IT1085396B - Ricevitore televisivo dotato di un circuito di rivelazione sincrono e di un circuito di reivelazione delle deviazioni di frequenza - Google Patents
Ricevitore televisivo dotato di un circuito di rivelazione sincrono e di un circuito di reivelazione delle deviazioni di frequenzaInfo
- Publication number
- IT1085396B IT1085396B IT27538/77A IT2753877A IT1085396B IT 1085396 B IT1085396 B IT 1085396B IT 27538/77 A IT27538/77 A IT 27538/77A IT 2753877 A IT2753877 A IT 2753877A IT 1085396 B IT1085396 B IT 1085396B
- Authority
- IT
- Italy
- Prior art keywords
- circuit
- television receiver
- reveal
- receiver equipped
- detection
- Prior art date
Links
- 238000001514 detection method Methods 0.000 title 2
- 230000001360 synchronised effect Effects 0.000 title 1
Classifications
-
- H—ELECTRICITY
- H04—ELECTRIC COMMUNICATION TECHNIQUE
- H04N—PICTORIAL COMMUNICATION, e.g. TELEVISION
- H04N5/00—Details of television systems
- H04N5/44—Receiver circuitry for the reception of television signals according to analogue transmission standards
- H04N5/50—Tuning indicators; Automatic tuning control
-
- H—ELECTRICITY
- H03—ELECTRONIC CIRCUITRY
- H03G—CONTROL OF AMPLIFICATION
- H03G3/00—Gain control in amplifiers or frequency changers
- H03G3/20—Automatic control
-
- H—ELECTRICITY
- H04—ELECTRIC COMMUNICATION TECHNIQUE
- H04N—PICTORIAL COMMUNICATION, e.g. TELEVISION
- H04N5/00—Details of television systems
- H04N5/44—Receiver circuitry for the reception of television signals according to analogue transmission standards
- H04N5/455—Demodulation-circuits
Landscapes
- Engineering & Computer Science (AREA)
- Multimedia (AREA)
- Signal Processing (AREA)
- Television Receiver Circuits (AREA)
- Circuits Of Receivers In General (AREA)
- Superheterodyne Receivers (AREA)
- Processing Of Color Television Signals (AREA)
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| NLAANVRAGE7610354,A NL183428B (nl) | 1976-09-17 | 1976-09-17 | Televisieontvanger met een synchrone detectieschakeling en een frequentieafwijkings-detectieschakeling. |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| IT1085396B true IT1085396B (it) | 1985-05-28 |
Family
ID=19826919
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| IT27538/77A IT1085396B (it) | 1976-09-17 | 1977-09-14 | Ricevitore televisivo dotato di un circuito di rivelazione sincrono e di un circuito di reivelazione delle deviazioni di frequenza |
Country Status (15)
| Country | Link |
|---|---|
| US (1) | US4157569A (enExample) |
| JP (1) | JPS5338220A (enExample) |
| AU (1) | AU510811B2 (enExample) |
| BE (1) | BE858740A (enExample) |
| CA (1) | CA1091340A (enExample) |
| DE (1) | DE2740623C3 (enExample) |
| ES (1) | ES462376A1 (enExample) |
| FI (1) | FI63144C (enExample) |
| FR (1) | FR2365257A1 (enExample) |
| GB (1) | GB1537799A (enExample) |
| HK (1) | HK66179A (enExample) |
| IT (1) | IT1085396B (enExample) |
| NL (1) | NL183428B (enExample) |
| NZ (1) | NZ185176A (enExample) |
| ZA (1) | ZA774892B (enExample) |
Families Citing this family (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4253118A (en) * | 1979-07-02 | 1981-02-24 | Zenith Radio Corporation | Synchronous detection system |
| US4323924A (en) * | 1980-10-06 | 1982-04-06 | Zenith Radio Corporation | Automatic phase adjusting circuit for a synchronous detector |
| US4388649A (en) * | 1981-06-01 | 1983-06-14 | Rca Corporation | AFT Lockout prevention system |
| NL8200374A (nl) * | 1982-02-02 | 1983-09-01 | Philips Nv | Televisie-ontvanger met een videosignaaldetektor van een met behulp van een referentiesignaal detekterend type. |
| NL8301179A (nl) * | 1983-04-01 | 1984-11-01 | Philips Nv | Ontvanger voor hf-signalen voorzien van een paar parallelle signaalwegen. |
| NL8800555A (nl) * | 1988-03-07 | 1989-10-02 | Philips Nv | Synchrone demodulatieschakeling voor een op een draaggolf gemoduleerd televisiesignaal. |
| DE10158357A1 (de) * | 2001-11-28 | 2003-06-12 | Philips Intellectual Property | Kompensationsschaltung für Frequenzfilter |
Family Cites Families (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US2573248A (en) * | 1949-06-18 | 1951-10-30 | Zenith Radio Corp | Television receiver |
| NL6609958A (enExample) * | 1966-07-15 | 1968-01-16 | ||
| US3812289A (en) * | 1972-11-06 | 1974-05-21 | Rca Corp | Television receiver using synchronous video detection |
| US3858000A (en) * | 1972-12-04 | 1974-12-31 | Warwick Electronics Inc | Extended range afc system |
| GB1440342A (en) * | 1973-04-10 | 1976-06-23 | Thorn Electrical Ind Ltd | Television receiver circuits |
| NL7306381A (enExample) * | 1973-05-08 | 1974-11-12 | ||
| JPS51100632A (enExample) * | 1975-03-03 | 1976-09-06 | Matsushita Electric Industrial Co Ltd | |
| US4091410A (en) * | 1976-11-08 | 1978-05-23 | Zenith Radio Corporation | Frequency and phase lock loop synchronous detecting system having a pair of phase lock conditions |
-
1976
- 1976-09-17 NL NLAANVRAGE7610354,A patent/NL183428B/xx not_active Application Discontinuation
-
1977
- 1977-08-12 ZA ZA00774892A patent/ZA774892B/xx unknown
- 1977-08-18 US US05/825,575 patent/US4157569A/en not_active Expired - Lifetime
- 1977-09-09 DE DE2740623A patent/DE2740623C3/de not_active Expired
- 1977-09-13 CA CA286,585A patent/CA1091340A/en not_active Expired
- 1977-09-14 NZ NZ185176A patent/NZ185176A/xx unknown
- 1977-09-14 IT IT27538/77A patent/IT1085396B/it active
- 1977-09-14 GB GB38362/77A patent/GB1537799A/en not_active Expired
- 1977-09-14 FI FI772706A patent/FI63144C/fi not_active IP Right Cessation
- 1977-09-15 ES ES462376A patent/ES462376A1/es not_active Expired
- 1977-09-15 BE BE180945A patent/BE858740A/xx not_active IP Right Cessation
- 1977-09-16 JP JP11062977A patent/JPS5338220A/ja active Granted
- 1977-09-16 FR FR7728006A patent/FR2365257A1/fr active Granted
- 1977-09-19 AU AU28912/77A patent/AU510811B2/en not_active Expired
-
1979
- 1979-09-13 HK HK661/79A patent/HK66179A/xx unknown
Also Published As
| Publication number | Publication date |
|---|---|
| HK66179A (en) | 1979-09-21 |
| ES462376A1 (es) | 1978-06-01 |
| JPS5338220A (en) | 1978-04-08 |
| NL183428B (nl) | 1988-05-16 |
| FI772706A7 (fi) | 1978-03-18 |
| ZA774892B (en) | 1979-03-28 |
| CA1091340A (en) | 1980-12-09 |
| AU2891277A (en) | 1979-03-29 |
| US4157569A (en) | 1979-06-05 |
| JPS6216067B2 (enExample) | 1987-04-10 |
| NL7610354A (nl) | 1978-03-21 |
| BE858740A (fr) | 1978-03-15 |
| AU510811B2 (en) | 1980-07-17 |
| DE2740623C3 (de) | 1980-03-20 |
| DE2740623B2 (de) | 1979-07-05 |
| FR2365257A1 (fr) | 1978-04-14 |
| DE2740623A1 (de) | 1978-03-23 |
| GB1537799A (en) | 1979-01-04 |
| NZ185176A (en) | 1980-08-26 |
| FI63144C (fi) | 1983-04-11 |
| FR2365257B1 (enExample) | 1982-05-14 |
| FI63144B (fi) | 1982-12-31 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| IT1084913B (it) | Circuito zavorra con oscillatore sintonizzato | |
| IT1098555B (it) | Generatore di impulsi a circuito integrato sintonizzabile per via digitale e sistema di sintonizzazione | |
| IT1108337B (it) | Ricevitore televisio con circuito di sincronizzazione di linea | |
| SE7810993L (sv) | Mottagare med en frekvenssynteskrets | |
| IT1085396B (it) | Ricevitore televisivo dotato di un circuito di rivelazione sincrono e di un circuito di reivelazione delle deviazioni di frequenza | |
| IT1127977B (it) | Ricevitore con circuito di sintonia a ricerca | |
| IT1082188B (it) | Circuito limitatore di disturbi in ricevitori radio | |
| IT1084692B (it) | Ricevitore di dati dotato di un circuito di rivelazione della seuquenza di sincronizzazione | |
| IT1080346B (it) | Circuito integrato con stadio a valore di soglia a soglia regolabile | |
| AR215265A1 (es) | Circuito desmagnetizador en un receptor de television en colores | |
| IT1094347B (it) | Circuito discriminatore a finestra | |
| JPS5310997A (en) | Hf invader sensor receiver circuit disposition | |
| JPS52154076A (en) | Proximity detection circuit | |
| IT8024016A0 (it) | Circuito per inibire le interferenze a radiofrequenza in un ricevitore televisivo. | |
| IT1087137B (it) | Ricevitore televisivo con temoporizzatore incorporato | |
| IT1192273B (it) | Circuito ricevitore | |
| DK287677A (da) | Fjernsynsmodtager med et frekvenssynteseafstemningskredslob | |
| AR214317A1 (es) | Un circuito de procesamiento de senales | |
| IT1109298B (it) | Sintonizzatore a pulsanti a basso profilo | |
| IT1086992B (it) | Circuito di sintonizzazione per un ricevitore eterodina | |
| JPS52151507A (en) | Tuning detecting circuit | |
| AT353331B (de) | Synchronimpuls-abtrennverstaerkerschaltung fuer fernsehempfaenger | |
| IT1072343B (it) | Circuito elaboratore di segnali televisivi | |
| JPS5342082A (en) | Peak value detection circuit | |
| JPS5295270A (en) | Frequency difference detection device |