Hz, H-3, H-6), 6.68 (1H, d, J=8.5Hz, H-2), 3.95 (3H, s, OCH3-4) 1 H-NMR (500 MHz, acetone- d 6 ) δ H 12.11 (s, OH-1), 7.58 (1H, s, H-8), 7.56 (1H, d, J = 8.5 Hz, H-5), 7.42 (2H, d, J = 8.5 Hz, H-3, H-6), 6.68 (1H, d, J = 8.5 Hz, H-2), 3.95 (3H, s, OCH 3 -4)
13C-NMR (125MHz, acetone-d 6) δ C 182.9 (C-9), 155.4 (C-1), 155.2 (C-7), 151.0 (C-10a), 149.0 (C-4a), 141.2 (C-4), 126.3 (C-6), 121.9 (C-8a), 121.2 (C-3), 120.5 (C-5), 109.7 (C-9a), 109.1 (C-8), 108.8 (C-2) 13 C-NMR (125 MHz, acetone- d 6 ) δ C 182.9 (C-9), 155.4 (C-1), 155.2 (C-7), 151.0 (C-10a), 149.0 (C-4a), 141.2 (C-4), 126.3 (C-6), 121.9 (C-8a), 121.2 (C-3), 120.5 (C-5), 109.7 (C-9a), 109.1 (C-8), 108.8 ( C-2)
실시예Example 3-4. 1,3,7- 3-4. 1,3,7- 트라이하이드록시잔톤Trihydroxyxanthone (화합물 4) (Compound 4)
1,3,7-trihydroxyxanthone, yellow needles, mp 298-299℃1,3,7-trihydroxyxanthone, yellow needles, mp 298-299 ℃
UV (MeOH) λ max 233, 308nmUV (MeOH) λ max 233, 308 nm
EIMS m/z 244[M]+ EIMS m / z 244 [M] +
1H-NMR (500MHz, acetone-d 6) δ H 12.98 (s, OH-1), 7.56 (1H, d, J=2.5Hz, H-8), 7.42 (1H, d, J=8.5Hz, H-5), 7.36 (1H, dd, J=8.5, 2.5Hz, H-6), 6.49 (1H, s, H-4), 6.25 (1H, s, H-2) 1 H-NMR (500 MHz, acetone- d 6 ) δ H 12.98 (s, OH-1), 7.56 (1H, d, J = 2.5 Hz, H-8), 7.42 (1H, d, J = 8.5 Hz, H-5), 7.36 (1H, dd, J = 8.5, 2.5Hz, H-6), 6.49 (1H, s, H-4), 6.25 (1H, s, H-2)
13C-NMR (125MHz, acetone-d 6) δ C 181.3 (C-9), 166.4 (C-3), 164.7 (C-1), 159.1 (C-4a), 154.9 (C-7), 150.8 (C-10a), 125.1 (C-6), 121.9 (C-8), 120.0 (C-5), 109.4 (C-8a), 103.6 (C-9a), 98.8 (C-2), 94.6 (C-4) 13 C-NMR (125 MHz, acetone- d 6 ) δ C 181.3 (C-9), 166.4 (C-3), 164.7 (C-1), 159.1 (C-4a), 154.9 (C-7), 150.8 (C-10a), 125.1 (C-6), 121.9 (C-8), 120.0 (C-5), 109.4 (C-8a), 103.6 (C-9a), 98.8 (C-2), 94.6 ( C-4)
실시예Example 3-5. 1,2,3,5- 3-5. 1,2,3,5- 테트라하이드록시잔톤Tetrahydroxyxanthone (화합물 5) (Compound 5)
1,2,3,5-tetrahydroxyxanthone, yellow needles, mp 264-265℃ 1,2,3,5-tetrahydroxyxanthone, yellow needles, mp 264-265 ℃
UV (MeOH) λ max 250, 325nmUV (MeOH)
EIMS m/z 260[M]+ EIMS m / z 260 [M] +
1H-NMR (500MHz, acetone-d 6) δ H : 12.98 (s, OH-1), 7.56 (1H, m, H-7), 7.43 (1H, m, H-8), 7.40 (1H, m, H-6), 6.26 (1H, s, H-4) 1 H-NMR (500 MHz, acetone- d 6 ) δ H : 12.98 (s, OH-1), 7.56 (1H, m, H-7), 7.43 (1H, m, H-8), 7.40 (1H, m, H-6), 6.26 (1H, s, H-4)
13C-NMR (125MHz, acetone-d 6) δ C : 181.2 (C-9), 152.5 (C-3), 152.0 (C-4a), 150.2 (C-1), 149.2 (C-5), 148.4 (C-10a), 136.3 (C-2), 122.5 (C-7), 120.1 (C-8a), 119.1 (C-6), 118.3 (C-8), 102.9 (C-9a), 99.5 (C-4). 13 C-NMR (125 MHz, acetone- d 6 ) δ C : 181.2 (C-9), 152.5 (C-3), 152.0 (C-4a), 150.2 (C-1), 149.2 (C-5), 148.4 (C-10a), 136.3 (C-2), 122.5 (C-7), 120.1 (C-8a), 119.1 (C-6), 118.3 (C-8), 102.9 (C-9a), 99.5 (C-4).
<< 실시예Example 4 : 인플루엔자 바이러스의 준비> 4: Preparation of influenza virus
4-1. 조류 인플루엔자(H9N2) 바이러스 4-1. Avian Influenza (H9N2) Virus
실험에 사용한 조류 인플루엔자 바이러스는 저병원성 조류 인플루엔자 바이러스인 A/chicken/Korea/01310/2001(H9N2)를 사용하였다. 이것을 10일령의 SPF(Specific-Pathogen Free) 수정란의 요막강(Allantoic Cavity)에 접종하고 2일 후 채독하여 바이러스를 신장 세포에 속하는 MDCK(Madin-Darby canine kidney)에 접종하여 5일간 배양하여 원심분리 후 상등액층의 배양액을 H9N2 기원의 바이러스 뉴라미니데이즈의 활성 측정에 사용하였다. The avian influenza virus used in the experiment was a low-pathogenic avian influenza virus A / chicken / Korea / 01310/2001 (H9N2). This was inoculated into the 10-day-old SPF (Specific-Pathogen Free) fertilized egg Allantoic Cavity, and 2 days later, the virus was inoculated into MDCK (Madin-Darby canine kidney) belonging to kidney cells and incubated for 5 days, followed by centrifugation. The culture of the supernatant layer was then used to measure the activity of viral neuraminidase of H9N2 origin.
4-2. 돼지 인플루엔자(H1N1) 바이러스 (WT H1N1) 4-2. Swine Influenza (H1N1) Virus (WT H1N1)
실험에 사용한 돼지 인플루엔자 바이러스는 중앙백신연구소의 돼지 인플루엔자 바이러스인 A/Sw/Kor/CAN1/04(H1N1, KCTC 11165BP)를 사용하였다. 이 바이러스를 10일령의 Specific-Pathogen Free(SPF) Egg 요막강(Allantoic Cavity)에 접종하고 2일 후 채독하여 씨드 바이러스(seed virus)를 증식시켰다. 이후 배양된 씨드 바이러스를 SPF 달걀의 요막강에 재접종하여 바이러스 배양액을 얻은 후 H1N1 기원의 바이러스 뉴라미니데이즈의 활성 측정에 사용하였다.The swine influenza virus used in the experiment was A / Sw / Kor / CAN1 / 04 (H1N1, KCTC 11165BP), a swine influenza virus from the Central Vaccine Institute. The virus was inoculated into 10-day-old Specific-Pathogen Free (SPF) Egg Allantoic Cavity and harvested 2 days later to propagate the seed virus. The cultured seed virus was then reinoculated into the lumen cavity of SPF eggs to obtain a virus culture, and then used to measure the activity of viral neuraminidase of H1N1 origin.
<< 실시예Example 5 : 5: 뉴라미니데이즈Neuraminidays 클로닝Cloning >>
신종플루 바이러스는 전염성이 강하고 감염될 경우에는 질환으로 사망할 가능성이 높기 때문에 일차적으로 신종플루 바이러스 자체를 이용하여 효과가 있는 활성물질을 검색하고 확인하기보다는 신약의 표적이 되는 신종플루 바이러스의 뉴라미니데이즈만을 동물 세포주에서 발현시켜서 신약 후보 물질의 활성을 검증하는 방법을 사용하였다. 신종플루 바이러스의 뉴라미니데이즈 유전자서열을 NCBI의 유전자은행으로부터 확인하여 신종플루 바이러스의 뉴라미니데이즈를 클로닝(cloning)하였으며, 타미플루에 내성을 가지는 신종플루 바이러스의 뉴라미니데이즈 점 돌연변이체를 인위적으로 제작하여 천연물의 활성 탐색에 사용하였다. 이하 클로닝에 사용된 각 염기서열은 다음과 같다. The H1N1 virus is highly contagious and is highly likely to die of disease if infected. Therefore, the H1N1 virus is primarily used as a target for new drugs rather than identifying and identifying active substances that are effective. Only Days was expressed in animal cell lines to validate the activity of drug candidates. The neuraminidase gene sequence of the H1N1 virus was confirmed from the NCBI gene bank, and cloned the neuraminidity of the H1N1 virus, and artificially produced a neuraminidism point mutant of the H1N1 virus was resistant to Tamiflu. Was used to explore the activity of natural products. Hereinafter, each base sequence used for cloning is as follows.
* 사용된 신종플루 뉴라미니데이즈 펩타이드 서열 *Swine Flu Neuraminidase Peptide Sequences Used
5-1. 신종플루(H1N1) 바이러스의 뉴라미니데이즈 펩타이드 서열5-1. Neuraminidase Peptide Sequences of Swine Flu (H1N1) Virus
MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSNRPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDKMNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNYHYEECSCYPDSSEITCVCRDNWHGSNRPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
5-2. 타미플루에 내성을 가지는 신종플루 바이러스의 뉴라미니데이즈 펩타이드5-2. Neuraminidase Peptide of Swine Flu Virus Resistant to Tamiflu
밑줄친 부분이 점돌연변이에 의해서 바뀌는 부분임 (H → Y)Underlined part is changed by point mutation (H → Y)
MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNY Y YEECSCYPDSSEITCVCRDNWHGSNRPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK MNPNQKIITIGSVCMTIGMANLILQIGNIISIWISHSIQLGNQNQIETCNQSVITYENNTWVNQTYVNISNTNFAAGQSVVSVKLAGNSSLCPVSGWAIYSKDNSVRIGSKGDVFVIREPFISCSPLECRTFFLTQGALLNDKHSNGTIKDRSPYRTLMSCPIGEVPSPYNSRFESVAWSASACHDGINWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQASYKIFRIEKGKIVKSVEMNAPNY Y YEECSCYPDSSEITCVCRDNWHGSNRPWVSFNQNLEYQIGYICSGIFGDNPRPNDKTGSCGPVSSNGANGVKGFSFKYGNGVWIGRTKSISSRNGFEMIWDPNGWTGTDNNFSIKQDIVGINEWSGYSGSFVQHPELTGLDCIRPCFWVELIRGRPKENTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK
상기의 서열로 각각의 유전자를 클로닝 한 후 신종플루 바이러스의 뉴라미니데이즈에 해당하는 유전자를 PCR 증폭 방법을 이용하였고, 증폭된 산물은 인비트로젠(Invitrogen)사의 pcDNA3.1/V5-His Topo 벡터에 클로닝하였다. 클로닝의 확인은 제한효소 절단(restriction enzyme cutting)을 통해서 일차적으로 확인하고, 염기서열 분석법(DNA sequencing)을 통해서 최종 확인하였다. 또한, 타미플루에 내성을 가지는 뉴라미니데이즈를 문헌조사를 통해 중간의 히스티딘(Histidine) 아미노산을 티로신(Tyrosine)으로 치환함으로써 획득하였다. 사용한 방법은 PCR을 이용하는 퀵체인지(Quick change) 방법을 이용하였다. 이 방법은 치환하려고 하는 부분에 해당하는 올리고뉴클레오타이드(oligonucleotide)를 제작한 후, PCR 효소를 사용하여 플라스미드를 시험관 내에서 증폭시켰으며, 기존의 염기서열을 가진 플라스미드를 제거하기 위해서 메틸레이션(methylation)되어 있는 플라스미드만 절단하는 DpnI 효소를 처리하였다. 돌연변이가 일어난 플라스미드는 박테리아에서 증폭하였으며, 염기서열 분석법(DNA sequencing)을 통해서 아미노산 치환을 최종 확인하여 실험에 사용하였다.After cloning each gene with the above sequence, a PCR amplification method was performed on the gene corresponding to the neuraminidase of the H1N1 virus, and the amplified product was pcDNA3.1 / V5-His Topo vector of Invitrogen. Cloned into. Cloning was confirmed primarily through restriction enzyme cutting and finally confirmed by DNA sequencing. In addition, Neuraminidase resistant to Tamiflu was obtained by substituting the histidine amino acid with Tyrosine in the literature. The method used was a quick change method using PCR. This method produced an oligonucleotide corresponding to the portion to be replaced, and then amplified the plasmid in vitro using a PCR enzyme, and methylation to remove the plasmid having the existing sequence DpnI enzyme that cleaves only the plasmids was treated. The mutated plasmid was amplified in bacteria and used for the experiment by finally confirming amino acid substitution through DNA sequencing.
<< 실시예Example 6 : 6: 뉴라미니데이즈의Of neuraminidays 활성 측정> Active measurement>
뉴라미니데이즈 활성은 정확한 저해율을 측정하기 위하여 메이어(Myers) 등이 고안한 방법을 변경하여 사용하였다. 각각의 뉴라미니데이즈에 0.04M sodium acetate 완충액(pH 5.0) 20㎕와 0.04mM 4-methylumbelliferyl-α-D-N-acetylneuraminic acid(Sigma M8639) 80㎕ 및 각각의 화합물 1㎕을 혼합하여 10분간 반응시킨 후 0.1M glycine-NaOH 완충액 100㎕을 첨가하여 반응을 중지시킨 후 형광광도계를 이용하여 360nm/440nm에서의 형광차이를 이용하여 활성을 측정하였다. 이 때 타미플루, 화합물이나 각각의 용매 및 분획 추출물은 세포에 미리 처리하거나 바이러스를 배양할 때 같이 투여되어 활성억제가 되도록 하였다. 또한, 시료의 발광도를 보정하기 위하여 측정 발광도를 A, 시료를 녹인 용매의 발광도를 C, 시료 혼합액의 발광도를 B로 하여 저해율을 계산하였다.The neuraminidase activity was used by modifying the method devised by Myers et al. In order to measure the exact inhibition rate. 20 μl of 0.04 M sodium acetate buffer (pH 5.0), 80 μl of 0.04 mM 4-methylumbelliferyl-α-DN-acetylneuraminic acid (Sigma M8639) and 1 μl of each compound were mixed in each neuraminidase for 10 minutes. After the reaction was stopped by adding 100 μl of 0.1 M glycine-NaOH buffer, the activity was measured using a fluorescence spectrophotometer at 360 nm / 440 nm. At this time, Tamiflu, a compound or each solvent and fraction extract was pre-treated in the cell or administered together when culturing the virus so as to inhibit the activity. In addition, in order to correct the luminescence of the sample, the inhibition rate was calculated using A as the measured luminescence, C as the luminescence of the solvent in which the sample was dissolved, and B as the luminescence of the sample mixture.
저해율 : [{C-(A-B)/C}]×100Inhibition rate: [{C- (A-B) / C}] × 100
상기 결과는 표 2 및 도 2에 나타내었다. The results are shown in Table 2 and FIG.
조건
Condition
돼지 인플루엔자 (H1N1)
Swine Influenza (H1N1)
조류 인플루엔자 (H9N2)
Avian Influenza (H9N2)
신종플루
(novel H1N1)
Swine flu
(novel H1N1)
내성 신종플루
(H1N1 H274Y)Tamiflu
Resistant swine flu
(H1N1 H274Y)
표 2 및 도 2의 결과를 확인하면, 본 발명의 폴리갈라 카렌시움 추출물 및 이로부터 분리된 잔톤계 화합물 1~5가 조류 인플루엔자 바이러스, 돼지 인플루엔자 바이러스, 신종플루, 타미플루 내성 신종플루 바이러스의 인플루엔자에 대한 뉴라미니데이즈 억제 활성이 뛰어남을 알 수 있었다.When confirming the results of Table 2 and Figure 2, the polygala carenium extract of the present invention and xanthone-based
한편, 화합물의 Kinetic 연구를 위하여 4-methoxyumbelliferone의 농도를 반응을 중지시키기 위하여 넣는 0.1M glycine-NaOH buffer를 첨가하기 전에 측정되었으며, Sigmaplot 11.0(SPCC Inc., Chicago, IL)에서 계산하였고, 효소의 가역반응을 측정하기 위하여, 효소와 저해물질이 들어간 반응액을 희석하는 방법을 사용하여 측정하였다. 이에 대한 결과는 도 3에 나타내었는데, 상기 도 3을 통해 본 발명의 화합물 3이 비경쟁적 저해제로 돼지 인플루엔자 바이러스의 뉴라미니데이즈를 저해함을 확인할 수 있었다(도 3A의 Lineweaver Burk plots 및 도 3B Dixon plot 참조). Meanwhile, the concentration of 4-methoxyumbelliferone was measured before adding 0.1M glycine-NaOH buffer to stop the reaction for the kinetic study of the compound, and calculated in Sigmaplot 11.0 (SPCC Inc., Chicago, IL). In order to measure the reversible reaction, it was measured by diluting the reaction solution containing the enzyme and the inhibitor. The results are shown in FIG. 3, and it was confirmed that
<< 실시예Example 7: 7: 세포병변효과Cytopathic effect 회복 recovery 어세이Assay > >
MDCK(Madin-Darby, canine kidney) 세포에 돼지 인플루엔자 바이러스(A/Sw/Kor/CAN1/04(H1N1, KCTC 11165BP)를 감염시킨 후, 바이러스에 의한 세포병변이 처리한 화합물에 의하여 저해되는 정도(세포의 회복되는 정도)를 평가하는 세포병변효과 회복 어세이(cytopathic effect reduction assay, CPE reduction assay)를 수행하였다. CPE는 바이러스 감염으로 인한 세포 모양의 변화(morphological change)를 나타내며, 세포 모양의 퇴행성 변화는 바이러스들의 감염과 관련이 있다(Semin. Neurol., 1999, 19, 113~127 ; J. Virol. Methods, 2002, 106, 71~79). After infection with porcine influenza virus (A / Sw / Kor / CAN1 / 04 (H1N1, KCTC 11165BP) in MDCK (Madin-Darby, canine kidney) cells, the degree of inhibition by virus-treated cell lesions ( Cytopathic effect reduction assay (CPE reduction assay) was performed to evaluate the degree of recovery of the cells (CPE), which shows the morphological changes caused by viral infection and the degeneration of the cell shape. Changes are associated with infection of viruses (Semin. Neurol., 1999, 19, 113-127; J. Virol. Methods, 2002, 106, 71-79).
이를 위해, 우선 96-웰(well) 플레이트에 1×10⁴세포/웰의 밀도로 MDCK 세포를 분주하여 5% FBS(fetal bovine serum), 1% PS(penicillin+streptomycin) 및 L-글루타민(L-glutamine, 500㎖ 배지 기준 2㎖ 첨가)를 포함한 DMEM 배양액에서 하루 동안 증식시킨 뒤 배양액을 PBS(phosphate buffer saline) 용액으로 세척하였다. 이후, 감염 배지(infection media:DMEM+0.5% BSA+1㎍/㎖ trypsin)에 돼지 인플루엔자 바이러스를 50 TCID50/100㎕/well의 농도로 100㎕를 접종한 후 화합물 1~5를 처리하고, 3~5일간 추가적으로 배양하여 바이러스에 의한 세포독성을 측정하였다. To this end, first, MDCK cells were dispensed in a 96-well plate at a density of 1 × 10 cells / well to give 5% fetal bovine serum (FBS), 1% penicillin + streptomycin (PS) and L-glutamine (L-). After a day of growth in DMEM culture medium containing glutamine, 2 ml of 500 ml medium), the culture was washed with PBS (phosphate buffer saline) solution. Then, the infection medium: handle (infection media DMEM + 0.5% BSA + 1㎍ / ㎖ trypsin) swine influenza virus, the
CPE 효과 측정을 위해서는, 배양한지 5일이 지난 후 MDCK 세포의 생존여부를 측정하기 위하여 MTT 실험을 실시하였다. MTT(3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide, Sigma M-2128 1G)) 시약은 담황색의 기질로서, 살아 있는 세포의 미토콘드리아 내의 호흡 효소에 의해 개열하여 암청색의 포마잔(formazan)을 생성한다. 바이러스의 감염에 의하여 죽은 MDCK 세포나 물질 자체의 세포독성 때문에 죽은 세포에서는 MTT 반응이 일어나지 않는다. 따라서 물질자체의 세포독성과 바이러스에 의한 세포독성을 생성한 포마잔을 550nm의 흡광도에서 각각 측정하는 방법을 이용하여 화합물의 효능을 평가하였다. 즉 화합물에 의한 MDCK 세포독성이 없는 화합물의 농도를 구하고, 감염된 돼지 인플루엔자 바이러스에 의한 MDCK 세포의 변성차이를 측정하여, 화합물의 농도에 따른 CPE 효과를 확인하여 도 4에 나타내었다.In order to measure the effect of CPE, MTT experiment was performed to measure the survival of MDCK cells after 5 days of culture. The MTT (3- (4,5-dimethylthiazol-2-yl) -2,5-diphenyltetrazolium bromide, Sigma M-2128 1G)) reagent is a pale yellow substrate that is cleaved by respiratory enzymes in the mitochondria of living cells and dark blue. Produces a formazan. MTT reactions do not occur in dead cells because of the cytotoxicity of MDCK cells killed by the virus or the substance itself. Therefore, the efficacy of the compound was evaluated using the method of measuring formazan, which produced cytotoxicity of the substance itself and cytotoxicity by virus at absorbance of 550 nm, respectively. That is, the concentration of the compound without MDCK cytotoxicity by the compound was determined, and the difference in degeneration of MDCK cells by the infected swine influenza virus was measured, and the effect of CPE according to the concentration of the compound was shown in FIG. 4.
도 4를 참고하면, 도 4A에서는 본 발명의 화합물 1~5가 5㎍/㎖로 처리된 군에서 세포 생존률이 50% 내외로 회복되는 것을 확인할 수 있었으며, 도 4B에서 화합물 3의 50% 세포사멸을 회복시키는 농도를 결정하였을 때 화합물 3은 4.50± 0.14㎍/㎖에서 50% 이상 세포 생존율이 회복되는 것을 알 수 있었다. 또한 도 4C를 보면, 돼지 인플루엔자 바이러스가 처리된 세포는 대부분 세포 형태가 이상하거나 죽어있는 것으로 나타났으나, 본 발명의 화합물 3을 5㎍/㎖로 처리한 군은 타미플루를 2㎍/㎖로 처리한 군과 유사하게 세포 형태 및 생존률을 갖는 것으로 나타나 본 발명의 화합물의 항바이러스 효과가 우수함을 입증할 수 있었다. Referring to FIG. 4, in FIG. 4A, the cell viability was recovered to about 50% in the group treated with the
<< 실시예Example 8: 독성실험> 8: Toxicity Test>
실시예Example 8-1. 8-1. 급성독성Acute toxicity
폴리갈라 카렌시움 메탄올 추출물과 화합물 1~5를 단기간에 과량을 섭취하였을 때의 급성적(24시간 이내)으로 동물 체내에 미치는 독성을 조사하고, 치사율을 결정하기 위하여 본 실험을 수행하였다. 일반적인 마우스인 ICR 마우스 계통 70 마리를 준비하였고, 각 군별로 10마리씩 배정하였다. 대조군에는 30% PEG-400만을 투여하고, 실험군은 폴리갈라 카렌시움 메탄올 추출물 및 화합물 1~5를 1.0g/㎏의 농도로 각각 경구 투여하였다. 투여 24시간 후에 각각의 치사율을 조사한 결과, 대조군과 1.0g/㎏ 농도의 폴리갈라 카렌시움 메탄올 추출물과 화합물 1~5를 투여한 실험군에서는 모두 생존하였다. This experiment was carried out to investigate the toxicity of the polygala carenium methanol extract and
실시예Example 8-2 : 8-2: 실험군Experimental group 및 대조군의 장기 및 조직 독성 실험 And control organ organs and tissue toxicity experiments
장기 독성 실험은 C57BL/6J 생쥐를 대상으로 동물의 각 장기(조직)에 미치는 영향을 조사하기 위하여 화합물 1~5 및 메탄올 추출물을 1.0g/㎏의 농도로 1회 투여한 실험군과 용매만을 투여한 대조군의 동물들로부터 8주 후 혈액을 채취하여 GPT(glutamate-pyruvate transferase) 및 BUN(Blood Urea Nitrogen)의 혈액 내 농도를 Select E(Vital Scientific NV, Netherland) 기기를 이용하여 측정하였다. 그 결과, 간독성과 관계있는 것으로 알려진 GPT와 신장독성과 관계있는 것으로 알려진 BUN의 경우, 대조군과 비교하여 실험군은 별다른 차이를 보이지 않았다. 또한, 각 동물로부터 간과 신장을 절취하여 통상적인 조직절편 제작과정을 거쳐 광학현미경으로 조직학적 관찰을 시행하였으며 특이한 이상이 관찰되지 않았다. In the long-term toxicity experiment, C57BL / 6J mice were administered with only one experimental group and a solvent in which Compound 1-5 and methanol extract were administered once at a concentration of 1.0 g / kg in order to investigate the effect on each organ (tissue) of the animal. Blood was collected after 8 weeks from animals in the control group and the blood concentrations of glutamate-pyruvate transferase (GPT) and blood urea nitrogen (BUN) were measured using a Select E (Vital Scientific NV, Netherland) instrument. As a result, GPT, which is known to be related to hepatotoxicity, and BUN, which is known to be related to renal toxicity, showed no significant difference compared to the control group. In addition, liver and kidneys were excised from each animal, and histological observations were performed by optical microscopy through a conventional tissue fabrication process. No abnormalities were observed.
<< 사용예Examples 1 : 약학적 1: Pharmaceutical 제제예Formulation example >>
1-1. 정제의 제조1-1. Manufacture of tablets
본 발명의 폴리갈라 카렌시움 메탄올 추출물 200g을 락토오스 175.9g, 감자전분 180g 및 콜로이드성 규산 32g과 혼합하였다. 이 혼합물에 10% 젤라틴 용액을 첨가시킨 후, 분쇄해서 14 메쉬체를 통과시켰다. 이것을 건조시키고 여기에 감자전분 160g, 활석 50g 및 스테아린산 마그네슘 5g을 첨가해서 얻은 혼합물을 정제로 만들었다. 200 g of polygala carenium methanol extract of the present invention was mixed with 175.9 g of lactose, 180 g of potato starch, and 32 g of colloidal silicic acid. To this mixture was added a 10% gelatin solution, which was pulverized and passed through a 14-mesh sieve. This was dried, and a mixture obtained by adding 160 g of potato starch, 50 g of talc and 5 g of magnesium stearate was made into tablets.
1-2. 주사액제의 제조1-2. Injection preparation
본 발명의 폴리갈라 카렌시움 메탄올 추출물 1g, 염화나트륨 0.6g 및 아스코르브산 0.1g을 증류수에 용해시켜서 100㎖를 만들었다. 이 용액을 병에 넣고 20℃에서 30분간 가열하여 멸균시켰다.1 g of the polygalar carenium methanol extract of the present invention, 0.6 g of sodium chloride and 0.1 g of ascorbic acid were dissolved in distilled water to make 100 ml. This solution was placed in a bottle and sterilized by heating at 20 DEG C for 30 minutes.
<< 사용예Examples 2 : 식품 2: Food 제조예Manufacturing example >>
2-1. 조리용 양념의 제조2-1. Manufacture of cooking seasonings
본 발명의 폴리갈라 카렌시움 메탄올 추출물을 0.2~10 중량%로 조리용 양념에 첨가하여 건강 증진용 조리용 양념을 제조하였다.Polygala calenium methanol extract of the present invention was added to the cooking seasoning at 0.2 to 10% by weight to prepare a cooking seasoning for health promotion.
2-2. 밀가루 식품의 제조2-2. Manufacture of flour food products
본 발명의 폴리갈라 카렌시움 메탄올 추출물을 0.1~5.0 중량%로 밀가루에 첨가하고, 이 혼합물을 이용하여 빵, 케이크, 쿠키, 크래커 및 면류를 제조하여 건강 증진용 식품을 제조하였다.Polygalar carenium methanol extract of the present invention was added to the flour in 0.1 to 5.0% by weight, and using this mixture to prepare bread, cakes, cookies, crackers and noodles to prepare health promoting food.
2-3. 2-3. 스프soup 및 육즙( And juicy ( graviesgravies )의 제조Manufacturing
본 발명의 폴리갈라 카렌시움 메탄올 추출물을 0.1~1.0 중량%로 스프 및 육즙에 첨가하여 건강 증진용 육가공 제품, 면류의 수프 및 육즙을 제조하였다.Polygala carenium methanol extract of the present invention was added to the soup and juice in 0.1 to 1.0% by weight to prepare meat products for health promotion, soup and noodles of noodles.
2-4. 유제품(2-4. dairy product( dairydairy productsproducts )의 제조Manufacturing
본 발명의 폴리갈라 카렌시움 메탄올 추출물을 0.1~1.0 중량%로 우유에 첨가하고, 상기 우유를 이용하여 버터 및 아이스크림과 같은 다양한 유제품을 제조하였다.Polygalar carenium methanol extract of the present invention was added to the milk in 0.1 to 1.0% by weight, using the milk to prepare a variety of dairy products such as butter and ice cream.
<< 사용예Examples 3 : 음료 3: Drink 제조예Manufacturing example >>
3-1. 3-1. 야채쥬스Vegetable juice 제조 Produce
본 발명의 폴리갈라 카렌시움 메탄올 추출물 0.5g을 토마토 또는 당근 쥬스 1,000㎖에 가하여 건강 증진용 야채쥬스를 제조하였다.0.5 g of polygala carenium methanol extract of the present invention was added to 1,000 ml of tomato or carrot juice to prepare vegetable juice for health promotion.
3-2. 3-2. 과일쥬스Fruit juice 제조 Produce
본 발명의 폴리갈라 카렌시움 메탄올 추출물 0.1g을 사과 또는 포도 쥬스 1,000㎖에 가하여 건강 증진용 과일쥬스를 제조하였다.0.1 g of polygala carenium methanol extract of the present invention was added to 1,000 ml of apple or grape juice to prepare fruit juice for health promotion.
<< 사용예Examples 4 : 사료첨가제 4: Feed additives 제조예Manufacturing example >>
본 발명의 폴리갈라 카렌시움 메탄올 추출물 10.0g을 사료용 부형제 50.0g과 섞어 사료첨가제를 제조하였다. 그러나, 그 배합비를 임의로 변형 실시하여도 무방하며, 통상의 사료조성물 제조방법에 따라 상기의 성분을 혼합하여 제조에 사용할 수 있다.A feed additive was prepared by mixing 10.0 g of polygalar carenium methanol extract of the present invention with 50.0 g of feed excipient. However, the compounding ratio may be arbitrarily modified, and the above components may be mixed and used in the manufacture according to a conventional feed composition manufacturing method.
<< 사용예Examples 5 : 소독물의 5: Disinfectant 제조예Manufacturing example >>
본 발명의 폴리갈라 카렌시움 메탄올 추출물 또는 이로부터 분리된 잔톤계 화합물 3.0g을 첨가한 후 정제수를 1,000㎖에 가하여 무방부제용 천연 소독제를 제조하였다.After adding 3.0 g of the polygalar carenium methanol extract of the present invention or the xanthone-based compound separated therefrom, purified water was added to 1,000 ml to prepare a natural antiseptic for antiseptic.
Claims (8)
[화학식 1]
1,3-dihydroxyxanthone (Compound 1 ), 1,7-dihydroxyxanthone (1,7-dihydroxyxanthone, Compound 2 ), 1,7-dihydroxy- 4-methoxyxanthone (1,7-dihydroxy-4-methoxyxanthone, compound 3 ), 1,3,7-trihydroxyxanthone (1,3,7-trihydroxyxanthone, compound 4 ), and 1,2,3 1,2,3,5-tetrahydroxyxanthone (compound 5 ), containing at least one xanthene compound selected from the group consisting of Composition for the prevention or treatment of colds, avian influenza, swine influenza or swine flu containing Polygala karensium extract.
[Formula 1]
상기 폴리갈라 카렌시움 추출물은 물, 탄소수 1 내지 4개의 저급 알코올, 아세톤, 에틸아세테이트, 클로로포름 또는 이들의 혼합용매로 추출하여 제조한 것을 특징으로 하는 감기, 조류 인플루엔자, 돼지 인플루엔자 또는 신종플루의 예방 또는 치료용 조성물.The method of claim 1,
The polygala calenium extract is a cold, avian influenza, swine influenza or swine flu, characterized in that the extract is prepared by extraction with water, lower alcohol having 1 to 4 carbon atoms, acetone, ethyl acetate, chloroform or a mixed solvent thereof. Or a therapeutic composition.
[화학식 1]
1,3-dihydroxyxanthone (Compound 1 ), 1,7-dihydroxyxanthone (1,7-dihydroxyxanthone, Compound 2 ), 1,7-dihydroxy- 4-methoxyxanthone (1,7-dihydroxy-4-methoxyxanthone, compound 3 ), 1,3,7-trihydroxyxanthone (1,3,7-trihydroxyxanthone, compound 4 ), and 1,2,3 1,2,3,5-tetrahydroxyxanthone (compound 5 ), containing at least one xanthene compound selected from the group consisting of A dietary supplement for the prevention or amelioration of colds, avian influenza, swine influenza or swine flu, containing Polygala karensium extract.
[Formula 1]
상기 폴리갈라 카렌시움 추출물은 물, 탄소수 1 내지 4개의 저급 알코올, 아세톤, 에틸아세테이트, 클로로포름 또는 이들의 혼합용매로 추출하여 제조한 것을 특징으로 하는 감기, 조류 인플루엔자, 돼지 인플루엔자 또는 신종플루의 예방 또는 개선용 건강기능식품.5. The method of claim 4,
The polygala calenium extract is a cold, avian influenza, swine influenza or swine flu, characterized in that the extract is prepared by extraction with water, lower alcohol having 1 to 4 carbon atoms, acetone, ethyl acetate, chloroform or a mixed solvent thereof. Or dietary supplements for improvement.
[화학식 1]
1,3-dihydroxyxanthone (Compound 1 ), 1,7-dihydroxyxanthone (1,7-dihydroxyxanthone, Compound 2 ), 1,7-dihydroxy- 4-methoxyxanthone (1,7-dihydroxy-4-methoxyxanthone, compound 3 ), 1,3,7-trihydroxyxanthone (1,3,7-trihydroxyxanthone, compound 4 ), and 1,2,3 1,2,3,5-tetrahydroxyxanthone (compound 5 ), containing at least one xanthene compound selected from the group consisting of Polygala ( Polygala) Animal medicine for the prevention or treatment of cold, avian influenza, swine influenza or swine flu containing karensium ) extract.
[Formula 1]
[화학식 1]
1,3-dihydroxyxanthone (Compound 1 ), 1,7-dihydroxyxanthone (1,7-dihydroxyxanthone, Compound 2 ), 1,7-dihydroxy- 4-methoxyxanthone (1,7-dihydroxy-4-methoxyxanthone, compound 3 ), 1,3,7-trihydroxyxanthone (1,3,7-trihydroxyxanthone, compound 4 ), and 1,2,3 1,2,3,5-tetrahydroxyxanthone (compound 5 ), containing at least one xanthene compound selected from the group consisting of Polygala ( Polygala) Animal feed additive for the prevention or amelioration of cold, avian influenza, swine influenza or swine flu containing karensium ) extract.
[Formula 1]
[화학식 1]
1,3-dihydroxyxanthone (Compound 1 ), 1,7-dihydroxyxanthone (1,7-dihydroxyxanthone, Compound 2 ), 1,7-dihydroxy- 4-methoxyxanthone (1,7-dihydroxy-4-methoxyxanthone, compound 3 ), 1,3,7-trihydroxyxanthone (1,3,7-trihydroxyxanthone, compound 4 ), and 1,2,3 1,2,3,5-tetrahydroxyxanthone (compound 5 ), containing at least one xanthene compound selected from the group consisting of Polygala ( Polygala) karensium ) A disinfectant for the prevention of colds, avian influenza, swine influenza or swine flu.
[Formula 1]
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
KR1020120062490A KR101334143B1 (en) | 2012-06-12 | 2012-06-12 | Composition comprising extract of polygala karensium or xanthone compounds isolated therefrom for treating or preventing cold, avian influenza, swine influenza or novel influenza |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
KR1020120062490A KR101334143B1 (en) | 2012-06-12 | 2012-06-12 | Composition comprising extract of polygala karensium or xanthone compounds isolated therefrom for treating or preventing cold, avian influenza, swine influenza or novel influenza |
Publications (1)
Publication Number | Publication Date |
---|---|
KR101334143B1 true KR101334143B1 (en) | 2013-11-28 |
Family
ID=49858701
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
KR1020120062490A KR101334143B1 (en) | 2012-06-12 | 2012-06-12 | Composition comprising extract of polygala karensium or xanthone compounds isolated therefrom for treating or preventing cold, avian influenza, swine influenza or novel influenza |
Country Status (1)
Country | Link |
---|---|
KR (1) | KR101334143B1 (en) |
Cited By (6)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
KR20190045050A (en) | 2018-09-07 | 2019-05-02 | 류형준 | Food composition for treating cold and flu |
WO2021060791A1 (en) | 2019-09-24 | 2021-04-01 | 성균관대학교산학협력단 | Nano-perforator having improved anti-viral activity |
KR20220110669A (en) | 2021-01-31 | 2022-08-09 | (주)예스킨 | Anti covid-19 agent |
KR20220110655A (en) | 2021-01-31 | 2022-08-09 | (주)예스킨 | Anti covid-19 agent and adjuvant for anti virus agent |
KR20220144771A (en) | 2021-04-20 | 2022-10-27 | 엠브릭스 주식회사 | Pharmaceutical Composition for Preventing or Treating Viral Infection Comprising Polymer Nanodiscs |
US11541100B2 (en) | 2016-07-15 | 2023-01-03 | MVRIX Co., Ltd. | Pharmaceutical composition comprising nanoperforator for preventing or treating viral infectious diseases |
Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
KR20100114674A (en) * | 2009-04-16 | 2010-10-26 | 한국생명공학연구원 | Composition for inhibiting the activity of neuraminidase and pharmaceutical composition for prevention and treatment of influenza viral diseases comprising extracts of cudrania tricuspidata |
KR101021830B1 (en) * | 2010-08-17 | 2011-03-17 | 주식회사 중앙백신연구소 | Antiviral agents with inhibitory activities on avian and swine influenza virus or novel influenza virus by compounds isolated from cleistocalyx operculatus |
-
2012
- 2012-06-12 KR KR1020120062490A patent/KR101334143B1/en active IP Right Grant
Patent Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
KR20100114674A (en) * | 2009-04-16 | 2010-10-26 | 한국생명공학연구원 | Composition for inhibiting the activity of neuraminidase and pharmaceutical composition for prevention and treatment of influenza viral diseases comprising extracts of cudrania tricuspidata |
KR101021830B1 (en) * | 2010-08-17 | 2011-03-17 | 주식회사 중앙백신연구소 | Antiviral agents with inhibitory activities on avian and swine influenza virus or novel influenza virus by compounds isolated from cleistocalyx operculatus |
Non-Patent Citations (2)
Title |
---|
Planta Medica 76(7): 708-712(2010) * |
Vaccine 19(32): 4824-4834(2001. 9. 14.) * |
Cited By (8)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US11541100B2 (en) | 2016-07-15 | 2023-01-03 | MVRIX Co., Ltd. | Pharmaceutical composition comprising nanoperforator for preventing or treating viral infectious diseases |
KR20190045050A (en) | 2018-09-07 | 2019-05-02 | 류형준 | Food composition for treating cold and flu |
WO2021060791A1 (en) | 2019-09-24 | 2021-04-01 | 성균관대학교산학협력단 | Nano-perforator having improved anti-viral activity |
KR20220110669A (en) | 2021-01-31 | 2022-08-09 | (주)예스킨 | Anti covid-19 agent |
KR20220110655A (en) | 2021-01-31 | 2022-08-09 | (주)예스킨 | Anti covid-19 agent and adjuvant for anti virus agent |
KR20220144771A (en) | 2021-04-20 | 2022-10-27 | 엠브릭스 주식회사 | Pharmaceutical Composition for Preventing or Treating Viral Infection Comprising Polymer Nanodiscs |
WO2022225268A1 (en) | 2021-04-20 | 2022-10-27 | 엠브릭스 주식회사 | Pharmaceutical composition for preventing or treating virus infections, comprising polymer nanodiscs |
KR20230064607A (en) | 2021-04-20 | 2023-05-10 | 엠브릭스 주식회사 | Pharmaceutical Composition for Preventing or Treating Viral Infection Comprising Amphipathic Polymer Nanodiscs |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
KR101021830B1 (en) | Antiviral agents with inhibitory activities on avian and swine influenza virus or novel influenza virus by compounds isolated from cleistocalyx operculatus | |
KR101077920B1 (en) | Composition for prevention and treatment of influenza virus and composition for inhibiting the activity of neuraminidase comprising extracts of Turmeric | |
KR101782532B1 (en) | A composition comprising extract of Angelica dahurica or furanocoumarins isolated therefrom for preventing or treating Avian influenza, Swine influenza or Corona virus | |
KR100962334B1 (en) | Antiviral agents with inhibitory activities on avian and swine influenza virus or novel influenza virus by compounds isolated from curcurma longa | |
KR101334143B1 (en) | Composition comprising extract of polygala karensium or xanthone compounds isolated therefrom for treating or preventing cold, avian influenza, swine influenza or novel influenza | |
KR100950445B1 (en) | Antiviral agents with inhibitory activities on on avian and swine influenza virus or novel influenza virus by compounds isolated from glycyrrhiza uralensis | |
WO2011055931A2 (en) | Composition for preventing or treating diseases caused by influenza viruses | |
KR101976528B1 (en) | Composition comprising extract of Undaria pinnatifida for preventing or treating of Corona virus | |
KR20150055683A (en) | Composition comprising ginsenosides for treating or preventing Cold, Avian influenza, or Swine influenza | |
KR101966124B1 (en) | Composition comprising extract of Ecklonia cava or phlorotannin compounds isolated from thereof for preventing or treating influenza | |
KR101189823B1 (en) | Composition for prevention and treatment of influenza virus and composition for inhibiting the activity of neuraminidase comprising polyphenol compounds | |
KR102456749B1 (en) | Composition for preventing or treating swine influenza virus disease comprising Curcuma longa extract or sesquiterpenoids isolated therefrom as active ingredients | |
KR101811848B1 (en) | Composite comprising curcuminoid/stevioside for prevention or treatment of influenza virus | |
KR20150095605A (en) | Composition comprising ginsenosides for treating or preventing Cold, Avian influenza, or Swine influenza | |
KR20100114674A (en) | Composition for inhibiting the activity of neuraminidase and pharmaceutical composition for prevention and treatment of influenza viral diseases comprising extracts of cudrania tricuspidata | |
KR101427096B1 (en) | Composition comprising extract of Dryopteris crassirhizoma or phloroglucinol derivatives isolated therefrom for treating or preventing Corona virus related disease | |
US20120046353A1 (en) | Cleistocalyx operculatus-derived compounds having inhibitory activities against avian and swine influenza viruses or novel influenza virus | |
KR20210133861A (en) | Composition for preventing or treating swine influenza virus disease comprising Resina Pini extract or diterpenoids isolated therefrom as active ingredients | |
KR102583001B1 (en) | Composition for preventing or treating severe acute respiratory syndrome- corona virus infection comprising Chlorella sp. extract or pheophytinized fraction or pyphyrins or carotenones isolated therefrom as active ingredients | |
KR20150086928A (en) | Composition for prevention or treatment of influenza virus infection comprising curcuminoid and licorice extracts or fraction thereof | |
EP4151226A1 (en) | Coronavirus therapeutic agent comprising zanthoxylum piperitum leaf extract as active ingredient | |
KR101115063B1 (en) | Composition for prevention and treatment of influenza virus and composition for inhibiting the activity of neuraminidase | |
KR101189822B1 (en) | Composition for inhibiting the activity of neuraminidase and composition for prevention and treatment of influenza viral diseases comprising coumarin compounds | |
KR101636606B1 (en) | Composition comprising polyphenols from the fruiting bodies of Phellinus baumii for preventing or treating of influenza virus infection | |
KR102000473B1 (en) | Composition comprising bee venom for prevention or treating avian influenza |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
A201 | Request for examination | ||
E902 | Notification of reason for refusal | ||
E701 | Decision to grant or registration of patent right | ||
GRNT | Written decision to grant | ||
FPAY | Annual fee payment |
Payment date: 20161024 Year of fee payment: 4 |
|
FPAY | Annual fee payment |
Payment date: 20181211 Year of fee payment: 6 |
|
FPAY | Annual fee payment |
Payment date: 20191028 Year of fee payment: 7 |