IE83721B1 - Interleukin-1 inhibitors - Google Patents

Description

Interleukins-l are a class of proteins produced by numerous cell-types. including monocytes and some macrophages. This class includes at least two 17-18 kilodalton proteins known as interleukin-1 alpha and interleukin-1 beta. These proteins have important physiological effects on a number of different target cells involved in the inflammatory and immune responses. The proteins are co-mitogens (with phytohemaglutinin) for T-cells, cause both fibroblasts and chondrocytes to secrete latent col- lagenase, and increase the surface adhesive powers of endothelial cells for neutrophils. In addition, they act on the hypothalamus as pyrogens, they stimulate the catabolism of muscle protein, and they cause hepatocytes to synthesize a class of proteins known as "acute phase reactants." Thus, interleukins-l (IL-1) are obvi- ously an important part of an organism's response to infection and injury.

B. Patholooical Roles of IL-1 However, despite their normally beneficial effects, circum- stances have come to light in which the actions of IL-1 are harm- ful. For example, IL-1 may increase the level of collagenase in an arthritic joint and has been implicated as a mediator of both the acute and chronic stages of immunopathology in rheumatoid arthritis. IL-l may be responsible for altering endothelial cell function, directing the chemotaxis and migration of leukocytes and lymphocytes into the synovial tissue, inducing capillary proliferation, and stimulating macrophage accumulation in the synovial lining during the acute phase of this disease. In the phase of tissue destruction, IL-1 has been implicated as a media- tor in induction of tissue damage through stimulating release of enzymes from fibroblasts and chondrocytes.

In addition, excessive IL-1 production has been demonstrated in the skin of patients with psoriasis and high levels of IL-1 can be found in the synovial fluid of patients with psoriatic arthritis. IL-l released by cells in the inflamed synovium in psoriatic arthritis may mediate tissue destruction through stimu- lation of enzyme release from other cells. The joint pathology of Reiter's syndrome is similar to that seen in psoriatic arthri- tis and in rheumatoid arthritis. IL-1 has been implicated as a mediator of tissue destruction in these three different forms of inflammatory arthritis. Moreover, IL-l may be found in the synovial fluid of patients with osteoarthritis. The release of IL-1 by chondrocytes has been implicated in the destruction of articular cartilage in this disease.

IL-l may also increase the severity of autoimmune diseases.

For example, decreased IL-1 production has been described from peripheral blood cells in persons suffering from systemic lupus erythematosus. Moreover, some of the alterations in B lymphocyte function may be related to abnormalities in IL-1 production or IL-1 availability.

Excessive IL-1 production has been demonstrated in the pe- ripheral monocytes of patients with scleroderma, and IL-1 has been implicated as a possible agent of fibrosis through stimula- tion of collagen production by fibroblasts. The mechanism of tissue damage in dermatomyositis might also involve cell-mediated immunity and IL-1 may therefore be involved as a mediator in this pathophysiological process.

Acute and chronic interstitial lung disease is characterized by excessive collagen production by lung fibroblasts which may be stimulated by IL-1. Recent studies on an animal model of pulmo- nary hypertension indicate that IL-1 may be responsible for in- duction of endothelial cell changes that result in narrowing of pulmonary arteries. It is this narrowing that leads to pulmonary hypertension and further secondary damage. Thus, IL-l inhibitors could be useful in treating these lung diseases.

Recent studies have described that IL-1 is capable of directly damaging the beta cells in the Islets of Langerhans that are responsible for the production of insulin. IL-l damage to the cells is now hypothesized to be a primary event in the acute phase of juvenile diabetes mellitus.

Monocyte and macrophage infiltration in the kidneys predomi- nates in many forms of acute and chronic glomerulonephritis.

IL-l release by these cells may result in local accumulation of other inflammatory cells, eventually leading to inflammatory dam- age and fibrotic reaction in the kidneys.

It has been demonstrated that the crystals found in tissues or fluids in gout or pseudogout can directly stimulate macrophages to release IL-1. Thus, IL-1 may be an important me- diator in the inflammatory cycle in these diseases.

IL-1 is capable of inducing loss of calcium from bones and may be responsible for the osteoporosis that is seen in inflamma- tory joint diseases.

Keratinocytes from patients with psoriasis release large amounts of IL-1. This mediator may be responsible for the sec- ondary cell proliferation and accumulation which occurs in the skin in patients with this disease.

IL-1 is one of the important endogenous pyrogens and may be responsible for inducing the marked degree of fever seen in some infectious diseases such as acute febrile illnesses due to bacte- ria or viruses.

Sarcoidosis is characterized by granulomatous lesions in many different organs in the body. IL-1 has been shown to be capable of inducing granuloma formation in vitro and may be in- volved in this process in patients with sarcoidosis.

Excessive IL-1 production has been demonstrated in peripher- al monocytes from both Crohn's disease and ulcerative colitis.

Local IL-1 release in the intestine may be an important mediator in stimulating the inflammatory cycle in these diseases.

Certain lymphomas are characterized by fever, osteoporosis and even secondary arthritis. Excessive IL-1 release has been demonstrated by some lymphoma cells in vitro and may be responsi- ble for some of the clinical manifestations of these ma- lignancies. Also, IL-1 production by some malignant lymphocytes may be responsible for some of the fever, acute phase response and cachexia seen with leukemias.

IL-1 release by astrocytes in the brain is thought to be re- sponsible for inducing the fibrosis that may result after damage to the brain from vascular occlusion.

C. Uses for an/Iggl Inhibitor In these and other circumstances in which IL-1 has a harmful effect, there is clearly a clinical use for an inhibitor of ;L-1 action. As IL-1 is a co-mitogen for T-cells, it is central to the development of autoimmune and other immune diseases. Thus, systemically administered, IL-1 inhibitors could be useful immunosuppressive agents. Locally applied, such IL-l inhibitors could serve to prevent tissue destruction in an inflamed joint and other sites of inflammation. Indeed, to prevent tissue destruction some IL-1 inhibitors could be even more effective when administered in conjunction with collagenase inhibitors- Therapeutic intervention against the action of IL-1 might be possible at the level of synthesis, secretion, or the target cell's binding or response to the protein. IL-1 is synthesized by monocyte/macrophages and other cells in response to lipopolysaccharides, complement fragments and viruses. Any molecule that blocks binding of these inducing agents to producer cells or which interferes with their effects on the physiology of these cells would serve as a regulator of IL-1 action. IL-1 is not secreted by a traditional secretion system since mRNAs have been isolated that code for at least two 30 kd precursors of the proteins but which do not contain a hydrophobic signal sequence.

Release of the active protein from the inactive precursor proba- bly requires proteolysis of that precursor. An inhibitor of the release of IL-1 or IL-ls from their precursors could theoreti- cally regulate IL-l action. IL-l probably acts on target cells through a classical receptor-mediated pathway, although that receptor has not yet been isolated. Thus, it could be that a molecule that interferes with IL-1 binding to its receptors, or down-regulates these receptors, could also regulate IL-1 action.

Moreover, although the intracellular events following receptor binding of IL-1 are not yet fully understood, it is possible that agents exist that can interfere with the cellular responses to other receptor-mediated events and therefore block IL-l action.

For the reasons stated above, proteins and small molecules capa- ble of inhibiting IL-1 in one or more of these manners have been sought.

Surprisingly, the present inventors have found at least two IL-l inhibitor proteins with IL-1 inhibiting properties. These molecules have been obtained in a purified form which will enable one of ordinary skill in the art to determine their amino acid sequence. Furthermore, a preparation of cells has been characterized which produce these proteins, and an mRNA that leads to its synthesis has been characterized. Finally, an antisera has been developed that will facilitate screening of cDNA expression libraries for the genes coding for these inhib- itors. Together these reagents will allow cDNAs encoding the IL-1 inhibitors to be cloned. These genes will, in turn, make possible the large scale production of IL-1 inhibitors suitable for use in pharmaceutical formulations useful in treating pathophysicological conditions mediated by IL-1.

Summary of the Invention This invention relates to IL-1 inhibitors ("IL-li") gener- ally and, more specifically, to a monocyte-derived IL-l inhib- itor. Additionally, the present invention relates to biologically-active analogs of these inhibitors.

An object of the present invention is to provide purified forms of IL-1 inhibitors which are active against IL-la or IL-18 or a combination thereof. An additional object of the present invention is to provide these inhibitors in purified forms to enable the determination of their amino acid sequence. A further object is to provide the amino acid sequences of certain IL-1 in- hibitors. Furthermore, the identification of biologically-active analogs of such IL-1 inhibitors with enhanced or equivalent prop- erties is also one of the objects of the invention.

This object is achieved by a recombinant polypeptide according to claim 1 having interieukin-1 inhibitor (IL-1i) activity comprising an amino acid sequence that is selected from: (A) an amino acid sequence that is encoded by a fragment of the coding region of a DNA sequence (A) that encodes an IL-1i or an IL-1i with an N-tenninai secretion leader sequence as set forth below: — 30 40 SO 60 GAATTCCGGGCTGCAGTCACAGAATGGAAATCTGCAGAGGCCTCCGCAGTCACCTAATCA M E I C R G L R S H L I 90 100 110 120 CTCTCCTCCTCTTCCTGTTCCATTCAGAGACGATCTGCCSACCCTCTGGGAGAAAATCCA T L L L F L F H S E T I C (X) P S G R K S 150 160 170 180 GCAAGATGCAAGCCTTCAGAATCTGGGATGTTAACCAGAAGACCTTCTATCTGAGGAACA S K M Q A F R I W D V N Q K T F Y L R N 210 220 230 240 ACCAACTAGTTGCTGGATACTTGCAAGGACCAAATGTCAATTTAGAAGAAAAGATAGATG N Q L V A G Y L Q G P N V N L E E K I D 270 I280 290 300 TGGTACCCATTGAGCCTCATGCTCTGTTCTTGGGAATCCATGGAGGGAAGATGTGCCTGT V V P I E P H A L F ’L G I H G G K M C L 330 340 350 360 CCTGTGTCAAGTCTGGTGATGAGACCAGACTCCAGCTGGAGGCAGTTAACATCACTGACC S C V K S G D E T R L Q L E A V N I T D 390 400 410 420 TGAGCGAGAACAGAAAGCAGGACAAGCGCTTCGCCTTCATCCGCTCAGACAGTGGCCCCA L S E N R K Q D K R F A F I R S D S G P 450 460 470 480 CCACCAGTTTTGAGTCTGCCGCCTGCCCCGGTTGGTTCCTCTGCACAGCGATGGAAGCTG T T S F E S A A C P G W F L C T A M E A A 490 500 510 520 530 540 ACCAGCCCGTCAGCCTCACCAATATGCCTGACGAAGGCGTCATGGTCACCAAATTCTACT D Q P v s L T N M P D E G V M v T K p Y 570 580 590 500 TC CAGGAGGACGAGTAGTACTGCCCAGGC CTGCTGTTCCATTCTTGCATGGCAAGGACTG FQE'DE'* wherein S of the DNA sequence is C or G and wherein (X) is R or P; (B) a fragment of the following amino acid sequence: (U)(X)PSGRKSSKMQAFRIWDVNQKTFYLRN NQLVAGYLQGPNVNLEEKlDVVPl'EPHA VLFLGIHGGKMCLSCVKSGDETRLQLEAV NITDLSENRKQDKRFAFIRSDSGPTTSF AESAACPGWFLCTAMEADQPVSLTNM.PDE GVMVTKFYFQEDE wherein (U) is nothing, M, or comprises an N-terrninal secretion leader sequence that is capable ot directing the polypeptide having lL-1 inhibitor activity out of a cell in a processed fonn and (X) is R or P; or (C) an amino acid sequence that is at least 70 % homologous to the amino acid sequence of native IL-1 inhibitor having the following amino acid sequence: (MP8GRKSSKMQAFRIWDVNQKTFYLRN NQLVAGYLQGPNVNLEEKIDVVPIEPHA LFLGIHGGKMCLSCVKSGDETRLQLEAV NITDLSENRKQDKRFAFIRSDSGPTTSF ESAACPGWFLCTAMEADQPVSLTNMPDE GVMVTKFYFQEDE wherein (X) is R or P; with the proviso that the amino acid sequence of any of (A), (B) or (C) does not comprise the amino acid sequence from position 26 to the end or from position 1 to the end of the following sequence: 90 100 110 120 T 130 140 wherein (X) is either P = proline or R = arginine.

Additionally, it is an object of this invention to provide a recombinant-DNA system for the production of the IL-1 inhibitoié described herein. Additional objects and advantages of the invention will be set forth in part in the description which follows, and in part will be obvious from thedescription or may be learned from the practice of the invention. The objects and advantages may be realised and attained by means of the instrumentalities and combinations particulany pointed out in the appended claims.

To achieve the objects and in accordance with the purposes of the present invention, lL-1 inhibitors are disclosed which exhibit inhibitory activity against lL-1. The preferred inhibitors have been isolated in.a purified form from monocyte-conditioned medium with monocytes grown on |gG-coated plates.

Moreover, to achieve the objects and in accordance with the purposes of the present invention, a recombinant-DNA system for the creation of these IL-l inhibitors and their analogs is also disclosed. A preferred embodiment of this system includes at least one cDNA clone or its synthetic equivalent encoding at least one IL-l inhibitor along with vectors and cells constituting an expression system capable of expressing the IL-1 inhibitors disclosed herein.

Expression systems for pro- ducing these IL-l inhibitors using these cDNA clones, their analogs, or other DNA sequences encoding these inhibitors are also provided.

Brief Description of the Figures Figures la and lb depict the protein profile of the Mono Q chromatography of two metabolically-labelled monocyte su- pernatants. The cells were cultured on lgG (la) or fetal calf serum (lb) coated plates.

Figure 2a shows silver stained gels of fractions from the regions indicated in Figures la and lb.

Figure 2b is an autoradiogram of the gels shown in Figure 2a.

Figures 3a, b and c present data on the purified IL-li of Example 1. Figure 3a presents chromatography data with the ra- dioactivity pattern superimposed. Figure 3b presents silver stained gels run on samples of the fractions indicated in Figure a. Figure 3c presents autoradiograms of the gels in Figure 3b.

Figures 4a and b present the results of gel filtration chromatograms of Mono Q-purified IL—li.

Figures 5a and b present Western analysis of mouse antisera.

Figure 6 depicts the construction of plasmid pSVXVPL2IL-ii.

Figure 7 depicts the construction of plasmid pMK-SGE:IL-li.

Figures 8a-d present data on IL-li-u. Figures 8a and 8b present chromatography data. Figure 8: presents a silver stained gel run on samples of fractions indicated in figure 8b. Figure 8d presents an autoradiogram.

Figures 9a and 9b present data on IL-li-B. Figure 9a pres- ents chromotography data. Figure 9b presents SDS-PAGE data.

Figure l0 presents data of IL-li-a peptide separation.

Figure 11 presents data of IL-li-B peptide separation.

Figure l2b presents data of an auzoradiogram of a Southern blot of the gel shown in Figure l2a.

Figure 14 depicts the nucleotide sequence of GTl0-IL—li—2A.

Figure 15 depicts a peptide including, inter alia, an IL—li sequence and a secretory leader sequence.

Description of the Preferred Embodiment Reference will now be made in detail to the presently pre- ferred embodiments of the invention, which, together with the -lO.. following examples, serve to explain the principles of the inven- tion.

A. Inhibitor from Human Monocvtes As noted above, the present invention relates to IL-1 inhib- itors which have been isolated in a purified form. Preferably, the IL-1 inhibitors of the present invention are derived from human monocyte conditioned medium where the monocytes are grown on IgG coated vessels. In addition, the invention encompasses substantially purified IL-l inhibitors of any origin which are biologically equivalent to the inhibitor derived from human monocyte-contained medium.

By "biologically equivalent," as used throughout the speci- fication and claims, we mean compositions of the present inven- tion that are capable of preventing IL-l action in a similar fashion, but not necessarily to the same degree, as the native IL-l inhibitor isolated from monocytes. By "substantially homol- ogous" as used throughout the ensuing specification and claims, is meant a degree of homology to the native IL-l inhibitor iso- lated from monocyte-conditioned medium in excess of that dis- played by any previously reported IL-l inhibitors. Preferably, the degree of homology in excess of 70 percent, more preferably in excess of 80 percent and even more preferably in excess of 90 per cent. A particularly preferred group of inhibitors are in excess of 95 percent homologous with the native inhibitor. The percentage of homology as described is calculated as the percent- age of amino acid residues found in the smaller of the two sequences that align with identical amino acid residues in the sequence being compared when four gaps in a length of lOO amino acids may be introduced to assist in that alignment as set forth by Dayhoff, M.D. in Atlas of Protein Sequence and Structure Vol.5, p. 124 (1972), National Biochemical Research Foundation, Washington, D.C., specifically incorporated herein by reference.

The preferred IL-l inhibitors of the present invention have been derived from monocyte-conditioned medium and, for the first time, have been isolated in a purified form. For the purposes of the present application, "pure form" or "purified form" when used to refer to the IL-1 inhibitors disclosed herein, shall mean a preparation which is substantially free of other proteins which are not IL-1 inhibitor proteins. Preferrably, the IL-1 inhib- itors of the present invention are at least 90% pure and prefer- ably 9S% pure.

At least three purified IL-1 inhibitors have been isolated by the methods of the Example. These include inhibitor 1, inhib- itor 2 and inhibitor 3. Inhibitor l is behaving as a 22-23 kDa molecule on SDS-PAGE with an approximate isoelectric point of 4.8 and eluting from a Mono:Q FPLC column at around 52 mM NaCl in Tris buffer, pH 7.6. Inhibitor 2 is also a 22-23 kDa protein, pI=4.8, but eluting from a Mono Q column at 60 mM NaCl. Inhib- itor 3 is a 20kDa protein and elutes from a Mono Q column at 48 mM Nacl. Inhibitors l, 2 and 3 are related immunologically and functionally. Having obtained these inhibitors in purified forms has enabled the present inventors to obtain their amino acid -12.. sequences. Using the purified inhibitors disclosed for the first time herein and methods such as those described in and by ABI Protein Sequencer technical manuals supplied with the ABI Protein Sequencer, a substantial proportion of the amino acid sequences of these inhibitors can be deduced.

Example 3 shows amino acid sequence data obtained of three species of IL-1 inhibitors, namely IL-li—X, IL-li-o and [L-li-B.

The present inventors have discovered at least one antibody raised against an IL-l inhibitor. Other polyclonal and monoclonal antibodies against this and other IL-l inhibitors may be prepared by methods known to those of ordinary skill in the art. one particular polyclonal antibody is described in Example 4.

B. Recombinant Inhibitor 1. General A recombinant DNA method for the manufacture of an IL-1 inhibitor is now disclosed. In one embodiment of the invention, the active site functions in a manner biologically equivalent to that of the native IL-l inhibitor isolated from human. A natural or synthetic DNA sequence may be used to direct production of the IL-1 inhibitors» This method comprises: (a) Preparation of a DNA sequence capable of directing a host cell to produce a protein having IL-l inhibitor activity; (b) Cloning the DNA sequence into a vector capable of being transferred into and replicated in a host cell, such vector containing operational elements needed to express the DNA sequence; (c) Transferring the vector containing the synthetic DNA sequence and operational elements into a host cell capa- ble of expressing the DNA encoding IL-l inhibitor; (d) culturing the host cells under conditions appro- priate for amplification of the vector and expression of the inhibitor; (e) Harvesting the inhibitor; and (f) Permitting the inhibitor to assume an active ter- tiary structure whereby it possesses IL-l inhibitory activ- ity.

. DNA Sequences DNA sequences contemplated for use in this method are discussed in part in Example 5 and in part in Example 6. It is contemplated that these sequences include synthetic and natural DNA sequences. The natural sequences further include cDNA or genomic DNA segments.

Figure 14 shows the partial DNA sequence of the EcoRI fragment.

In light of the teachings contained herein and procedures known, other synthetic polynucleotide sequences will be available to one of ordinary skill in the art. As an example of the cur- rent state of the art relating to polynucleotide synthesis, one is directed to Matteucci, M.D. and Caruthers, M.H., in J. Am.

Chem. Soc. l03:3l85 (1981) and Beaucage, S.L. and Caruthers, M.H. in Tetrahedron Lett. 22:l859 (1981), and to the instructions supplied with an ABI oligonucleotide synthesizer, each of which is specifically incorporated herein by reference.

These synthetic sequences may be identical to the natural sequences described in more detail below or they may contain dif: ferent nucleotides. In one embodiment, if the synthetic se- quences contain nucleotides different from those found in the natural DNA sequences of this invention, it is contemplated that these different sequences will still encode a polypeptide which has the same primary structure as IL-li isolated from monocytes.

In an alternate embodiment, the synthetic sequence containing different nucleotides will encode a polypeptide which has the same biological activity as the IL-li described herein.

Additionally, the DNA sequence may be a fragment of a natu- ral sequence, i.e., a fragment of a polynucleotide which occurred in nature and which has been isolated and purified for the first time by the present inventors. In one embodiment, the DNA se- quence is a restriction fragment isolated from a CDNA library.

In an alternative embodiment, the DNA sequence is isolated from a human genomic library. .An example of such a library useful in this embodiment is set forth by Lawn et al. in Cell l5:ll57-1174 (l978L In a preferred version of this embodiment, it is contem- plated that the natural DNA sequence will be obtained by a method comprising: (a) Preparation of a human CDNA library from cells, preferably monocytes, capable of generating an IL-l inhib- itor in a vector and cell capable of amplifying and expressing all or part of that cDNA; (b) Probing the human DNA library with at least one probe capable of binding to the IL-1 inhibitor gene or its protein product: (C) Identifying at least one clone containing the gene coding for the inhibitor by virtue of the ability of the clone to bind at least one probe for the gene or its protein product: (d) Isolation of the gene or portion of the gene coding for the inhibitor from the clone or clones chosen: (e) Linking the gene, or suitable fragments thereof, to operational elements necessary to maintain and express the gene in a host cell.

The natural DNA sequences useful in the foregoing process may also be identified and isolated through a method comprising: (a) Preparation of a human genomic DNA library, pref- erably propagated in a gggA;gg8C E. coli host; (b) Probing the human genomic DNA library with at least one probe capable of binding to an IL-l inhibitor gene or its protein product: (c) Identification of at least one clone containing the gene coding for the inhibitor by virtue of the ability of the clone to bind at least one probe for the gene or its protein product; (d) Isolation of the gene coding for the inhibitor from the clone(s) identified; and (e) Linking the gene, or suitable fragments thereof, to operational elements necessary to maintain and express the gene in a host cell.

In isolating a natural DNA sequence suitable for use in the above-method, it is preferred to identify the two restriction sites located within and closest to the end portions of the appropriate gene or sections of the gene. The DNA segment con- taining the appropriate gene is then removed from the remainder of the genomic material using appropriate restriction endo- nucleases. After excision, the 3' and 5' ends of the DNA se- quence and any exon junctions are reconstructed to provide appro- priate DNA sequences capable of coding for the N- and C- termini of the IL-1 inhibitor protein and capable of fusing the DNA se- quence to its operational elements.

. Vectors (a) Microorganisms, especially E. coli The vectors contemplated for use in the present inven- tion include any vectors into which a DNA sequence as discussed above can be inserted, along with any preferred or required oper- ational elements, and which vector can then be subsequently transferred into a host cell and replicated in such cell. Pre- ferred vectors are those whose restriction sites have been well documented and which contain the operational elements preferred or required for transcription of the DNA sequence.

However, cer- tain embodiments of the present invention are also envisioned which employ currently undiscovered vectors which would contain one or more of the cDNA sequences described herein. In particu- lar, it is preferred that all of these vectors have some or all of the following characteristics: (I) possess a minimal number of host-organism sequences; (2) be stably maintained and propa- gated in the desired host; (3) be capable of being present in a high copy number in the desired host; (4) possess a regulatable promoter positioned so as to promote transcription of the gene of interest: (5) have at least one marker DNA sequence coding for a selectable trait present on a portion of the plasmid separate from that where the DNA sequence will be inserted; and (6) a DNA sequence capable of terminating transcription.

In various preferred embodiments, these cloning vectors con- taining and capable of expressing the DNA sequences of the pres- ent invention contain various operational elements. These "oper- ational elements," as discussed herein, include at least one promoter, at least one Shine-Dalgarno sequence and initiator codon, and at least one terminator codon. Preferably, these "op- erational elements" also include at least one operator, at least one leader sequence for proteins to be exported from intracell- ular space, at least one gene for a regulator protein, and any other DNA sequences necessary or preferred for appropriate tran- scription and subsequent translation of the vector DNA.

Certain of these operational elements may be present in each of the preferred vectors of the present invention.

It is contem- plated that any additional operational elements which may be re- quired may be added to these vectors using methods known to those of ordinary skill in the art, particularly in light of the teach- ings herein.

In practice, it is possible to construct each of these vectors in a way that allows them to be easily isolated, assem- bled and interchanged. This facilitates assembly of numerous functional genes from combinations of these elements and the coding region of the DNA sequences. Further, many of these ele- ments will be applicable in more than one host. It is addition- ally contemplated that the vectors, in certain preferred embodi- ments, will contain DNA sequences capable of functioning as regulators ("operators"), and other DNA sequenes capable of coding for regulator proteins. (i) Regulators These regulators, in one embodiment, will serve to prevent expression of the DNA sequence in the presence of certain envi- ronmental conditions and, in the presence of other environmental conditions, will allow transcription and subsequent expression of the protein coded for by the DNA sequence. In particular, it is preferred that regulatory segments be inserted into the vector such that expression of the DNA sequence will not occur, or will occur to a greatly reduced extent, in the absence of, for exam- ple, isopropylthio-beta-D-galactoside. In this situation, the transformed microorganisms containing the DNA sequence may be grown to at a desired density prior to initiation of the expres- sion of IL-li. In this embodiment, expression of the desired protein is induced by addition of a substance to the microbial environment capable of causing expression of the DNA sequence after the desired density has been achieved. (ii) Promoters The expression vectors must contain promoters which can be used by the host organism for expression of its own proteins. while the lactose promoter system is commonly used, other micro- bial promoters have been isolated and characterized, enabling one skilled in the art to use them for expression of the recombinant IL-li. (iii) Zggnscription Terminator The transcription terminators contemplated herein serve to stabilize the vector. In particular, those sequences as described by Rosenberg, M. and Court, D., in Ann. Rev. Genet. i;:3i9—3s3 (1979), are contemplated for use in the present invention. (iv) Non—Translated Sequence It is noted that, in the preferred embodiment, it may also be desirable to reconstruct the 3' or 5' end of the coding region to allow incorporation of 3' or 5' non—translated sequences into the gene transcript. Included among these non-translated se- quences are those which stabilize the mRNA as they are identified by Schmeissner, U., Mcxenney, K., Rosenberg, M and Court, D. in (v) Ribosome Binding Sites The microbial expression of foreign proteins requires cer- tain operational elements which include, but are not limited to, ribosome binding sites. A ribosome binding site is a sequence Additionally, it is preferred that DNA coding for an appro- priate secretory leader (signal) sequence be present at the 5' end of the DNA sequence as set forth by Watson, M.E. in Nucleic Acids Res. _g:Sl4S-5163, if the protein is to be excreted from the cytoplasm. The DNA for the leader sequence must be in a position which allows the production of a fusion protein in which the leader sequence is immediately adjacent to and covalently joined to the inhib- itor, i.e., there must be no transcription or translation termi- nation signals between the two DNA coding sequences. The pres- ence of the leader sequence is desired in part for one or more of the following reasons.

First, the presence of the leader se- quence may facilitate host processing of the IL-li. In particu- lar, the leader sequence may direct cleavage of the initial translation product by a leader peptidase to remove the leader sequence and leave a polypeptide with the amino acid sequence which has potential protein activity. Second, the presence of the leader sequence may facilitate purification of the IL-li, through directing the protein out of the cell cytoplasm. in some species of host microorganisms, the presence of an appropriate leader sequence will allow transport of the completed protein into the periplasmic space, as in the case of some E. coli. In the case of certain E. coli, saccharomvces and strains of Bacillus and Pseudomonas, the appropriate leader sequence will allow transport of the protein through the cell membrane and into the extracellular medium. In this situation, the protein may be purified from extracellular protein. Thirdly, in the case of some of the proteins prepared by the present invention, the pres- ence of the leader sequence may be necessary to locate the com- pleted protein in an environment where it may fold to assume its active structure, which structure possesses the appropriate pro- tein activity.

In one preferred embodiment of the present invention, an additional DNA sequence is located immediately preceding the DNA sequence which codes for the IL-1 inhibitor. The additional DNA sequence is capable of functioning as a translational coupler, i.e., it is a DNA sequence that encodes an RNA which serves to position ribosomes immediately adjacent to the ribosome binding site of the inhibitor RNA with which it is contiguous. In one embodiment of the present invention, the translational coupler may be derived using the DNA sequence 10TAACGAGGCGCAAAAAATGAAAAAGACAGCTATCGCGATCTTGGAGGATGATTAAATG and methods currently known to those of ordinary skill in the art re- lated to translational couplers. (vii) Translation Terminator The translation terminators contemplated herein serve to 15stop the translation of mRNA. They may be either natural, as sized. as described by Pettersson, R.F. Gene gg:15-27 (l983L (viii) Selectable Marker Additionally, it is preferred that the cloning vector con- tain a selectable marker, such as a drug resistance marker or other marker which causes expression of a selectable trait by the host microorganism. In one embodiment of the present invention, the gene for ampicillin resistance is included in the vector while, in other plasmids, the gene for tetracycline resistance or the gene for chloramphenicol resistance is included.

Such a drug resistance or other selectable marker is intend- ed in part to facilitate in the selection of transformants.

Additionally, the presence of such a selectable marker in the cloning vector may be of use in keeping contaminating microorga- nisms from multiplying in the culture medium. In this embodi- ment, a pure culture of the transformed host microorganisms would be obtained by culturing the microorganisms under conditions which require the induced phenotype for survival.

The operational elements as discussed herein are routinely selected by those of ordinary skill in the art in light of prior literature and the teachings contained herein. General examples of these operational elements are set forth in B. Levin, ggggg.

Wiley & Sons, New York (l983L various examples of suitable operational elements may be found on the vectors discussed above and may be elucidated through review of the publications discussing the basic characteristics of the aforementioned vectors.

Upon synthesis and isolation of all necessary and desired component parts of the above-discussed vector, the vector is assembled by methods generally known to those of ordinary skill in the art. Assembly of such vectors is believed to be within the duties and tasks performed by those with ordinary skill in the art and, as such, is capable of being performed without Undue experimentation. For example, similar DNA sequences have been ligated into appropriate cloning vectors, as set forth by Ma- niatis et al. in Molecular Cloning, Cold Spring Harbor Laboratories (1984).

In construction of the cloning vectors of the present inven- tion, it should additionally be noted that multiple copies of the DNA sequence and its attendant operational elements may be in- serted into each vector. In such an embodiment, the host organ- ism would produce greater amounts per vector of the desired IL-1 inhibitor. The number of multiple copies of the DNA sequence which may be inserted into the vector is limited only by the ability of the resultant vector, due to its size, to be trans- ferred into and replicated and transcribed in an appropriate host cell. (b) Other Microorganisms Vectors suitable for use in microorganisms other than g; ggli are also contemplated for this invention. Such vectors are described in Table 1. In addition, certain preferred vectors are discussed below.

HUHMHDOO HICOCI coauwamwo wumnmmozm cowuwamwv m can A 92. N umm mmouflo . XS n ma: uouomm mcm~< uouumu n:ma< omouumamo nna nu: mwmmu cam can :04 umnmmozw U404 ac: couuoamwu «mod son an: wnonauuo>:n a uao umouaao .HnH Haw ummww UBWH Saou .589 coauwamov oncauheoumouum mm< cwxouoxw :m:moum>uu no Auaou .mvumJ mmcoe Aaaou .mv mus omwcasmcouasm mmu wmmmaaonmmonm .:owuHvum < mmcamfiaaunsm . 5.5 .m 2.3 o~Tummm wmmaaam m¢-m. ~ ad muomoahadumnmac >Ed.m umzmam >Ed.m wacamaaaunznc mm uamu Amomamuoum oNH.Hm cuu >aomm~>Ew omuououm Hausa: >ed.m ¢~ ucux Hnuunoc >Ec.m .m mcmau. wsaaaumm coauwamwn cmzmoumauu no coflufloum ¢4H amuwcazmmuoacu monm wuaumuwmewu mmuh mA.¢Hw:qHu>umuuou Nacmeo muca nucuu Uommouucw gm munemq Zcfifiufieu 332 card 2;: Nona Jun... Sou .u meam UZHQZHQ m5E mm a maum am a4zoHa Afimumzfifi A u.::F Backman, K., Ptashne, M. and Gilbert, W. Proc. Natl. Acad, Sci. USA 1;, 4174-4178 (1976). de Boer, H.A., Comstock, L.J., and Vasser, M. Proc. Natl.

Acad. Sci. USA gg, 21-25 (1983).

Shimatake, H.

Derom, C., Gheysen, D. and Fiers, W. Gene 11, 45-54 (1982).

Hallewell, R.A. and Emtage, 5. Gene 9, 27-47 (1980).

Brosius, J., Dull, T.J., Sleeter, D.D. and Noller, H.F. J.

Mol. Biol. 143 107-127 (1931).

Normanly, J., Ogden, R.C., Horvath, S.J. and Abelson, J.

Nature 321, 213-219 (1986). - Belasco, J.G., Nilsson, G., von Gabain, A. and Cohen, S.N.

Cell 46, 245-251 (1986).

Schmeissner, U., Mcxenney, K., Rosenberg M. and Court, D.

J. Mol. Biol. 176, 39-53 (1984).

Mott, J.E., Galloway, J.L. and Platt, T. EMBO J. g, 1887- 1891 (1985).

Koshland, D. and Botstein, D. Cell gg, 749-760 (1980).

Movva, N.R., Kakamura, K. and Inouye, M. J. Mol. Biol. , 317-328 (1980).

Surin, B.P., Jans, D.A., Fimmel, A.L., Shaw, D.C., Cox, G.B. and Rosenberg, H. J. Bacteriol. 157, 772-778 (1984).

Sutcliffe, J.G. Proc. Natl. Acad. Sci. USA 1;, 3737-3741 (1978).

Peden, K.W.C. Gene 2;, 277-280 (1983). 864-869 (1979).

Alton, N.K. and Vapnek, 2. Nature 282, Yang,\M., Galizzi, A., and Henner, D. Nuc. Acids Res. (2), 237-248 (1983).

Wong, S.-L., Price, C.W., Goldfarb, D.S., and Doi, R.H.

Proc. Natl. Acad. Sci. USA 81, 1184-1188 (1984).

Wang, P.-z., and Doi, R.H. J. Biol. Chem. 251, 8619-8625, (1984). and Rosenberg, M. Nature 2 2, 128-132 (1981). . 27. . 29. . . 37.

Lin, C.-K., Quinn, L.A. Rodriquez, R.L. J. Cell Biochem.

Suppl. (98), p. 198 (1985).

Vasantha, N., Thompson, L.D., Rhodes, C., Banner, C., Nagle, J., and Filpula, D. J. Bact. 159(3), 811-819 (1984).

Palva, I., Sarvas, M., Lehtovaara, P., Sibazkov, M., and Kaariainen, L. Proc. Natl. Acad. Sci. USA 12, 5582-5585 (1932).

Sullivan, M.A., Yasbin, R.E., and Young, F.E. Gene 33, 21-46 (1984).

Vasantha, N., Thompson, L.D., Rhodes, C., Banner, C. Nagle, J., and Filula, D. J. Bact. 159(3), 811-819 (1984).

Yansura, D.G. and Henner, D.J. PNAS 81, 439-443 (1984).

Gray, G.L., McKeown, K.A., Jones, A.J.S., Seeburg, P.H. and Heyneker, H.L. Biotechnology, 161-165 (1984).

Lory, S., and Tai, P.C. Gene 2;, 95-101 (1983).

Liu, p.v. J. Infect. Dis. 130 (Suppl), 594-599 (1974).

J. Bact. 145, Wood, D.G., Hollinger, M.F., nd Tindol, M.B. 1448-1451 (1981).

St. John, T.P. and Davis, R.W. J. Mol. Biol. 152, 285-315 (1981).

Hopper, J.E., and Rowe, L.B. J. Biol. Chem. 2 3, 7566-7569 (1978).

Denis, C.L., Ferguson, J. and Young, E.T. J. Biol. Chem. , 1155-1171 (1933).

Lutsdorf, L. and Megnet, R. Archs. Biochem. Biophys. 126, 933-944 (1968).

Meyhack, 8., Bajwa, N., Rudolph, H. and Hinnen, A. EMBO. J. 6, 675-680 (1982).

Watson, M.B. Nucleic Acid Research 1;, 5145-5164 (1984).

Gerband, C. and Guerineau, M. Curr. Genet. 1, 219-228 (1980).

Hinnen, A., Hicks, J.B. and Pink, G.R. P:roc. Natl. Acad.

Sci. USA 1;, 1929-1933 (1978).

Jabbar, M.A., Sivasubramanian, N. and Nayak, D.P. Proc.

Natl. Acad. Sci. USA 8;, 2019-2023 (1985). -27a- (i) Pseudomonas Vectors Several vector plasmids which autonomously replicate in a broad range of Gram negative bacteria are preferred for use as cloning vehicles in hosts of the genus Pseudomonas. Certain of these are described by Tait, R.C., Close, T.J., Lundquist, R.C Hagiya, M., Rodriguez, R.L., and Kado, C.I. In Biotechnology, May, 1983, pp. 269-275; Panopoulos, N.J. in Genetic Engineering in the Plant Sciences, Praeger Publishers, New York, New York, pp. 163-185 (1981): and Sakagucki, K. in Current Topic in one particularly preferred construction would employ the plasmid RSFl0l0 and derivatives thereof as described by Bagdasarian, M., Bagdasarian, M.M., Coleman, S., and Timmis, K.N. in Plasmids of Medical,/gngironmentgl and Commercial Importance, Timmis, K.N. and Puhler, A. eds., Elsevier/North Holland Biomedical Press (1979L r The advantages of RSFl0l0 are that it is relatively a small, high copy number plasmid which is readily transformed into and stably maintained in both E. coli and ggggggmgngg species.

In this system, it would be preferred to use the Tao expression system as described for Escherichia, since it appears that the g; coli Mcxeown, K.A., Jones, A.J.S., Seeburg, P.H., and Heyneker, H.L. in Biotechnology, Feb. 1984, pp. 161-165.

Transcriptional activity may be further maximized by requiring the exchange of the promoter with, e.g., an E. coli or P. aeruqinosa trp promot- er. Additionally, the lacl gene of E. coli would also be includ- ed in the plasmid to effect regulation.

Translation may be coupled to translation initiation for any of the Pseudomonas proteins, as well as to initiation sites for any of the highly expressed proteins of the type chosen to cause intracellular expression of the inhibitor.

In those cases where restriction minus strains of a host Pseudomonas species are not available, transformation efficiency with plasmid constructs isolated from E. coli are poor.‘ There- fore, passage of the Pseudomonas cloning vector through an r- m+ strain of another species prior to transformation of the desired host, as set forth in Bagdasarian, M., et a1., Plasmids of Medical, Environmental and Commercial Importance, pp. 411-422, Timmis and Puhler eds., Elsevier/North Holland Biomedical Press (1979) is desired . (ii) Bacillus Vectors Furthermore, a preferred expression system in hosts of the genus Bacillus involves using plasmid pUBl10 as the cloning vehicle. As in other host vector systems, it is possible in Bacillus to express the IL-1i of the present invention as either an intracellular or a secreted protein. The present embodiments ,Academic Press, include both systems. Shuttle vectors that replicate in both Bacillus and E. coli are available for constructing and testing various genes as described by Dubnau, D., Gryczan, T., Contente, S., and Shivakumar, A.G. in Genetic Engineering, Vol. 2, Setlow and Hollander eds., Plenum Press, New York, New York, pp. llS-131 (1980). For the expression and secretion of the IL-li from B. subtilis, the sig- nal sequence of alpha-amylase is preferably coupled to the coding region for the protein. For synthesis of intracellular inhib- itor, the portable DNA sequence will be translationally coupled to the ribosome binding site of the alpha-amylase leader se- quence.

Transcription of either of these constructs is preferably directed by the alpha-amylase promoter or a derivative thereof.

This derivative contains the RNA polymerase recognition sequence of the native alpha-amylase promoter but incorporates the lac op- erator region as well. Similar hybrid promoters constructed from the penicillinase gene promoter and the lac operator have been shown to function in Bacillus hosts in a regulatable fashion as set forth by Yansura, D;G. and Henner in Genetics and Biotechnology of Bacilli, Ganesan, A.T. and Hoch, J.A., eds., pp. 249-263 (l984L The lacI gene of E. coli would also be included in the plasmid to effect regulation. (iii) Clostridium Vectors One preferred construction for expression in Clostridium is in plasmid pJUl2, described by Squires, C.H. et al., in J. transformed into C. perfringens by the method of Heefner, D.L. et al., as described in J. Bacteriol. l59:460-464 (1984). Tran- scription is directed by the promoter of the tetracycline resis- tance gene. Translation is coupled to the Shine—Dalgarno se- quences of this same tet’ gene in a manner strictly analogous to the procedures outlined above for vectors suitable for use in other hosts. (iv) Yeast vectors Maintenance of foreign DNA introduced into yeast can be effected in several ways as described by Botstein, D. and Davis, R.W., in The Molecular Biology of the Yeast Saccharomyces, Cold Spring Harbor Laboratory, Strathern, Jones and Broach, eds., pp. -636 (l982L One preferred expression system for use with host organisms of the genus Saccharomyces'harbors the IL-li gene on the 2 micron plasmid. The advantages of the 2 micron circle include rela- tively high copy number and stablility when introduced into cir° strains. These vectors preferably incorporate the replication origin and at least one antibiotic resistance marker from pBR322 the to allow replication and selection in E. coli. In addition, plasmid will preferably have the two micron sequence and the yeast LEU2 gene to serve the same purposes in LEU2 defective mu- tants of yeast.

If it is contemplated that the recombinant IL-1 inhibitors will ultimately be expressed in yeast, it is preferred that the cloning vector first be transferred into Escherichia coli, where the vector would be allowed to replicate and from which the vector would be obtained and purified after amplification. The vector would then be transferred into the yeast for ultimate expression of the IL-1 inhibitor. (c) Mammalian Cells The CDNA for the IL-1 inhibitor will serve as the gene for expression of the inhibitor in mammalian cells. It should have a sequence that will be efficient at binding ribsomes such as that (1987)] and growth. The vector should have a complete polyadenylation signal -32.. vas described by Ausubel, F.M. et al. in Current Protocols in Mo- lecular Biology, Wiley (l987), so that the mRNA transcribed from this vector is processed properly. Finally, the vector will have the replica- tion origin and at least one antibiotic resistance marker from pBR322 to allow replication and selection in E. coli.

In order to select a stable cell line that produces the IL-1 inhibitor, the expression vector can carry the gene for a se- lectable marker such as a drug resistance marker or carry a com- plementary gene for a deficient cell line, such as a dihydrofolate reductase (dhfr) gene for transforming a dhfr' cell line as described by Ausubel et al., supra. 3 separate plasmid carrying the selectable marker can be Alternatively, cotransformed along with the expression vector.

. Host Cells/Transformation The vector thus obtained is transferred into an appropriate host cell. These host cells may be microorganisms or mammalian cells.

Microorganisms is believed that any microorganism having the ability to take up exogenous DNA and express those genes and attendant oper- ational elements may be chosen. After a host organism has been chosen, the vector is transferred into the host organism using methods generally known to those of ordinary skill in the art.

Examples of such methods may be found in Advanced Bacterial Genetics by R. W. Davis et al., Cold Spring Harbor Press, Cold Spring Harbor, New York, (l98OL It is preferred, in one embodiment, that the transformation occur at low temperatures, as temperature regulation is contemplated as a means of regulating gene expres- sion through the use of operational elements as set forth above.

In another embodiment, if osmolar regulators have been inserted into the vector, regulation of the salt concentrations during the transformation would be required to insure appropriate control of the foreign genes.

It is preferred that the host microorganism be a facultative anaerobe or an aerobe. Particular hosts which may be preferable for use in this method include yeasts and bacteria. Specific yeasts include those of the genus Saccharomyces, and especially Saccharomvces cerevisiae. Specific bacteria include those of the genera gacillus, Escherichia, and Pseudomonas, especially Bacillus subtilis and Escherichia coli. Additional host cells are listed in Table 1, supra. (b) Mammalian Cells The vector can be introduced into mammalian cells in culture by several techniques such as calcium phosphate:DNA coprecipita- tion, electroporation, or protoplast fusion. The preferred meth- od is coprecipitation with calcium phosphate as described by Ausubel gg_al., ggpgg.

Many stable cell types exist that are transformable and capable of transcribing and translating the cDNA sequence, pro- cessing the precursor IL—li and secreting the mature protein.

However, cell types may be variable with regard to glycosylation of secreted proteins and post-translational modification of amino acid residues, if any. Thus, the ideal cell types are those that produce a recombinant IL-1 inhibitor identical to the natural molecule.

. Culturinq Enqineered Cells The host cells are cultured under conditions appropri- ate for the expression of the IL-1 inhibitor. These conditions are generally specific for the host cell, and are readily deter- mined by one of ordinary skill in the art in light of the pub- lished literature regarding the growth conditions for such cells and the teachings contained herein. For example, Bergey's Manual of Determinative Bacteriology: 8th Ed., Williams & Wilkins Com- pany, Baltimore, Maryland, contains information on conditions for culturing bacteria. Similar information on culturing yeast and mammalian cells may be obtained from Pollack, R. Mammalian Cell Culture, Cold Spring Habor Laboratories (l975L Any conditions necessary for the regulation of the expres- sion of the DNA sequence, dependent upon any operational elements inserted into or present in the vector, would be in effect at the transformation and culturing stages. In one embodiment, cells are grown to a high density in the presence of appropriate regu- latory conditions which inhibit the expression of the DNA se- quence. when optimal cell density is approached, the environmental conditions are altered to those appropriate for expression of the DNA sequence. It is thus contemplated that the production of the IL-1 inhibitor will occur in a time span subse- quent to the growth of the host cells to near optimal density, and that the resultant IL-1 inhibitor will be harvested at some time after the regulatory conditions necessary for its expression were induced.

. Purification (a) IL-li Produced From Microorganisms In a preferred embodiment of the present invention, the recombinant IL-1 inhibitor is purified subsequent to harvesting and prior to assumption of its active structure. This embodiment is preferred as the inventors believe that recovery of a high yield of re-folded protein is facilitated if the protein is first purified. However, in one preferred, alternate embodiment, the IL-1 inhibitor may be allowed re-fold to assume its active struc- ture prior to purification. In yet another preferred; alternate embodiment, the IL-1 inhibitor is present in its re-folded, active state upon recovery from the culturing medium.

In certain circumstances, the IL-1 inhibitor will assume its proper, active structure upon expression in the host microorga- nism and transport of the protein through the cell wall or mem- brane or into the periplasmic space. This will generallY OCCUV if DNA coding for an appropriate leader sequence has been linked to the DNA coding for the recombinant protein. If the IL-1 in- hibitor does not assume its proper, active structure, any disulfide bonds which have formed and/or any noncovalent interac- tions which have occurred will first be disrupted by denaturing and reducing agents, for example, guanidinium chloride and beta—mercaptoethanol, before the IL-1 inhibitor is allowed to assume its active structure following dilution and oxidation of these agents under controlled conditions.

For purification prior to and after refolding, some combina- tion of the following steps is preferably used: anion exchange chromatography (MonoQ or DEAE-Sepharose), gel filtration chromatography (superose), chromatofocusing (MonoP), and hydrophobic interaction chromatography (octyl or phenyl sepharose). of particular value will be antibody affinity chromatography using the IL-li-specific monoclonal antibodies (described in Example 3). (b) IL-li Produced from Mammalian Cells IL-li produced from mammalian cells will be purified from conditioned medium by steps that will include ion exchange chromatography and immunoaffinity chromatography using monoclonal antibodies described in Example 3. It will be apparent to those skilled in the art that various modifications and variations can be made in the processes and products of the present invention.

Thus, it is intended that the present invention cover the modifi- cations and variations of this invention provided they come within the scope of the appended claims and their equivalents.

It is to be understood that application of the teachings of the present invention to a specific problem or environment will -37.. be within the capabilities of one having ordinary skill in the art in light of the teachings contained herein. Examples of the products of the present invention and representative processes for their isolation and manufacture appear in the following.

The following examples illustrate various presently pre- ferred embodiments of the present invention.

EXAMPLES Example 1 — Protein Preparation A. Materials Hank's Balanced Salt Solution (HBSS) and RPMI were purchased from Mediatech. Washington. D.C. Lymphoprep was obtained from Accurate Chemical and Scientific Corp., westbury, N.Y.' Human IgG, MTT, rabbit anti-prostaglandin E2 antiserum, ammonium bicar- bonate, dithiothreitol, complete and incomplete Freundfs adjuvants, hypoxanthine, aminopterin, and thymidine were pur- chased from Sigma Chemical Co., St. Louis, Missouri. C3H/HeJ mice were purchased from Jackson Labs, Bar Harbor, Maine. BALB/c mice and P3 myeloma cells were obtained from Drs. John Kappler and Philippa Marrack at the National Jewish Center for Immunology and Respiratory Medicine (NJC/IRM), Denver, Colorado.

Recombinant human IL-1 was obtained from Cistron Biotechnology, Pine Brook, N.J. Purified phytohemagglutinin was purchased from Wellcome Diagnostics, Research Triangle Park, N.C. Human -38.. foreskin fibroblasts from primary cultures were obtained from Dr.

Richard Clark at the NJC/IRM, Denver, Colorado. Monoclonal mouse anti—rabbitt IgG antibodies were purchased from AIA reagents, Aurora, Colorado. Low methionine RPMI was made using a Select- Amine kit from GIBCO Laboratories, Grand Island, N.Y. id="p-358" id="p-358" id="p-358" id="p-358" id="p-358" id="p-358" id="p-358" id="p-358" id="p-358" id="p-358" id="p-358" id="p-358"

[358]-methionine, diphenyloxazole, and [l4C]-iodoacetic acid were obtained from DuPont-NEN, Chicago, Illinois. Fetal calf serum was purchased from Hyclone Laboratories, Logan, Utah. Mono Q and Superose 12 columns were purchased from Pharmacia, Inc., Piscataway, N.J. C4-reversed phase columns were obtained from Synchrom, Inc., Lafayette, Indiana. C8-reversed phase columns were obtained from Applied Biosystems, Inc., Foster City, California. Acetonitrile and polyethylene glycol 8000 were pur- chased from J. T. Baker Chemical Co., Pnillipsburg, N.J.

Trifluroacetic acid and guanidine hydrochloride were obtained from Pierce Chemicals, Rockford, Illinois. Endoproteinase Lys C was obtained from Boehringer Mannheim Biochemicals, Indianapolis.

Indiana. The microtitering plates used for PGB2 ELISA were Nunc-Immuno Plate I obtained from Intermountain Scientific Corpo- ration, Bountiful, Utah.’ The plates used for hybridoma produc- tion were from costar, Cambridge, Massachusetts.

. Generation of Monocyte IL-l Inhibitor Human leukocytes were obtained from normal donors by leukophoresis, resuspended in Hank's balanced salt solution (HESS) at 1 part packed cells to 1 part HESS, underlayed with Lymphoprep and spun at 400 xg for 30' at room temperature. The mononuclear fraction was taken (typically 4-5 X 109 cells were obtained per donor), washed in HBSS without Ca** or Mg++, sus- pended in serum-free RPMI and plated on petri dishes coated with normal human IgG made LPS free by chromatography over Sephapex G200 (6 X 107 cells in 10ml per 100 mm dish). All reagents con- tained less than 10 pg/ml LPS. The cells were cultured 24-48 hr, and the resulting conditioned medium constituted the crude IL-l inhibitor (IL-li) supernatant. Typically, the cells from one donor yielded 700-900 ml crude IL-li supernatant.

C. Assays for the IL-1 Inhibitor Two IL-l assays have been used routinely to detect the IL-li. Thymocytes (1 x 105 cells from 4 to 6 week old C3H/HeJ mice) respond to 1.0 unit/ml of recombinant human IL-1 plus 1 ug/ml phytohaemaglutinin by proliferating half-maximally, as mea- sured by 3H-thymidine incorporation or uptake of the tetrazolium three days of stimulation. Crude IL-li supernatant fully inhib- its this proliferative response at a 1/10 dilution. Human dermal fibroblasts (1 x 105 cells per well in a 96 well plate) typically respond to 0.5 units/ml recombinant human IL-1 by secreting, at 6 hours of stimulation, approximately 50,000 pg/ml PGE2 that can be measured by ELISA. This assay is as sensitive to IL-li as is the thymocyte assay.

D. Metabolic Labeling of the IL-1 Inhibitor -40..

The IL-li was metabolically labeled by culturing mononuclear leukocytes for 48 hours on IgG—coated plates (as described in B) in serum-free RPMI containing only 0.75 ug/ml cold methionine (1Sug/ml is normal) and to which was added 0.5 mCi 35$-methionine (1151 Ci/mmol) per 107 cells. Control labelings were performed identically except that the plates were coated with fetal calf serum rather than IgG. Assays on such control supernatants showed that very little IL—li was secreted when the cells were cultured on fetal calf serum-coated plates.

E. Purification of the IL-1 Inhibitor Protein Crude IL-li supernatants were made 1.0 M in sodium chloride, incubated on ice for 1 hour and centrifuged at 10,000 rpm for 15 minutes. The supernatants, which contained all of the inhibitor activity but only 20% of the initial protein, were then dialyzed extensively at 4°C versus 0.025M Tris, pH 7.6 containing 0.1% sucrose (the A buffer) for gradient fractionation of proteins on a Mono Q anion exchange column.‘ Following dialysis the inhibitor-containing solutions were recentrifuged at 10,000 rpm for 15 minutes and then passed through 0.22u nylon filters. The supernatants were typically combined with 10 ml of similarly pre- pared supernatant from a metabolic labeling and loaded onto Mono Q-superose (Pharmacia FPLC) columns with bed volumes of either 1.0 ml or 8.0 ml, washed with A buffer until the OD230 of the effluent returned to baseline, and carefully chromatographed using a linear sodium chloride gradient (.025M to .10M) in buffer A. Column fractions were collected and analyzed for radioactivity and bioactivity. Samples of each fraction were also run on reduced 12.5% SDS-PAGE, silver stained, permeated with diphenyloxazole, dried and put onto film to obtain autoradiographic data. Figure la shows the protein profile of the Mono Q chromatography of 40 ml crude IL-li supernatant mixed with 3 ml of metabolically labeled IL-li supernatant. Superim- posed are the amount of radioactivity found in 50 ul of each fraction as well as the IL-li bioactivity as measured in the PGE2-production assay. Two major and one minor radioactive spe- cies are shown that perfectly correlate with three peaks of bioactivity. Figure lb shows the similar chromatography of 15 ml of crude IL-li supernatant mixed with 3 ml of supernatant from monocytes metabolically labeled on plates coated with fetal calf serum (FCS) rather than IgG. The levels of the three radioactive species discussed above are markedly diminished. Figure 2a shows silver stained gels run on the fractions from the regions of in- terest in the chromatographies shown in Figures la and lb. Note that the fractions of peak radioactivity and bioactivity in Fig- ure la (fractions 52 and 59) both show a major band at 22 Rd (marked with arrows) on Sbs-PAGE. The third species (fraction 48 in Figure la) shows a band at 20kD on SDS-PAGE. Gel filtration experiments on crude IL-li have shown that the active molecule has a molecular weight of 18-25 Kd. Figure 2b is an autoradiogram of the gels shown in Figure 2a. It can be readily seen that the protein bands at 20 and 22 Rd are the major radio- active species in those fractions.

Summarizing these results, we have shown that the metabolic labeling of monocytes plated on petri dishes coated with IgG results in radioactive species that are only poorly produced if the cells are plated on dishes coated with FCS. These induced radioactive species perfectly co-chromatograph with several spe- cies of IL-li bioactivity on Mono Q, and gels and resulting autoradiograms show that the three major induced molecules are proteins of the predicted molecular weight for IL-li.

The IL-li molecules were further purified for sequencing in two ways. First, Mono Q fractions with peak bioactivity and ra- dioactivity were loaded onto a C4-reversed phase column and eluted with an H20/0.l%TFA: acetonitrile/0.l%TFA gradient.

Since the IL-li molecule was trace labeled, samples from each fraction were directly counted for radioactivity and were also analyzed by SDS-PAGE followed by autoradiography. Figure 3a shows such a chromatograph with the radioactivity pattern super- imposed. The silver stained gels run on samples from each frac- tion (Figure 3b) and subsequent autoradiograms of the gels (Fig- ure 3c) show~ that the IL-li molecule is found in fractions -36. Alterna- These fractions were dried down and sequenced. tively, the peak Mono Q fractions were dried by Speed Vac, resuspended in 0.4 ml 0.05 M NH4HCO3 and directly chromatographed two times on a 10 X 300mm Superose 12 gel filtration column (Pharmacia FPLC) equilibrated in the same buffer, as shown in Figs. 4a and 4b. Fractions were collected and samples of each were tested for radioactivity and bioactivity and were analyzed by silver stained and autoradiographed SDS-PAGE. Appropriate fractions were then dried on a speed vac and sequenced.

Example 2 Proposed Sequencinq of the IL-1 Inhibitor Prior to sequencing, samples were dissolved in 6 M guanidine-Hcl, pH 8.6, reduced for 4 hours at 37°C under N2 with 100-fold molar excess dithiothreitol over protein, and alkylated for 1 hour with 400-fold excess 14C-iodoacetic acid. In that case, the reactions would be desalted on a C8-reversed phase col- umn, eluted, and partially dried. N-terminal sequences will be determined using an Applied Biosystems Protein Sequencer. To obtain internal sequences, samples which may have been reduced and alkylated would be digested with cyanogen bromide or proteolytic enzymes using methods known to those of ordinary skill in the art. Reactions will be dried, dissolved in 0.1% TFA/H20, and peptides will be separated using a C8-reverse phase column.

Example 3 Purification and Sequencing of the Species of IL-1 Inhibitors A. IL-li-X, IL-li-a and IL-li-b Species The Mono Q purification of IL-li resolves the biological activity into three major species, as shown in Figure la and described in Example 1, where the peak fractions for this activity are 48, S2, and S9.

SDS—PAGE on samples of these frac- tions, as shown in Figure 2a, reveal pertinent species at 20 kD, RD, and 22kD, respectively. Western analysis of such gels, using the mouse antisera discussed in Example 4 below, stains all three of these species. when IL-li is prepared from cells metabolically labeled with 355-methionine, during growth on plates coated with IgG, each of these bands is radioactive (as shown in Figure 2b, the autoradiogram of the above-mentioned gel). Based on the logic discussed in Example 1, namely that parallel cells incubated in a non-inducing condition do not pro- duce the IL-li bioactivity and do not produce these radioactive bands, we can conclude that these three species account for the biological activity. we have tentatively named these species IL- li-X, IL-li-a, and IL-li-b, respectively.

. Purification and Sequencing of IL-li-X Mono Q fractions containing IL-li-X and/or IL-li-a were fur- ther purified by reversed-phase HPLC chromatography on a Synchropak RP-4 (C4) column, and radioactive species were sub- mitted for sequence analysis. Numerous attempts at directly sequencing RP—HPLC-purified IL—li-a and IL~li—b have failed, sug- gesting that they are chemically blocked at their N-termini.

However, one preparation of IL-li-a (IL-li-aB2p42) yielded the following sequence: 15 2o 3 P S C R1(S S KI1Q A r__1 5 o v M Q and subsequent preparations of IL-li-X, similarly purified by C4 RP-HPLC, have produced the same sequence: '10 is PropKxF24 , 2° ‘ad - - — — — — - __HQAF_IQ_»’N_K_; PropKxF23 P....3K_i-KHQAI-'_I These are obviously part of the sequence found in the ini- tial attempt at sequencing IL-li-a.

It is the inventors‘ conclu- sion that the sequence data shown is the N-terminus of the 20 kD species called IL-li-X.

In these and all subsequent sequences an underlined position indicates either an inability to identify a residue or that ambi- guity exists with respect to the residue identified. when two or more residues are put in one position, it indicates that more than one amino acid was detected at that sequencing step, and the more likely correct residue is on top.

C. Generation, Purification, and sequencing of Peotides of IL-li-a and IL-li-b Since IL-li-a and IL-li-b are apparently chemically blocked at their N-termini, peptides of each were generated by endoproteinase digestion. Specifically, Mono Q fractions con- taining either IL-li—a or IL-li-b were passed through a 4.6x2S0 Hm C3-RPHPLC column (zorbax Protein Plus), an acceptable alterna- tive to the C-4 columns used in all previous experiments. Very gradual gradients (0.2% acetonitrile per minute at 0.5 ml/min) resolved the IL—li-a (Figure 8a,b) or IL-li-b (Figure 9a) away from the major contaminating radioactive species, human lysozyme.

The identities of the purified species were confirmed by the presence of a single, radioactive, 22 kD protein on SDS-PAGE and subsequent autoradiograms (Figures 8c,d and 9b). The proteins were hand-collected into siliconized glass tubes and to each was added 25 ml of a 0.2% Tween-20 solution. The IL-li-containing fractions were then reduced in volume on a Speed-Vac to 50 ml, brought up to 300 ml by the addition of 1% NH4HCO3, followed by the addition of 1 mg of endoproteinase. In the case of IL-li—a, the enzyme used was Endoproteinase Lys C (Boehringer-Mannheim), while IL-li—b was cleaved with Endoproteinase Asp N (Boehringer- Mannheim). Cleavage was carried out at 37°C for 16 hr, and then the volume of the reaction mix was reduced to 50 ml on a Speed Vac.

In the case of IL—li—a, the sample was directly chromatographed, whereas the IL-li-b sample was first reduced by the addition of 5ml of 50 mM dithiothreitol in 2 M Tris, pH 8.0. reacted for 30 min at 37°C, and then carboxymethylated by addi- tion of 1.1 umole 3H-iodoacetic acid in 10 ml ethanol (reacted 30 min at 37°C in the dark). Separation of the peptides was per’ formed on a 2.lx250 mm Brownlee Aquapore RP-300 (C8) narrow-bOF€ column at a flow rate of 100 ml/min using a Beckman HPLC out- fitted with microbore hardware and microbore-compatible pUmpS- A min O-100% linear gradient was used (H20/0.1% TFA to acetonitrile/0.1% TFA). The peptide separations are shown in -47..

Figures 10 and 11. The sequence information obtained is as fol- lows: l S 10 RaLysC-1+1 HQAF_I__DVNQK I S 10 15 20 K 25 P RaLysC~S3 _ F Y L _ N N Q L v A _ Y L Q G P N v N L E 2 Q I D 5 _ 3 1 5: Y RaLysC-61 _ F A T I R 3 2 H 1 5 RaLysC-31 r Y s Q 2 o V 15 N 20 c 2 s I r s RaLysC-37 _ Q n 5 r _ L Q L 2 A 3 R Q 5 Q L 5 2 Q 1 5 1o 15 2o RaLyaC-35 _ _ _ s r 3 L Q L 2 A v _ 1 r n L L 3 N 1 s 10 15 2o 25 Q K r r L c RAAspN-51 D v N 2 1 5 2 Y A R N N Q L v A 5 Y L Q G 2 N v N L 1 5 1o apAspK.a3 D 2 c v H v r K r Y P Q 1 s K 10 15 RBAspN-39 _ 2 5 c R K s 5 2 M Q A r 3 1 Q 1 5 } R£AspN-25 n K K F A r 1 R L H IIIUID-O Q R5AspN-30 D v H L K K 1 5 Two of the peptide sequences are obviously related to that which was obtained earlier from IL-li-X. One of these, RaLysC- , is an IL—li—a sequence, and the other, RbAspN—Sl, is an IL-li-b sequence, arguing that the three species of IL-li are at least closely related proteins if not chemically and/or physi- cally modified forms of a single original IL-li molecule. If the listed sequences are combined, the following composite sequences result: I-laLyIC| g . . . . . ..uupx.a3 . . . . . ..| DlCVHVf!}'Yl’QlD , ............ ..g.;,.c.3s,17 ........... .., I c aeblfllotlavxarnig C ‘I I----lALynC---| I--4aupu4s~.p oxnrnrtnazi These composite sequences appear to be present in no other known polypeptides listed in the most recently updated Protein Identification Resource Database (PIR 16.0). The inventors believe that these sequences, or minor variants thereof, -49.. represent a class of molecules that are capable of acting as IL-1 inhibitors.

Example 4 Preparation of Antibodies Soecific For the IL-1 Inhibitor Ten week old BALB/c mice were injected subcutaneously with IL-li that was partially purified (400-fold) from crude supernatants by Mono Q—chromatography, dialyzed versus PBS, and emulsified with Complete Freund's Adjuvant. Each mouse received the IL-li purified from 5 ml of crude supernatant. The mice were boosted every two weeks with an equivalent amount of IL-li emulsifed with Incomplete Freund's Adjuvant, and serum samples were taken from the tails seven days after each boost. Antisera were tested for anti-IL—li activity by Western analysis of transblots of the immunogen run on SDS-PAGE, as shown in Fig. 5a.

Fig. Sb shows that all of the mice were making anti-IL-li antibodies after three injections of IL-11.

Since monoclonal antibodies will be of great value in cloning the IL-li gene from an expression library, purifying the recombinant IL-li protein, and studying the biology of the mole- cule, we have begun the process of making a battery of monoclonal antibodies specific for Il-li. To produce 8 cell hybridomas, the above mice were injected intravenously with the same amount of IL—li in saline 24 hours prior to removal of the spleens.

Splenocytes were teased out of the spleens into cold balanced salt solution (BSS), washed two times with BSS, mixed with P3 myeloma cells at a ratio of 2 x 107 P3 cells per 108 splenic B -50.. cells and spun down. The cells were fused by the dropwise addi- tion of 1 ml of warm, gassed (5% CO2) PEG 6000 (40% polyethylene glycol 6000 : 60% minimal essential medium) to the dry pellet.

Fused cells were washed with BSS and resuspended in 10 ml of rich media (10% PBS) containing 2 x lO5 peritoneal cells per ml and the pellet was gently broken up using a 10 ml pipet. The volume was adjusted to 20 ml with the addition of more peritoneal cells in media, and the cells were plated out in 96 well plates at 0.1 ml/well. Plates were placed in a gas incubater and treated in the following manner thereafter: Day 1 - Add 3x HAT (hypoxanthine, aminopterin, thymidine) in rich medium to a final concentration of 1x Day 5 - Change medium, replacing with 200 ul lx HAT in rich medium Day 10 - Begin checking for hybrid growth. Change medium, replacing with 200 ul lx HAT in rich medium containing 1.5 x 105 peritoneal cells per ml.

When hybrid cells are nearly confluent in a well the supernatants are transfered for testing, and the cells are gently scraped with a pipet tip and transfered to 1 ml culture wells containing lx HAT in rich medium plus 3 x 106 peritoneal cells per ml.

The supernatants from the confluent wells are tested for anti-IL-li activity using an ELISA in which partially purified IL-li (Mono Q-purified material identical to that injected into the mice) is bound to microtitering wells. Normal mouse sera and hyperimmune antisera are used as the negative and positive controls, respectively. 'Positive supernatants will be retested by ELISA on plates coated with homogeneously purified IL-li and by immunoprecipitation of purified metabolically labeled IL-li. Positive cells will then be cloned by limiting dilution and injected into pristane—treated mice for the generation of ascites. Large quantities of IL-li—specific antibodies can be produced by tissue culture or by massive generation and collection of ascitic fluid in mice. Purification of these antibodies and attachment thereof to insoluble beads will produce affinity adsorbents for the purification of the recombinant IL-li protein.

Example 5 Cloninq the IL-li cDNA It was shown that monocytes plated on IgG-coated petri dishes and cultured for 24 hours in the presence of id="p-358" id="p-358" id="p-358" id="p-358" id="p-358" id="p-358" id="p-358" id="p-358" id="p-358" id="p-358" id="p-358" id="p-358"

[358]-methionine produced [355]-IL-li which could be identified zoby its chromotographic properties on Mono Q.

In order to determine when (during the 24 hour period) IL-li was being produced at a maximal rate, plated monocytes were exposed to [355]-methionine (pulsed) for a short, two-hour peri- od, at which time a large excess of unlabelled methionine was Zsadded and incubated for an additional two hours. The medium was then collected and analyzed for radiolabelled IL-li. This procedure was applied to monocytes at various times after plating of IgG-coated plates and it was found that exposing monocytes to id="p-353" id="p-353" id="p-353" id="p-353" id="p-353" id="p-353" id="p-353" id="p-353" id="p-353" id="p-353" id="p-353" id="p-353"

[353]-methionine at 15 hours after plating produced the maximal amount of [355]-IL-li, indicating that IL-li mRNA in monocytes was at its maximal level 15 hours after plating on IgG.

Fresh monocytes were then plated on LPS free IgG obtained as in Example 13. After incubating in RPMI media for 15 hours at 37°C, the cells are washed with phosphate buffered saline then lysed with 4M guanidinium thiocyanate; 25 mM sodium citrate, OpH 7, 0.5% sarcosyl, 0.13 2—mercaptoethanol. Total RNA was then isolated from this lysate by the AGPC method of P. Chomczynski and N. Sacchi described in Analytical Biochemistry, vol. 162, pp. 156-159 (1987).

Poly A‘ RNA was isolated by oligo dT cellulose The CDNA was incorporated into a lambda gtll expression li- brary using ggo R1 linkers from Boehringer Mannheim catalog No. 988448 or New England Bio Lab No. 1070 and instructions provided by these manufacturers.

The resulting library, which contains 105 independent Zsclones, was screened on E. coli Yl090 rk' (Promega Biotec) with an appropriate polyclonal antibody to IL-li as described previously using screening conditions described by R. A. Young Positive signals will be detected using a biotinylated second antibody (such as goat anti-mouse IgG, Bethesda Research Labs) followed by a strepavidin-alkaline phosphatase conjugate (Bethesda Research Labs), as described by Bayer, E. A. and Wilchek, M. (1979) in Methods in Biochemical Analysis, and Guesdon, J. L. Ternynch, T. and Avrameas, S. (1979) J. Histochem. Cytochem. _1:l13l-1138 and according to manufacturer's instructions.

Example 6 Preparation and Sequencing of Gene Encoding IL-1i CDNA prepared as described in Example 5 was incorporated into the cloning vector lambda GTIO. This cDNA was first (antisense) probes were synthesized based on protein and peptide sequence presented in Example 3.

The sequences of the probes and of their corresponding peptide sequence are as follows. -54..

Probe Probe Probe Prcbe Probe Note: aIL1i1-3 TTETACGTE Lys Met Gln HL111-4 mgugng Lyn Phc Ty: nun-5 TACCANTGN Mat val Th: :11.111-5 c'rgcAN'r'rg Asp Val Asn , A T 'r #IL1i17 TTGGTCTTC Asn Gln Lys N-A,G,C,and'I‘ - are T G N Probe #ILlil-3 was 32?-phosphorylated at its 5' end and used to screen 3x105 plaques of the library. The probe hybridized reproducibly to three plaques, and out of these, one plaque was shown to also hybridize to probe #lLlil-4. This plaque, GTlO— ILli-2A, was cultivated and the DNA was isolated using Lambdasorb (Promega) according to the manufacturer's instructions.

GTlO-lLli-2A has been deposited at American Type Culture Collec- tion (ATCC) in Rockville, Maryland under Accession No. 40488.

England Biolabs) which are useful as molecular weight markers.

In order to demonstrate more conclusively that this 1850 bp fragment carries coding sequence for the ILI inhibitor, a South- ern blot was performed as follows. The DNA fragments in the gel shown in Figure 12a were blotted onto nitrocellulose using stan- dard methods. The nitrocellulose was then cut lengthwise into five strips such that each strip contained the DNA from lanes 6, 8, l0, l2, and l4. The strips were then individually hybridized to each of the five oligonucleotide probes (above) which were labeled at the 5' end with 32? phosphate. The oligonucleotide concentration was l pmole/ml and the hybridization temperatures were as follows.

LANE PROBE V TEMPERATURE 6 #ILlil-3 35°C 8 #ILlil-4 42°C 1‘ #IL1i1-5 42°C 12 #ILlil-6 40°C 14 #ILlil-7 35°C After washing, the strips were lined up and taped together to reform the original nitrocellulose sheet. This was autoradiographed in the presence of an intensifying screen at -70°C for 24 hours. Figure 12b is a photograph of this autoradiograph. It provides evidence that all of the probes hy- bridize specifically to the 1850 bp fragment, proving that this fragment carries substantial coding sequences for the IL-1 inhib— itor.

In order to determine its DNA sequence, GT10—IL—li—2A DNA was beta-galactosidase activity. Five such transformants were iso- _25 lated, single-stranded DNA was prepared, and sequencing was -57.. performed according to Sanger et al. The DNA sequence of three of the transformants corresponded to the 3' end of the mRNA, while two transformants provided protein coding sequence.

Figure 14 shows the predicted amino acid sequence.

Example 7 Sequencing GT10—IL-li-2A and IL—li A portion of GTlO—IL—li—2A has been sequenced and is set forth in Figure 14. The DNA encodes a protein containing amino acid sequences that are characteristic of IL—li (nucleotides 99-557). However, it is believed that several modifications may be made to this protein before it is secreted into the extracellular Hdlieu. These nmdifications may or may not be essential for the protein to have activity as an IL-li.

GTlO—ILli—2A encodes at least 32 amino acids N—terminal (nucleotides 3-98) to the amino terminus of the form. of IL—li known as X. It is believed that included in these 32 amino acids is a secretory leader sequence that starts at the M encoded by nucleotides -26, the nascent IL—li to the _58.. directs extracellular milieu, and is then removed by a leader peptidase, and possibly other peptidases. The extent to which this sequence is removed in forms alpha and beta of IL-li is presently unknown, but the N-terminus of these forms is thought to be close to that of form X. Removal of the secretory leader sequence is probably required for the protein to have effective IL-li activity.

Nucleotides 349-351 of GT10—lL-li-2A encode an N residue that is part of a concensus N-glycosylation site. On the basis of their susceptibility to digestion with N-glycanase it is believed that forms alpha and beta of IL-li are glycosylated. Since form X is not believed to be susceptible to digestion with this enzyme it is believed that it is not glycosylated, although this remains a possibility that could easily be demonstrated by one of ordi- nary skill in the art of protein sequencing using the information provided here. It is believed that glycosylation at this N resi- due is not required for the protein to show effective IL-li activity.

Nucleotides 99-101 of GTlO—lL-li—2A encode a P (see Figure ), but no P has been detected at this position (the N-terminus) of form X of IL-li. It is possible that this residue has been modified in the mature protein. It is believed that modification of this residue is not essential for effective IL-li activity.

The presently unknown N-terminus residues of forms alpha and beta are not wholly detectable by Edman degradation and are like- ly to be modified following removal of some of the N-terminal residues of the protein encoded by GTlO-IL—1i—2A. It is believed that this modification is not essential for effective IL-li activity.

Example 8 Expression of Genes Encoding IL-li in Animal Cells Animal—cell expression of IL-li requires the following steps: a. Construction of an expression vector’ b. Choice of a host cell line c. Introduction of the expression vector into host cells d. Manipulation of recombinant host cells to increase expression levels of IL-li l. IL-li expression vectors designed for use in animal cells can be of several types including strong constitutive expression constructs, inducible gene constructs, as well as those designed for expression in particular cell types. In all cases promoters and other gene regulatory regions such as enhancers (inducible or not) and polyadenylation signals are placed in the appropriate location in relation to the CDNA se- quences in plasmid-based vectors. Two examples of such con- structs follow: (1) A construct using a strong constitutive pro- meter region should be made using the simian virus 40 (SV40) gene control signals in an arrangement such as that found in the plasmid pSV2CAT as described by Gorman g£_gl. in Mol. Cel. Biol. g:l044-10Sl,.l982, specifically incorporated herein by reference- This plasmid should be manipulated in such a way as to substitute -60.. the IL—li CDNA for the chloramphenicol acetyltransferase (CAT) coding sequences using standard molecular biological techniques (Maniatis et al., supra), as shown in Fig. 6. (2) An inducible gene construct should be made utilizing the plasmid PMK which contains the mouse metallothionein (MT-l) promoter region (Brinster et al., Cell ;Z:228—23l, l98l>. This plasmid can be used as a starting material and should be manipulated as shown in Fig. 7 to yield a metal-inducible gene construct.

. A number of animal cell lines should be used to express IL-li using the vectors described above to produce active pro- tein. for their ability to promote foreign gene expression are mouse Ltk' and Chinese hamster ovary (CHO) dhfr' cells, although expression of I1-li is not limited to these cell lines.

. Vector DNA should be introduced into these cell lines using any of a number of gene-transfer techniques. The method co-precipitated with a second expression vector encoding a se- lectable marker. In the case of Ltk' cell transfection, the se- lectable marker is a thymidine kinase gene and the selection is the case of CHO dhfr' cells the selectable marker is dihydrofolate reductase (DHFR) whose selection is as described by Ringold et al. in J. Mol. Appl. Genet. l:l65-l7S, 1981.

Two potential cell lines that have been well-characterized_ . Cells that express the IL-li gene constructs should then be grown under conditions that will increase the levels of production of IL-li. Cells carrying the metallothionein promoter produced by the cells.

Example 9 Purification of Il-li From Recombinant Animal Cells Since the IL-li are expected to be secreted from cells like the natural material, it is anticipated that the methods described above for purification of the natural protein will allow similar purification and characterization of the recombinant protein.

Example 10 Sequence of IL-li The amino terminal residue of IL-li has been identified several times by direct protein sequencing as an arginine (R).

The result of such sequencing is shown in Example 3. In contrast, the amino terminal residue of IL-1i predicted by the sequence of the CDNA is a proline (P). This amino terminal residue is circled in Figs. 14 and 15.

This apparent disagreement between the CDNA sequence and the direct protein sequence can be resolved by assuming that an error in the CDNA sequence was incorporated during the reverse transcriptase-catalyzed synthesis from its mRNA. That is, a CGA (arginine) codon, located on the mRNA where it would code for that amino terminal residue, could have been changed during the reverse-transcriptase reaction to a CCA (proline) codon in the CDNA. This type of reverse transcriptase problem has been reported in the literature before, e.g., by B.

D. Clark et al. in Nucleic Acids Research 14:7897 (1986).

The present inventors believe that the correct amino acid sequence of the protein is as predicted by the CDNA except that the amino terminal amino acid is an arginine instead of the proline residue indicated in Figs. 14-15. The inventors contemplate that both DNA sequences and their corresponding peptide sequences fall within the scope of their invention although the amino terminal arginine sequence is preferred.

Examgle 11 A protein having the sequence: wherein X is cysteine, serine or alanine; z is arginine or proline is also incLuded in the invention.

N

Claims (8)

Claims

1. A recombinant polypeptide having interleukin-1 inhibitor (IL-1 i) activity comprising an amino acid sequence that is selected from: (A) an amino acid sequence that is encoded by a fragment of the coding region of a DNA sequence (A) that encodes an lL-1i or an IL-1i with an N-terminal secretion leader sequence as set forth below: 10 20 30 40 50 60 GAATTCCGGGCTGCAGTCACAGAATGGAAATCTGCAGAGGCCTCCGCAGTCACCTAATCA M E I C R G L R S H L I 70 80 90 100 110 A 120 CTCTCCTCCTCTTCCTGTTCCATTCAGAGACGATCTGCCSACCCTCTGGGAGAAAATCCA T L L L F L F H S E T I C (X) P S G R K S 130 140 150 160 I70 180 GCAAGATGCAAGCCTTCAGAATCTGGGATGTTAACCAGAAGACCTTCTATCTGAGGAACA S K M Q A F R I W D V N Q K T F Y L R N 190 200 210 220 230 240 ACCAACTAGTTGCTGGATACTTGCAAGGACCAAATGTCAATTTAGAAGAAAAGATAGATG N Q L V A G Y L Q G P N V N L E E K I D 250 260 270 280 290 300 TGGTACCCATTGAGCCTCATGCTCTGTTCTTGGGAATCCATGGAGGGAAGATGTGCCTGT V V P I E P H A L F L G I H G G K M C L 310 320 330 340 350 360 CCTGTGTCAAGTCTGGTGATGAGACCAGACTCCAGCTGGAGGCAGTTAACATCACTGACC S C V K S G D E T R L Q L E A V N I T D 370 380 390 400 410 420 TGAGCGAGAACAGAAAGCAGGACAAGCGCTTCGCCTTCATCCGCTCAGACAGTGGCCCCA L S E N R K Q D K .R F A F I R S D S G P 430 440 450 460 470 480 CCACCAGTTTTGAGTCTGCCGCCTGCCCCGGTTGGTTCCTCTGCACAGCGATGGAAGCTG T T S F E S A A C P G W F L C T A M E A 490 500 510 520 530 540 ACCAGCCCGTCAGCCTCACCAATATGCCTGACGAAGGCGTCATGGTCACCAAATTCTACT D Q P V S L T N M P D E G V M V T K F Y 550 560 570 580 590 600 TCCAGGAGGACGAGTAGTACTGCCCAGGCCTGCTGTTCCATTCTTGCATGGCAAGGACTG F Q E D E * wherein S of the DNA sequence is C or G and wherein (X) is R or P; (B) a fragment of the following amino acid sequence: (U)(X)PSGRKSSKMQAFRIWDVNQKTFYLRN NQLVAGYLQGPNVNLEEKIDVVPIEPHA LFLGIHGGKMCLSCVKSGDETRLQLEAV NITDLSENRKQDKRFAFIRSDSGPTTSF ESAACPGWFLCTAMEADQPVSLTNMPDE GVMVTKFYFQEDE wherein (U) is nothing, M, or comprises an N—terminal secretion leader sequence that is capable of directing the polypeptide having IL-1 inhibitor activity out of a cell in a processed form and (X) is R or P; or _ 65 _ (C) an amino acid sequence that is at least 70 % homologous to the amino acid sequence of native lL-‘I inhibitor having the following amino acid sequence: (X)PSGRKSSKMQAFRIWDVNQKTFYLRN NQLVAGYLQGPNVNLEEKIDVVPIEPHA LFLGIHGGKMCLSCVKSGDETRLQLEAV NITDLSENRKQDKRFAFIRSDSGPTTSF ESAACPGWFLCTAMEADQPVSLTNMPDE GVMVTKFYFQEDE wherein (X) is R or P; with the proviso that the amino acid sequence of any of (A), (B) or (C) does not comprise the amino acid sequence from position 26 to the end or from position 1 to the end of the following sequence: 10 20 30 40 50 60 7O 80 90 100 110 120 TRLQLEAVNITDLSENRRQD 130 140 KRFAFIRSDSGPTTSGESAA 150 160 CPGWFLCTAMEADQPVSLTN 170 TKFYFQEDE wherein (X) is either P = proline or R = arginine.

2. The polypeptide having IL-1 inhibitor activity of claim 1, characterized in that (X) is R = arginine.

3. The polypeptide having IL-1 inhibitor activity of claim 1 or 2, characterized in that it comprises the fragment of the amino acid sequence of claim 1(B) wherein (U) is M.

4. The polypeptide having IL-1 inhibitor activity of claim 1or 2, characterized in that it comprises an amino acid sequence that is at least 80 % homologous to the amino acid sequence of native IL-1 inhibitor having the following amino acid sequence: (X)PSGRKSSKMQAFRIWDVNQKTFYLRN NQLVAGYLQGPNVNLEEKlDVVP|EPHA LFLGIHGGKMCLSCVKSGDETRLQLEAV NITDLSENRKQDKRFAFIRSDSGPTTSF U1 20 ESAACPGWFLCTAMEADQPVSLTNMPDE GVMVTKFYFQEDE wherein X is either R or P.

5. The polypeptide having IL-1 inhibitor activity of claim 4, characterized in that said amino acid sequence is at least 90 % homologous.

6. The polypeptide having lL—1 inhibitor activity of claim 4, characterized in that said amino acid sequence is at least 95 % homologous.

7. The polypeptide having IL-1 inhibitor activity of claim 1 or 2, characterized in that it comprises the fragment of claim 1(B) wherein (U) is nothing. 8. The polypeptide having IL-1 inhibitor activity of any of claims 1 to 7, characterized in that it is produced by a recombinant host cell. 9. The polypeptide having IL-1 inhibitor activity of claim 8, characterized in that the host cell is a bacterial cell. 10. The polypeptide having IL-1 inhibitor activity of claim 9, characterized in that the host cell is Escherichia coli. 25 11. The polypeptide having IL-1 inhibitor activity of claim 8, characterized in that the host cell is a mammalian cell. 12. The polypeptide having IL-1 inhibitor activity of claim 11, characterized in that the host cell is a CHO cell. 13. The polypeptide having IL-1 inhibitor activity of any one of claims 1 to 12, characterized in that it has a glycosylation pattern obtainable by expression in yeast or mammalian cells, or is unglycosylated. 14. The polypeptide having IL-1 inhibitor activity of any one of claims 1 to 13, characterized in that it is 90% pure. 15. The polypeptide having IL-1 inhibitor activity of any one of claims 1 to 14, characterized in that it is 95% pure. 16. An isolated DNA molecule, characterized in that it comprises a DNA sequence that encodes a polypeptide having IL-1 inhibitor activity according to any of claims 1 to 7, with the proviso that the DNA molecule does not comprise the following nucleotide sequence from position 99 to position 554 or from position 1 to 554: 10 20 30 40 50 60 GAATTCCGGGCTGCAGTCACAGAATGGAAATCTGCAGAGGCCTCCGCAGTCACCTAATCA MEICRGLRSHLI _70_ 70 80 90 100 110 120 CTCTCCTCCTCTTCCTGTTCCATTCAGAGACGATCTGCCSACCCTCTGGGAGAAAATCCA T L L L F L F H S E T I C X P S G R K S 130 140 150 160 170 180 GCAAGATGCAAGCCTTCAGAATCTGGGATGTTAACCAGAAGACCTTCTATCTGAGGAACA S K M Q A F R I W D V N Q K T F Y L R N 190 200 210 220 230 240 ACCAACTAGTTGCTGGATACTTGCAAGGACCAAATGTCAATTTAGAAGAAAAGATAGATG N Q L V A G Y L Q G P N V N L E E K I D 250 260 270 280 290 300 TGGTACCCATTGAGCCTCATGCTCTGTTCTTGGGAATCCATGGAGGGAAGATGTGCCTGT V V P I E P H A L F L G I H G G K M C L 310 320 330 340 350 360 CCTGTGTCAAGTCTGGTGATGAGACCAGACTCCAGCTGGAGGCAGTTAACATCACTGACC S C V K S G D E T R L Q L E A V N I T D 370 380 390 400 410 420 TGAGCGAGAACAGAAAGCAGGACAAGCGCTTCGCCTTCATCCGCTCAGACAGTGGCCCCA L S E N R K Q D K R F A F I R S D S G P 430 440 450 460 470 480 CCACCAGTTTTGAGTCTGCCGCCTGCCCCGGTTGGTTCCTCTGCACAGCGATGGAAGCTG T T S F E S A A C P G W F L C T A M E A 490 500 510 520 530 540 ACCAGCCCGTCAGCCTCACCAATATGCCTGACGAAGGCGTCATGGTCACCAAATTCTACT D Q P V S L T N M P D E G V M V T K F Y 550 560 570 580 590 600 TCCAGGAGGACGAGTAGTACTGCCCAGGCCTGCTGTTCCATTCTTGCATGGCAAGGACTG F Q E D E * wherein the S is either (3 or G which codon codes for a proline or arginine. 17. An isolated DNA molecule according to claim 16, characterized in that it comprises a DNA sequence that is selected from a fragment of the coding region of the following sequence (A) : (A) 10 20 30 40 50 60 GAATTCCGGGCTGCAGTCACAGAATGGAAATCTGCAGAGGCCTCCGCAGTCACCTAATCA M E I C R G L R S H L I 70 8O 90 100 110 120 CTCTCCTCCTCTTCCTGTTCCATTCAGAGACGATCTGCCSACCCTCTGGGAGAAAATCCA T L L L F L F H S E T I C X P S G R K S 130 140 150 160 170 180 GCAAGATGCAAGCCTTCAGAATCTGGGATGTTAACCAGAAGACCTTCTATCTGAGGAACA S K M Q A F R I W D V N Q K T F Y L R N 190 200 210 220 230 240 ACCAACTAGTTGCTGGATACTTGCAAGGACCAAATGTCAATTTAGAAGAAAAGATAGATG N Q L V A G Y L Q G P N V N L E E K I D 250 260 270 280 290 300 TGGTACCCATTGAGCCTCATGCTCTGTTCTTGGGAATCCATGGAGGGAAGATGTGCCTGT V V P I E P H A L F L G I H G G K M C L 310 320 330 340 350 360 CCTGTGTCAAGTCTGGTGATGAGACCAGACTCCAGCTGGAGGCAGTTAACATCACTGACC S C V K S G D E T R L Q L E A V N I T D 370 380 390 400 410 420 TGAGCGAGAACAGAAAGCAGGACAAGCGCTTCGCCTTCATCCGCTCAGACAGTGGCCCCA L S E N R K Q D K R F A F I R S D S G P 430 440 450 460 470 480 CCACCAGTTTTGAGTCTGCCGCCTGCCCCGGTTGGTTCCTCTGCACAGCGATGGAAGCTG T T S F E S A A C P G W F L C T A M E A 490 500 510 520 530 540 ACCAGCCCGTCAGCCTCACCAATATGCCTGACGAAGGCGTCATGGTCACCAAATTCTACT D Q P V S L T N M P D E G V M V T K F Y 550 560 570 580 590 600 TCCAGGAGGACGAGTAGTACTGCCCAGGCCTGCTGTTCCATTCTTGCATGGCAAGGACTG F Q E D E * 18. A recombinant DNA vector, characterized in that it comprises a DNA molecule of any one of claims 16-17. 19. The vector of claim 18, characterized in that it is an expression vector and further comprises at least one operational element needed for the expression of the DNA molecule in a host. 20. The vector of claim 19, characterized in that the DNA molecule is capable of being expressed in bacteria or in mammalian cells. 21. A recombinant vector, characterized in that it comprises a DNA molecule encoding the following amino acid sequence: (U)(X)PSGRKSSKMQAFRIWDVNQKTFYLRN NQLVAGYLQGPNVNLEEKIDVVPIEPHA LFLGIHGGKMCLSCVKSGDETRLQLEAV NITDLSENRKQDKRFAFIRSDSGPTTSF ESAACPGWFLCTAMEADQPVSLTNMPDE _73_ GVMVTKFYFQEDE wherein (U) is nothing, M, or comprises an N-terminal secretion leader sequence that is capable of directing the polypeptide having lL-1 inhibitor activity out of a cell in a processed form, and (X) is R or P. 22. The vector of claim 21, wherein (X) is R = arginine. 23. A host cell, characterized in that it comprises a DNA molecule according to any of claims 16 or 17, said DNA molecule encoding a polypeptide having IL-1 inhibitor activity. 24. A host cell, characterized in that it contains a vector according to any one of claims 18 to 22. 25. The host cell of any of claims 23 or 24, characterized in that it is a bacterial cell. 26. The host cell of claim 25, characterized in that it is Escherichia coli. 27. The host cell of any of claims 23 or 24, characterized in that it is a mammalian cell. 28. The host cell of claim 27, characterized in that it is a CHO cell. 29. A process for producing a polypeptide having lL-1 inhibitor activity according to any one of claims 1-15 wherein the polypeptide having lL-1 inhibitor activity is produced in a host cell comprising a recombinant DNA molecule according to any of claims 16 to 17. 30. The process according to claim 29, further comprising harvesting the formed polypeptide having IL-1 inhibitor activity. 31. The process according to any of claims 29 or 30, characterized in that the DNA molecule comprises promoter DNA operatively linked to the DNA sequence. 32. The process according to any of claims 29 to 31, characterized in that the host cell is grown under conditions suitable for expression of the polypeptide having IL-1 inhibitor activity. 33. The process according to claim 32, characterized in that it comprises the further step of preparing a pharmaceutical composition containing the polypeptide having IL- 1 inhibitor activity. 34. Use of a polypeptide having IL-1 inhibitor activity according to any one of claims 1-7 for making a pharmaceutical composition for inhibiting interleukin-1. -75.. 35. Use of a polypeptide having lL-1 inhibitor activity according to any one of claims 1-7 for making a pharmaceutical composition for treating an lL-1 mediated pathophysiological condition. 36. Use of a polypeptide having IL-1 inhibitor activity according to any one of claims 1-7 for making a pharmaceutical composition for treating arthritis, rheumatoid arthritis, Crohn's disease, ulcerative colitis, osteoporosis, juvenile diabetes, psoriasis, lupus erythematosus, fibrosis, glomerulonephritis, gout, acute febrile illness, sarcoidosis, lymphomas, a patient after damage to the brain from vascular occlusion, or acute or chronic interstitial lung disease. 37. Use of a polypeptide having lL-1 inhibitor activity comprising the following amino acid sequence for making a pharmaceutical composition for treating arthritis, rheumatoid arthritis, Crohn's disease, ulcerative colitis, osteoporosis, juvenile diabetes, psoriasis, lupus erythematosus, fibrosis, glomerulonephritis, gout, acute febrile illness, sarcoidosis, lymphomas, a patient after damage to the brain from vascular occlusion, or acute or chronic interstitial lung disease: (mmPSGRKSSKMQAFRIWDVNQKTFYLRN NQLVAGYLQGPNVNLEEKIDVVPIEPHA LFLGIHGGKMCLSCVKSGDETRLQLEAV NITDLSENRKQDKRFAFIRSDSGPTTSF ESAACPGWFLCTAMEADQPVSLTNMPDE 25 GVMVTKFYFQEDE , wherein (U) is nothing or M and (X) is R or P. 38. Use according to claim 37, wherein (X) is R = arginine. 39. Use of a polypeptide having IL-1 inhibitor activity comprising the following amino acid sequence for making a pharmaceutical composition for treating an IL-1 mediated pathophysiological condition: (U)(X)PSGRKSSKMQAFRIWDVNQKTFYLRN NQLVAGYLQGPNVNLEEKIDVVPIEPHA LFLGIHGGKMCLSCVKSGDETRLQLEAV NITDLSENRKQDKRFAFIRSDSGPTTSF ESAACPGWFLCTAMEADQPVSLTNMPDE GVMVTKFYFQEDE wherein (U) is nothing or M and (X) is R or P. 40. Use according to claim 39, wherein (X) is R = arginine. 41. A pharmaceutical composition for inhibiting interleukin-1 comprising a polypeptide having lL-1 inhibitor activity of any one of claims 1-7. 42. A pharmaceutical composition for treating an IL-1 mediated pathophysiological condition comprising a polypeptide having IL-1 inhibitor activity of any one of claims 1-7. 43. A pharmaceutical composition for treating arthritis, rheumatoid arthritis, Crohn's disease, ulcerative colitis, osteoporosis, juvenile diabetes, psoriasis, lupus erythematosus, fibrosis, glomerulonephritis, gout, acute febrile illness, sarcoidosis, lymphomas, a patient after damage to the brain from vascular occlusion, or acute or chronic interstitial lung disease, comprising a polypeptide having IL-1 inhibitor activity of any one of claims 1-7. 44. A pharmaceutical composition for treating arthritis, rheumatoid arthritis, Crohn's disease, ulcerative colitis, osteoporosis, juvenile diabetes, psoriasis, lupus erythematosus, fibrosis, glomerulonephritis, gout, acute febrile illness, sarcoidosis, lymphomas, a patient after damage to the brain from vascular occlusion, or acute or chronic interstitial lung disease, comprising a polypeptide having IL-1 inhibitor activity comprising the following amino acid sequence: (U)(X)PSGRKSSKMQAFRIWDVNQKTFYLRN 'N_VQHL_VAGYLQAGPNVNLEEKIDVVPIEPHA ."‘Al“£l_W:E;LCV3lHGGKMCLSCVKSGDETRLQLEAV §N*"l"F;,DL«,rSENRKQDKRFAFIRSDSGPTTSF ESAACPGWFLCTAMEADQPVSLTNMPDE GVMVTKFYFQEDE wherein (U) is nothing or M and (X) is R or P. 45. A pharmaceutical composition according to claim 44, wherein (X) is R = arginine. 46. A pharmaceutical composition for treating an lL-1 mediated pathophysioiogical condition, comprising a polypeptide having IL-1 inhibitor activity comprising the following amino acid sequence: (wmPSGRKSSKMQAFRIWDVNQKTFYLRN NQLVAGYLQGPNVNLEEKIDVVPIEPHA LFLGIHGGKMCLSCVKSGDETRLQLEAV NITDLSENRKQDKRFAFIRSDSGPTTSF ESAACPGWFLCTAMEADQPVSLTNMPDE GVMVTKFYFQEDE wherein (U) is nothing or M and (X) is R or P. '~\, 1 The pharmaceutical composition of claim 46, wherein (X) is R = arginine. ‘_F.~ss,, he Fl{KBiY&CO” AGENTS FOR THE APPLICANTS 355-MEI LABEL mm -._. MONOCYTES PLATED on PETRI DISHES COATED _o wnu L. _I R) —— 09280 « -.4 -~-«»- aAmoAcnvm —— aLoAcnvm _5 —- Mace GRADIENT FIG. 1b .510 I5 2025303540 4550556065707500 355- NET LABEL wma MONOCYTES PLATED on PETRI DISHES COATED wnu §c_s. +100?! IZ~* —— 00280 +—o— RADIOACTIVITY 5 I0 15 20253035 40 45 5055606570 7580 859095 I00 8372? 2/21 as 8z_<.$ fi_>.__m IgG PLATE F08 PLATE 83721 W mo<¢op=< 3/21 4/21 ,50_ C4-REVERSE PHASE HPLC ON MONOO-PURIFIED IL-I (TRACE 355-LABELED) '00‘ ———0D2I5 00230 -°—-°-RADIOACTIVITY 50~ /H START smsmgw$wum$mammm 5/21 83721 SILVER-STAINED GELS Fla 3:: AUTORAD 6/21 83721 FI&S4a O CONSECUTIVE SUPEROSE M’ I2 (SIZING) CHROMATO- « GRAPHIC SEPARATIONS ON NONOO PURIFIEOIL-Ij “V E E 3 3 E 3 :25 cu" «r :9 2 S _' ' ‘ l _ _ A 5 l0 I5 20 25 30 35"T‘40 45 50 55 60 RERUN FRACTIONS 37+33 FIG. 412 __(,,,m -°-°— RADIOACTIVITY -°-°- BIOACTIVITY 83721 7/21 s__.:.. ._._< 29: smwE,_< .._o :2 < 22 $25 seam $22 3:52 2%: Eu: E... o 2,55 z§z§_.._ 3 mass: 235%» .3: fiwm Emma; Js §§_;< 2; :35 4 :5: + 232.. 83721 8/21 __-: 3:5 3.: m ._._< “S wasm wE_<.mm 3. 2 2: 2...; =§z2=._ 3 .u._m: 9/21 FIG. 6 D[GEST wnn Hpal psvzm mi‘ HInd9.II AND Hpal 2. ISOLATE LARGE FRAGMENT. pSVXV PL2IL—li 83721 83721 10/21 FIG. 7 K EcoRI fl EcoRI DIGEST mm PW? £°£“l A"_°£°£8¥_. , FILL IN EcoRI sncxv END T0 roan BLUNT END. EcoRI P 5116: R N TER BLUNT W ?:fE5I»'é'.I5‘s‘°r"o“‘ E“ "H PROMOTER H5v-uk FORM BLUNT ENDS. 2 PURlFY4kbFRA'GMENT ' 3,111 %33I.‘o'%‘é’.%° 3'11‘: sn£, AND H53-mx HSV-"k aumr sun mx FRAGMENTS 1 AND 2 LIGATE mnsroau E. coli, ISOLATE PLASMID DNA, cuscx smucruns av RESTRICTION DIGESTS. IHE PLASMID SHOULD "H %%%’é2a‘PsH%E§R'#.6”6L% Paouom B9111 SITE. Bglll HSV-Hk EcoRI 11/21 83721 FIG. 7(com‘.) u1—1 MT-1PROMOTER PROMOTER B9111 ommImmBmn Rwl zcouamt wnu SYNTHEHCIJNKER 5'GATCGGAATTCC CCTTAAGGOTAG 5' -u c E’ "1 -< -4 :: rn ca 1 j 3.LlGATE w1wnH&m1 EcpRI EgoRI LAMBDAJ c1n—u-n#m1 COTWHHEwRI UL-HcDNA)FRAG- MENT 31 AGAROSE GEL ELECTROPHORERS. COMBINE EcoRI OUT pMK-SOE2 AND IL-IicDNA AND LIGATE. TRANSFORM E. coli AND ISOLATE PLASMID. CHECK R THE PRESENCE AND ORIENTATION OF -1icDNA FRAGMENT. MT-1 PROMOTER EcoRI IL-1i cDNA EcoRI 83721 12/21 SE: g%u_u“...._.M__<.M_.41 2. 5“. 1.. E <: .2 =__..:..: K..\\ 5.2511 SN 8. 8. 2_ 8. 2.: 3. B R. c.__ 8. 8 o. 2 8 cm 8 pm ow 2 O M U nn.n_m rwmwmwmu 8 Q m f En. mm mm nun »_w 11 $8) on GR =2. :2: ma 3 3 2.5 W2: 8: 3 22:5 .555 .3 22. as 3: E5...

8. pm 8 2 8 om 8. pm ow o._ M. 48 um GE F/61 8d 13/21 $\.’w—& (EA) 5 £ FROM FIG. 8b . U3’; 83721 83721 14/21 25 3 ‘T -24 E ' -23 :2 -22 -2: 6 :33 as -119 <6 :1: § '4. PREP R 5 (F31 + 32) FILE 3® 0.5 ml/min PROTEIN PLUS (4.6 X 250mm) 83721 15/21 3 .2“. :2: m wt. 16/21 IL-II R BETAENDO ASP N- 17/21 83721 ORDER FOR SEQUENCING 5|,43,39,25,30,50,28,4|,48,54,27,46 PT 358 {-95 IDE no o¢:-aoo<\l o o ooooc>ooooc>oooOOooOOc> E ‘ no to o oo oooooooooooooooooocoo 83721