FR2954136A1 - DEODORANT COMPOSITION BASED ON ANTIMICROBIAL PEPTIDES AND METHOD FOR TREATING BODY ODORS - Google Patents

Abstract

The subject of the present invention is a composition comprising, in a cosmetically acceptable medium, at least one phylloseptine antimicrobial peptide or dermaseptin, a functional variant or a salt of such a peptide. The present invention also relates to a method for treating body odor, in particular armpits or feet, comprising applying to the surface of the skin a composition comprising at least one antimicrobial peptide phylloseptine or dermaseptin, a variant functional or a salt of such a peptide.

Description

The present invention relates to compositions comprising in a cosmetically acceptable medium at least one phylloseptine antimicrobial peptide or dermaseptin.

The present invention also relates to a method for treating body odors, in particular underarms and feet, comprising applying to the surface of the skin an effective amount of such a composition.

Eccrine or apocrine sweat is poorly fragrant when secreted. It is its degradation by bacteria via enzymatic reactions that produces malodorous compounds. Deodorant active ingredients have the function of reducing or preventing the formation of bad odors. The different systems proposed so far can be grouped into large families: (i) bactericidal substances or limiting the growth of bacteria, (ii) substances blocking the enzymatic reactions responsible for the formation of odorant compounds, (iii) absorbers bad smells, and (iv) antiperspirants.

Aluminum and / or zirconium salts are most commonly used as an antiperspirant active. The principle of action of these assets would be to form a gel in the sweat duct. This gel would create a plug that would partially plug the pores. The flow rate is thus reduced.

These aluminum salts also have their own efficacy because they are antibacterials. They also play a direct role in deodorant efficiency by reducing the number of bacteria responsible for the degradation of sweat. This technology, however, has certain disadvantages, due for the most part to the large quantities of assets that must be implemented. The active concentrations are high in the products currently used (around 15%) and can not be increased so as to reduce the amount of product applied to the skin of the user. These large amounts of applied product therefore leads at the moment a wet sensation that can be felt as uncomfortable and antinomic of the desired effect. In addition, the product has a sticky appearance as it has not evaporated on the skin. This sticky appearance can reappear when you sweat. In use, one can also observe hair sticking phenomena, whitish appearance and the appearance of traces left on clothing. The user may also feel the need to wash at the end of the day not to leave products on the body.

Absorbers of odors are also used in high concentration, which limits the possibility of increasing their quantity in the marketed products. Bactericidal substances or limiting the growth of bacteria, for their part, have the disadvantage of having to be mixed with compounds for their maintenance on the skin so that their action can be maintained during the day.

The different treatments applied on the armpit skin also tend to cause skin alterations resulting in irregularities, inhomogeneities of the pigmentary stain type especially on Asian skin, dyschromia or blackheads often due to the regrowth of the skin. hair. We can also note phenomena of drying and irritation. In addition, these different treatments are generally in the form of scented product, to help cover odors. However, these perfumes are noticeable and can be annoying.

At present, and in the market of deodorant products, there is no solution to hide these irregularities immediately and remarkably by the consumer from the application while maintaining a natural visual. In addition, it is important to achieve this goal with materials that are compatible in the deodorant formulations and that do not cause significant traces on clothing in contact with the skin. It is also important to find products whose assets are usable at low concentrations. Finally, it is important to identify new antimicrobial formulations capable of eliminating the germs responsible for unpleasant odors, while respecting the beneficial microbial flora of the skin.

It has already been proposed in US Pat. No. 6,255,279 the use of antimicrobial peptides of the sequence GIGDPVTXLKSGAIXHPVFXPRRYKQIGGXGLPXTKXXXX, where X can be any amino acid, in deodorant compositions. The use of a specific peptide isolated from human skin is also described.

However, there is still the need to make other deodorant products that cause virtually no trace or not at all on clothes in contact with the skin, and which combine efficiency and simplicity, while being comfortable. In particular, deodorant products whose action is more respectful of the beneficial microbial flora of the skin would be particularly advantageous, compared to known products.

The applicant has discovered that these objectives can be achieved by using antimicrobial peptides which will be defined in more detail later. This discovery is the basis of this invention. The present invention relates to compositions comprising in a cosmetically acceptable medium at least one phylloseptine antimicrobial peptide or dermaseptin, a functional variant or a salt of such a peptide.

The present invention also relates to a method for treating body odors, in particular armpits and feet, comprising applying to the surface of the skin an effective amount of such a composition.

The present invention also relates to the use of an antimicrobial peptide phylloseptine or dermaseptin as a deodorant active.

By "deodorant active" is meant any substance capable of masking, absorbing, improving and / or reducing the unpleasant odor resulting from the decomposition of human sweat by bacteria. By "cosmetically acceptable" is meant compatible with the skin and / or its integuments, which has a pleasant color, smell and feel and which does not generate unacceptable discomfort likely to distract the consumer from using this composition. 30 Antimicrobial Peptides

In the context of the present invention, the term "peptide" refers to a chain of amino acids linked together by a peptide bond (or amide bond).

The term "amino acids" refers to the following 20 amino acids in their levorotatory (L) or dextrorotatory (D) form, preferably in their natural form. L: Name One-letter code Three-letter code Alanine A Ala Arginine R Arg Asparagine N Asn Aspartate D Asp Cysteine C Cys Glutamate E Glu Glutamine Q Gln Glycine G Gly Histidine H His Isoleucine I Ile Leucine L Leu Lysine K Lys Methionine M Met Phenylalanine F Phe Proline P Pro Serine S Ser Threonine T Thr Tryptophan W Trp Tyrosine Y Tyr Valine V Val 4 The term "hydrophobic amino acid" refers to one of the following amino acids: I, L, V, M, F, Y, W, T, G, C or A. The term "alkaline hydrophilic amino acid" denotes one of the following amino acids: R, K or H. The term "neutral hydrophilic amino acid" refers to one of the following amino acids: S, P, N or Q. The term "acidic amino acid" refers to: one of the following amino acids: D or E.

The term "antimicrobial peptide" refers to a peptide that prevents, inhibits or reduces the growth of a microorganism, or destroys such a microorganism. The term "microorganism" refers to a bacterium, a virus, a protozoan and / or a fungus. The peptides used according to the invention therefore have in particular an antibacterial and / or antifungal activity, preferably an activity against the germs responsible for the formation of bad body odors, and more particularly the germs responsible for the formation of bad odors in the armpits. or feet. The antimicrobial activity of a peptide can be determined by measuring its "C150" or "inhibitory concentration 50", which corresponds to the concentration of a peptide needed to reduce by 50% the in vitro growth of a population of microorganisms. . In a particular embodiment of the invention, the antimicrobial peptides used have an IC50 of between 10 ng / g and 10 mg / g of composition against the germs responsible for the formation of unpleasant body odors, in particular against Corynebacterium striatum germs. , Corynebacterium jeikeium, Corynebacterium bovis and Corynebacterium xerosis.

According to the invention, the antimicrobial peptide used is a peptide of natural or synthetic origin. According to one particular embodiment, the antimicrobial peptide comprises the sequence, or consists of the sequence, of a peptide secreted by the skin of animals, in particular terrestrial animals living in humid environments, such as forests, in particular by amphibians, more particularly those of the subfamily Phyllomedusinae and representatives of the six known genera: Phyllomedusa and in particular of Phyllomedusa Hypochondrialis; Agalychnis; Pachymedusa; phrynomedusa; phasmahyla; Hylomanthis. The invention also comprises the use of functional variants or salts of such a peptide comprising the sequence of an antimicrobial peptide secreted by the skin of animals.

In a preferred embodiment, the antimicrobial peptide is chosen from the group consisting of phylloseptine peptides and dermaseptins, in particular described in Conceicao et al., Peptides 27 (2006), pp. 3092-3099. The phylloseptin peptides used according to the invention can be described by the following formula (I): ## STR2 ## I-X-I-P-H-A-I-N-AVSX I-X2-X3-X4-H-X5 (I) Wherein X 1 and X 5 independently are a hydrophobic or hydrophilic neutral amino acid; X2 and X3, independently, correspond to a hydrophobic amino acid; X4 is a neutral alkaline or hydrophilic amino acid. 15

In a particular embodiment, the phylloseptin peptide used according to the invention is a peptide of formula (I '): F-L-S-L-I-P-H-A-I-N-A-V-S-XI-X2-X3-X4-H-X5 (I').

In a particular embodiment, the peptide of the composition is a peptide of formula (I) or (I ') in which XI, X2 and X3 are hydrophobic amino acids, X4 is an alkaline hydrophilic amino acid, and X5 is a neutral hydrophilic amino acid. In another embodiment, the peptide of the composition is a peptide of formula (I) or (I ') wherein XI is a hydrophobic amino acid or a neutral hydrophilic amino acid, X2, X3 and X5 are hydrophobic amino acids and X4 is either an alkaline hydrophobic amino acid or a neutral hydrophilic amino acid. In an alternative embodiment, the peptide of the composition is a peptide of formula (I) or (I ') wherein XI, X2, X3 and X5 are independently hydrophobic amino acids and X4 is a alkaline hydrophilic amino acid.

According to one variant embodiment, the peptide of the composition is a peptide of formula (I) or (I ') in which XI is chosen from A and T, X2 is chosen from L and I, X3 is chosen from A and V, X4 corresponds to K and X5 corresponds to F in the phylloseptin peptide of formula (I) or (I ') used. In a particular embodiment, the phylloseptin peptide used is a peptide of formula (I) or (I ') amide in the C-terminal position.

By way of illustration, the following peptides may be used according to the invention: PS-1: FLSLIPHAINAVSAIAKHN-NH2 (SEQ ID NO: 1) -SP-2: FLSLIPHAINAVSTLVHHF-NH2 (SEQ ID NO: 2) PS-3: FLSLIPHAINAVSALANHG-NH2 (SEQ ID NO: 3) - PS-4: FLSLIPHAINAVSTLVHHSG-NH2 (SEQ ID NO: 4) - PS-5: FLSLIPHAINAVSAIAKHS-NH2 (SEQ ID NO: 5) - PS-6: SLIPHAINAVSAIAKHF-NH2 (SEQ ID NO: 6). PS-7: FLSLIPHAINAVSAIAKHF-NH2 (SEQ ID NO: 7).

The peptides of sequence SEQ ID NO: 1 to SEQ ID NO: 7 are phylloseptin peptides present in batrachian secretions. Their use represents a particular embodiment of the invention. In a preferred embodiment, the invention relates to the use of the peptide PS-7 (SEQ ID NO: 7).

The dermaseptin peptides used according to the invention can be described by the following formula (II):

Xa- (L or M) -W-Xb-Xc-K-Xd-Xe-Xf-Xg (II)

wherein: Xa denotes an apolar amino acid (F, G, I, L, V or A); Xb is an amino acid sequence comprising two or three amino acids; X denotes an apolar amino acid (F, G, I, L, V or A); Xd denotes an amino acid or a sequence of two amino acids; Xe denotes an apolar amino acid (F, G, I, L, V or A) or K; Xf is a set of two amino acids selected from the group consisting of GK, SK, AK, LK and GT; Xg represents an amino acid sequence comprising between 10 and 25 amino acids; and wherein Xg comprises at least 50% non-polar amino acids (F, G, I, L, V or A), based on the number of amino acids included in Xg; more than 50% of the amino acids of the peptide are apolar amino acids (F, G, I, L, V or A); the number of cationic residues (K, R or H) is less than or equal to 5; the number of cationic residues (K, R or H) minus the number of anionic residues (D or E) is an integer between 0 and 3 inclusive.

Any combination of the following embodiments relating to the structure of the dermaseptin peptide may also be implemented in the invention: Xa is selected from A and G; and / or - Xb denotes a sequence of two amino acids; and / or - Xc is selected from I and L; and / or - Xe is selected from the group consisting of A, I, L and V; and / or - Xf is GK; and / or - Xg represents an amino acid sequence comprising between 14 and 22 amino acids; and / or - Xg comprises between 50% and 86% of apolar amino acids, relative to the number of amino acids included in Xg; and / or - Xg comprises at least 50% of the apolar amino acids (F, G, I, L, V or A) of the peptide as a whole; and / or the peptide comprises at least one amino acid selected from D and E.

According to one particular embodiment, the dermaseptin peptide is amide in the C-terminal position.

In a preferred embodiment, the dermaseptin peptide used is a peptide of formula (II) in which:

Xa is selected from A and G; Xb is a two amino acid sequence selected from the group consisting of SK and ST; Xc is selected from I and L; Xe is selected from the group consisting of A, I, L and V; Xf is GK; Xg represents an amino acid sequence comprising between 14 and 22 amino acids; - Xg comprises between 50% and 86% of apolar amino acids, relative to the number of amino acids included in Xg; - Xg comprises between 50% and 80% of the apolar amino acids (F, G, I, L, V or A) of the entire peptide; and the peptide comprises at least one amino acid chosen from D and E.

In one particular embodiment, the dermaseptin peptide used is a peptide of formula (II ') Xa-LW-Xb-XC-K-Xd-Xe Xf-Xg (II') in which: Xa is chosen from A and BOY WUT; Xb is SK or ST, preferably ST; Xc is selected from I and L; Xe is selected from the group consisting of A, I, L and V; Xf is GK; Xg represents an amino acid sequence comprising 14 amino acids; - Xg comprises 12 apolar amino acids; and the peptide comprises at least one amino acid chosen from D and E.

In a particular embodiment, the dermaseptin peptide used is selected from the group consisting of: DS 01: GLWSTIKQKGKEAAIAAAKAAGQAALGAL-NH2 (SEQ ID NO: 8) DD L: ALWKTLLKNVGKAAGKAALNAVTDMVNQ (SEQ ID NO: 9) DRS B1: AMWKDVLKKIGTVALHAGKAALGAVADTISQ-NH2 ( SEQ ID NO: 10) DRS B5: GLWNKIKEAASKAAGKAALGFVNEMV-NH2 (SEQ ID NO: 11) DRS Si: ALWKTMLKKLGTMALHAGKAALGAAADTISQGTQ (SEQ ID NO: 12), DRS S2: ALWFTMLKKLGTMALHAGKAALGAAANTISQGTQ (SEQ ID NO: 13), DPh-1: GLWSTIKNVGKEAAIAAGKAALGAL-NH2 (SEQ ID NO: 14), and Dermaseptin-L1: GLWSKIKEAAKAAGKAALNAVTGLVNQGDQPS (SEQ ID NO: 15).

In a preferred embodiment, the composition according to the invention comprises at least one antimicrobial peptide chosen from peptides PS-7 (SEQ ID NO: 6) and DPh-1 (SEQ ID NO: 14).

According to a particular embodiment, the peptide dermaseptin DPh-1 of sequence SEQ ID NO: 14 is used.

The antimicrobial peptides used according to the present invention may be of natural origin or can be synthesized without difficulty by those skilled in the art, using conventional solid phase or solution peptide synthesis techniques (M. Bodanszky, Principles of Peptides Synthesis, 2nd ed., 1993, Springer-Verlag Edition). In a preferred embodiment, the antimicrobial peptides used according to the invention are synthetic peptides.

The antimicrobial peptides used according to the invention can also be produced by microorganisms, using bioengineering methods. In this case, it may be necessary to extract and purify the peptide from the producing microorganisms, before formulation. Alternatively, the producer microorganism may be applied directly to the site to be treated in the user, when said microorganism is capable of excreting the antimicrobial peptide produced.

The use of functional variants of phylloseptin peptides and dermaseptins is also contemplated. By "functional variant" is meant a peptide derived from the sequence of a phylloseptine peptide or dermaseptin as described above, in particular one of the peptides of sequence SEQ ID NO: 1 to SEQ ID NO: 15 described hereinabove. above, comprising essentially the same sequence, and having antimicrobial activity. Such a functional variant has in particular a percentage of sequence identity greater than 60% with the peptide from which it is derived, preferably greater than 70%, 80%, 90% and even more preferably greater than 95%. These functional variants may in particular be designed by addition or deletion of one or more amino acids at the ends of a peptide as described above, or in an internal part to its sequence. The functional variant may also be a peptide comprising one or more amino acid substitutions, including conservative substitutions. A "conservative substitution" is a substitution of one amino acid residue for another that has similar chemical or physical properties (size, charge, or polarity). By way of example, isoleucine, leucine, alanine, valine, phenylalanine, proline and glycine may be conservatively substituted, as may lysine, histidine and arginine or serine, tyrosine and threonine or cysteine and methionine or asparagine, glutamine and tryptophan or aspartic acid and glutamic acid. The substitution may also correspond to the replacement of one or more amino acids L of the sequence by the corresponding amino acids D.

The preparation of functional variants aims in particular to obtain peptides whose properties have been improved. It is thus possible to seek to improve the selectivity of the antimicrobial peptides with respect to a particular organ responsible for the formation of the unpleasant body odors and / or to increase its antimicrobial activity (for example making it possible to use such a modified peptide at a lower level). concentration). Such an improved peptide could allow the precise targeting of a specific germ such as Corynebacterium striatum, Corynebacterium jeikeium, Corynebacterium bovis and Corynebacterium xerosis, while preserving the balance of the beneficial microbial flora at the site of application of the peptide used according to US Pat. invention.

The antimicrobial action of the peptides used according to the invention can be evaluated by measuring their minimum inhibitory concentration (MIC). A blotting paper impregnated with a defined quantity of antimicrobial peptide is deposited on the surface of an agar medium previously inoculated with a suspension of a seed whose sensitivity to the peptide is to be tested, in the exponential phase of growth. The antibiotic diffuses from the disc and its concentration is even lower as one moves away from the disc. Each disc is surrounded by a halo of inhibition of bacterial growth. The MIC obtained can be compared to the same measurement made with a disk impregnated solely with solvent (without the peptide) or with a disc impregnated with a compound with known antibiotic activity. This test can also be used to test the selectivity of the peptides used. This method will be used to determine the effect of the tested peptide on a beneficial seed of skin flora such as Staphylococcus epidermidis. The peptides on the strains responsible for unpleasant odors (e.g., C. xerosis) will be better inhibited than the beneficial strains (e.g., S. epidermidis).

In a particular embodiment, a functional variant of a phylloseptine peptide or dermaseptin is designed, in particular on the basis of one of the peptides of sequence SEQ ID NO: 8 to 15 above, by: - addition or deletion from one to five internal amino acids (ie amino acids which are not at the ends of the peptides described above). When the modification relates to more than one amino acid, said addition or deletion may relate to successive or separated amino acids in the sequence of one or more amino acids; the deletion of one to five amino acids at the ends of the peptide; adding one to 20 amino acids to one or both ends; the substitution of a part of the natural amino acids of the sequence by natural or unnatural amino acids. This type of substitution may concern at most one-third, preferably at most one-quarter, of the amino acids of the basic sequence used to produce the modified peptide, and includes conservative or non-conservative substitutions. Among the unnatural amino acids that may be used, there may be mentioned 2-amino-heptanoic acid; the natural or non-natural amino acids that have undergone a modification of the N- and / or C-terminal end of the peptide by amidation, acylation, esterification; the natural or non-natural amino acids having undergone a modification of the amino acid residues present in the peptide, in particular not acetylation, methylation, acylation, esterification, etc., and any combination of the modifications described above.

These modifications can lead to increase or decrease the positive charge of the peptides (to improve the antimicrobial effect or to potentially improve the strength and resistance of the product on the treated area), to provide the peptides with reactive functions useful in the context of the treatments envisaged, in particular by adding functions that can act with the thiols (to improve the resistance of the product to the treated area and / or obtain a washing resistance), to facilitate the elimination or catabolism of the peptides and / or to prevent the absorption peptides at the application site, in particular by adding oxide ether functions, polyol units (for example sugars) or hydrophobic functions such as fluorinated or silicone functions, or to increase lipophilicity and compatibility with the sebum (in the case of people whose sweat is more oily or to treat oily areas of perspiration (scalp, nose )), in particular by connecting a hydrocarbon chain at the ends of the peptide or at one or more amino acid residues.

According to one particular embodiment, the antimicrobial peptides described above are included in the composition according to the invention at a concentration of between 1 nM (ie 10-9 mol per liter, or about 0.3pg per 100 g of composition). at 10 mM (ie 10-2 mol per liter, ie approximately 3 g per 100 g of composition).

In some cases, it may be advantageous to use the relatively high concentration antimicrobial peptide, for example, from 10 nM to 100 nM (ie from 3 g per 100 g of composition to 30 g per 100 g of composition). This is for example the case where a product is used which is applied in very small quantities, for example, an electrostatic diffuser, or a liquid product such as a serum. It is also the case when one uses a formula that is applied either on the armpits in limited quantities or in a product such as a shower gel, a solar product, an anti-mosquito product, a cream of care, of hydration, a tanning product, a depilatory product, etc.

According to a particular embodiment, the antimicrobial peptides described above may be used in dry products. In this case, the applied product may consist solely of peptides, or be a mixture of peptide and binder or peptide and a cosmetically acceptable solid support. In the case of such dry products, the peptide concentration may vary from 0.001% to 100% by weight relative to the weight of the cosmetic product.

The deodorant products according to the invention may further comprise the active ingredients usually incorporated in this type of products.

Deodorant active ingredients The compositions according to the invention may contain one or more deodorant active agents, for example bacteriostatic agents or other bactericidal agents, such as 2,4,4'-trichloro-2'-hydroxydiphenyl ether (Triclosan), on 2 , 4-dichloro-2'-hydroxydiphenyl ether, 3 ', 4', 5'-trichlorosalicylanilide, 1- (3 ', 4'-dichlorophenyl) -3- (4'-chlorophenyl) urea (Triclocarban) or 3 7,11-trimethyldodeca-2,5,10-trienol (Farnesol); quaternary ammonium salts such as cetyltrimethylammonium salts, cetylpyridinium salts; chlorhexidine and salts; diglycerol monocaprate, diglycerol monolaurate, glycerol monolaurate; polyhexamethylene biguanide salts; zinc salts such as zinc salicylate, zinc phenolsulfonate, zinc pyrrolidone carboxylate (more commonly known as zinc pidolate), zinc sulphate, zinc chloride, zinc lactate, zinc gluconate, Zinc ricinoleate, zinc glycinate, zinc carbonate, zinc citrate, zinc chloride, zinc laurate, zinc oleate, zinc orthophosphate, zinc stearate, zinc tartrate, lactate zinc, zinc acetate or mixtures thereof; odor absorbers such as zeolites, cyclodextrins, metal oxide silicates such as those described in the application US2005 / 063928; transition metal-modified metal oxide particles as described in US2005084464 and US2005084474, aluminosilicates such as those described in EP1658863, particles of chitosan derivatives such as those described in US6916465; substances blocking the enzymatic reactions responsible for the formation of odorous compounds such as the inhibitors of arylsulfatase, 5-lipoxygenase, aminocylase, R-glucoronidase; and their mixtures.

The deodorant active agents may be present in the composition according to the invention in a proportion of 0.01 to 10% by weight relative to the total weight of the composition and preferably in a proportion of 0.1 to 5% by weight.

Antiperspirant active ingredients

The antiperspirant active agents are preferably chosen from aluminum and / or zirconium salts; complexes of zirconium hydroxychloride and of aluminum hydroxychloride with an amino acid, such as those described in US-3792068 commonly known by the name "ZAG complexes." Such complexes are generally known by the name ZAG ( when the amino acid is Glycine.) The ZAG complexes usually have an Al / Zr quotient ranging from about 1.67 to 12.5 and a Metal / Cl quotient ranging from about 0.73 to 1. 93. Among these products, mention may be made of aluminum zirconium octachlorohydrex GLY, aluminum zirconium pentachlorohydrex GLY, aluminum zirconium tetrachlorohydrate GLY and aluminum zirconium trichlorohydrate-GLY, Among the aluminum salts, mention may be made of hydrochloride aluminum chlorohydrex aluminum, chlorohydrex aluminum PEG, aluminum chlorohydrex PG, aluminum dichlorohydrate, aluminum dichlorohydrex PEG, aluminum dichlorohydrex PG, aluminum sesquichlorohydrate, aluminum sesquichlorohydrex PEG, the aluminum sesquichlorohydrex PG, alum salts, aluminum sulfate, aluminum zirconium octachlorohydrate, aluminum zirconium pentachlorohydrate, aluminum zirconium tetrachlorohydrate, aluminum zirconium trichlorohydrate and more particularly aluminum hydroxychloride marketed by the REHEIS company under the name REACH 301 or by the company GUILINI CHEMIE under the name ALOXICOLL PF 40. Aluminum salts and zirconium are for example that marketed by the company REHEIS under the name REACH AZP-908-SUF.

In particular, aluminum chlorohydrate will be used in activated or non-activated form.

The antiperspirant active agents may be present in the composition according to the invention in a proportion of 0.001 to 30% by weight relative to the total weight of the composition and preferably in a proportion of 0.5 to 25% by weight.

The composition according to the invention preferably has a pH ranging from 3 to 9 depending on the support chosen.

The composition according to the invention may be in any of the galenical forms conventionally used for topical application and especially in the form of aqueous gels, aqueous or aqueous-alcoholic solutions. They may also, by addition of a fatty or oily phase, be in the form of lotion-type dispersions, emulsions of liquid or semi-liquid consistency of the milk type, obtained by dispersion of a fatty phase in one phase. aqueous (O / W) or conversely (W / O), or suspensions or emulsions of soft, semi-solid or solid consistency of the cream or gel type, or multiple emulsions (W / O / W or O / W) / H), microemulsions, vesicular dispersions of ionic and / or nonionic type, or wax / aqueous phase dispersions. These compositions are prepared according to the usual methods.

The composition according to the invention may also be in the form of a moisturizing product, a depilatory product, a shower gel, a mosquito product, a sunscreen product, a spray of water, etc. According to one object of the invention, the compositions according to the invention are packaged in an aerosol device or by a pump bottle; in a device provided with a perforated wall such as a grid; in a device provided with a ball-on applicator; in the form of sticks (sticks). They contain in this regard the ingredients generally used in this type of products and well known to those skilled in the art.

The compositions according to the invention intended for cosmetic use may comprise at least one aqueous phase. They are in particular formulated in aqueous lotions or in water-in-oil, oil-in-water or multiple emulsion emulsions (triple oil-in-water-in-oil or water-in-oil-in-water emulsion). such emulsions are known and described for example by C. FOX in "Cosmetics and Toiletries" - november 1986 - Vol 101 - pages 101-112).

The aqueous phase of said compositions contains water and in general other solvents which are soluble or miscible with water. Solvents that are soluble or miscible in water include short-chain monohydric alcohols, for example C1-C4, such as ethanol or isopropanol; diols or polyols such as ethylene glycol, 1,2-propylene glycol, 1,3-butylene glycol, hexylene glycol, diethylene glycol, dipropylene glycol, 2-ethoxyethanol, diethylene glycol monomethyl ether, triethylene glycol monomethyl ether and sorbitol. Propylene glycol and glycerin will be used more particularly.

According to one particular form of the invention, the compositions of the invention may be anhydrous.

By "anhydrous" is meant in the sense of the invention, a composition whose content of free or added water is less than 3% and preferably whose added water content is less than 1% by weight relative to the weight total of the composition.

The compositions according to the invention may contain at least one organic liquid phase immiscible in water. This generally comprises one or more hydrophobic compounds which render said phase immiscible in water. Said phase is liquid (in the absence of structuring agent) at room temperature (20-25 ° C). Preferably, the water-immiscible organic liquid organic phase according to the invention generally consists of an oil or a mixture of oils and comprises at least 80% of compounds having a pressure vapor that does not exceed the value 4 kPa (30 mm Hg) at 25 ° C.

The immiscible organic liquid phase in water preferably contains one or more silicone or hydrocarbon emollient oils, volatile or non-volatile. These emollient oils are especially described in US Patents 4,822,596 and US 4,904,463.

Volatile silicones are defined in a known manner as volatile compounds at room temperature. Among these compounds, mention may be made of cyclic and linear volatile silicones of the dimethylsiloxane type whose chains comprise from 3 to 9 silicone residues. The cyclomethicones D4, D5 or D6 are preferably chosen.

Nonvolatile silicones are defined in a known manner as compounds with low vapor pressure at ambient temperature. Among these compounds are included: polyalkylsiloxanes, in particular linear polyalkylsiloxanes, for example linear polydimethylsiloxanes, or dimethicones, marketed by Dow Corning under the name "Dow Corning 245 Fluid"; polyalkylarylsiloxanes, for example polymethylphenylsiloxanes, marketed by Dow Corning under the name "Dow Corning 556 Fluid"; polyether and siloxane copolymers, for example Dimethicone Copolyols.

Among the non-volatile emollient oils that can be used in the present invention, mention may be made, for example, of hydrocarbon derivatives, mineral oils, fatty alcohols, esters of C3-C18 alcohols with C3-C18 acids, esters benzoic acid with C12-C18 alcohols and mixtures thereof, C2-C6 polyols preferably chosen from glycerol, propylene glycol or sorbitol, polalkylene glycol polymers.

The emollient oils are preferably present in amounts ranging from 1 to 50% by weight and more preferably from 5 to 40% by weight relative to the total weight of the composition.

In order to improve the antiperspirant effectiveness of the composition, it is also possible to use one or more water-soluble anionic polymers comprising a Bronsted acid, in particular those derived from maleic acid and / or maleic anhydride which are described in the patent application WO02 / 49590.

In order to improve the homogeneity of the product, it is also possible to use one or more suspending agents which are preferably chosen from hydrophobic modified montmorillonite clays, such as hydrophobic modified bentonites or hectorites. Mention may be made, for example, of the product Stearalkonium Bentonite (CTFA name) (reaction product of bentonite and quaternary ammonium chloride stearalkonium chloride), such as the commercial product sold under the name Tixogel MP 250 by the company Sud Chemie Rheologicals, United Catalysts Inc. or the product Disteardimonium Hectorite (CTFA name) (reaction product of hectorite and distearyldimium chloride) sold under the name Bentone 38 or Bentone Gel by Elementis Specialties.

The suspending agents are preferably present in amounts ranging from 0.1 to 5% by weight and more preferably from 0.2 to 2% by weight relative to the total weight of the composition. The compositions according to the invention may also contain at least one organic powder.

Among the fillers that may be used according to the invention, mention may be made of organic powders. As used herein, the term "organic powder" means any solid that is insoluble in the medium at room temperature (25 ° C.).

Organic powders which may be used in the composition of the invention include, for example, polyamide particles and especially those sold under the names ORGASOL by the company Atochem; polyethylene powders; microspheres based on acrylic copolymers, such as those made of ethylene glycol dimethacrylate / lauryl methacrylate copolymer sold by Dow Corning under the name Polytrap; polymethyl methacrylate microspheres, sold under the name MICROSPHERE M-100 by the company Matsumoto or under the name COVABEAD LH85 by the company Wackherr; ethylene-acrylate copolymer powders, such as those sold under the name FLOBEADS by Sumitomo Seika Chemicals; expanded powders such as hollow microspheres and in particular microspheres formed of a terpolymer of vinylidene chloride, acrylonitrile and methacrylate and sold under the name EXPANCEL by the company Kemanord Piast under the references 551 DE 12 (particle size of about 12 μm and density 40 kg / m 3), 551 DE (particle size about 30 μm and density 65 kg / m 3), 551 DE 50 (particle size about 40 μm), or the microspheres marketed under the name MICROPEARL F 80 ED by the company Matsumoto; powders of natural organic materials such as starch powders, especially corn starch, wheat or rice, crosslinked or otherwise, such as starch powders crosslinked with octenylsuccinate anhydride, sold under the name DRY -FLO by the company National Starch; silicone resin microbeads such as those sold under the name Tospearl by the company Toshiba Silicone, in particular Tospearl 240; amino acid powders such as the Lauroyllysine powder marketed under the name Amihope LL-11 by the Ajinomoto Company; the wax microdispersion particles, which preferably have average dimensions of less than 1 μm and in particular from 0.02 μm to 1 μm, and which consist essentially of a wax or a mixture of waxes, such as products marketed under the name Aquacer by the company Byk Cera, and in particular: Aquacer 520 (mixture of synthetic and natural waxes), Aquacer 514 or 513 (polyethylene wax), Aquacer 511 (polymeric wax), or such as the products marketed under denomination Jonwax 120 by the company Johnson Polymer (mixture of waxes of polyethylene and paraffin) and under the name Ceraflour 961 by Byk Cera (micronized modified polyethylene wax); and their mixtures. The organic powder or powders may be present for example in a quantity

According to a particular embodiment, the composition according to the invention comprises an absorbent powder and / or absorbent molecules, in particular chosen from cyclodextrins. These powders or molecules can also be used in the form of solid materials such as fabrics.

The cosmetic compositions according to the invention may also comprise cosmetic adjuvants chosen from waxes, softeners, antioxidants, opacifiers, stabilizers, moisturizers, vitamins, perfumes, bactericides, preservatives, polymers, perfumes, thickeners, propellants or any other ingredient usually used in cosmetics for this type of application.

According to another embodiment, the composition according to the invention may also contain active agents that help to soften the bonds between the germs responsible for bad body odors and the skin. It is thus possible to use cationic surfactants, organic solvents such as alkyl acetates, acetone, silicones, plasticizers, thiols such as cysteine, for example. It is also possible to use enzymes such as proteases, in particular keratinases, lipases, but also protein destructurants: urea and its derivatives, guanidine and its salts (for example guanidine carbonate or guanidine hydroxide), ionic liquids for example .

Advantageously, the composition according to the invention may also comprise penetration assistants such as, for example, hydrotropes, typically propylene carbonate, benzyl alcohol or benzoic acid.

According to another embodiment, the composition according to the invention further comprises another peptide or protein involved in the defense of the skin, in particular a defensin (human R-defensin for example), human cathelicidin, alamethicin or a melittin.

Of course, those skilled in the art will take care to choose this or these optional complementary compounds in such a way that the advantageous properties intrinsically attached to the cosmetic composition according to the invention are not, or not substantially, impaired by the addition or additions envisaged. .

The waxes can be chosen from animal, fossil, vegetable, mineral or synthetic waxes. These include beeswax, carnauba wax, candelilla wax, sugar cane, japan, ozokerites, montan wax, microcrystalline waxes, paraffins, waxes and silicone resins.

The thickeners, preferably nonionic, may be selected from guar gums and modified or unmodified celluloses such as hydroxypropyl guar gum, cetylhydroxyethylcellulose, silicas such as Bentone Gel MIO sold by the company NL INDUSTRIES or the Veegum Ultra, sold by POLYPLASTIC.

The thickeners may also be cationic, for example POLYQUATERNIUM-37 sold under the name Salcare SC95 (Polyquaternium-37 (And) Mineral Oil (And) PPG-1 Trideceth-6) or Salcare SC96 (Polyquaternium-37 (And) Propylene Glycol Dicaprylate / Dicaprate (And) PPG-1-Trideceth-6) or other crosslinked cationic polymer such as for example those of CTFA name Ethylacrylate / Dimethylamino Ethyl Methacrylate Cationic Emulsion Copolymer.

The amounts of these various constituents that may be present in the cosmetic composition according to the invention are those conventionally used in deodorant and / or antiperspirant compositions.

When they contain a water-immiscible organic liquid phase, the compositions according to the invention can also also contain one or more structuring agents or gelling agents for said water-immiscible organic liquid phase, such as fatty alcohols. linear solids and / or waxes; fatty acids or their salts (steric acid, sodium stearate, 12-hydroxystearic acid); dibenzylidene alditols (DBS); lanosterol, N-acyl amino acid derivatives; derivatives of di or tri-carboxylic acids such as N, N'-dialkylsuccinamide alkyls (ie: dodecyl N, N'dibutylsuccinamide), and organopolysiloxane elastomers such as those described in application WO97 / 44010.

According to another embodiment, the composition according to the invention further comprises a retention agent on the skin, in particular anionic polymers or anionic particles. The resulting composition makes it possible to limit the action of the antimicrobial peptide as described above in the only place where said composition has been applied.

The compositions according to the invention may also be pressurized and packaged in an aerosol device consisting of: (A) a container comprising a composition as defined above, (B) at least one propellant and a means for dispensing said composition aerosol.

Propellants generally used in this type of product and well known to those skilled in the art are, for example, dimethyl ether (DME); volatile hydrocarbons such as n-butane, propane, isobutane, and mixtures thereof, optionally with at least one chlorinated and / or fluorinated hydrocarbon; among these are the compounds sold by the company Dupont de Nemours under the names Freon® and Dymel®, and in particular monofluorotrichloromethane, difluorodichloromethane, tetrafluorodichloroethane and 1,1-difluoroethane sold in particular under the trade name Dymel 152 A by the company DUPONT. It is also possible to use as propellant carbon dioxide, nitrous oxide, nitrogen or compressed air.

The dispensing means, which forms a portion of the aerosol device, is generally constituted by a dispensing valve controlled by a dispensing head, itself comprising a nozzle through which the aerosol composition is vaporized. The container containing the pressurized composition may be opaque or transparent. It may be glass, polymeric material or metal, optionally covered with a layer of protective varnish.

According to a particular embodiment, the antimicrobial peptide may also be used as a deodorant active ingredient in a dry or almost dry dosage form. It can be cited as a patch, powder, sticky or not, compress, paste, coating or balm. In the case of a product in powder form, the latter can be applied with a fabric, a brush, a brush or by hand for example. It is enough for example to spend the hand on the armpits to apply a little powder. This mode of presentation is very convenient for a discrete application, since it will not produce wet traces.

The composition according to the invention can also be prepared extemporaneously, immediately before use. The subject of the invention is then a cosmetic assembly intended to fight against bad body odors, comprising at least two compositions, one of the two compositions comprising at least one peptide as described above, optionally in a physiologically acceptable medium. In this embodiment, a mixture of the compositions must be carried out beforehand by the user, or by a system performing the mixing automatically. One can consider the use of a dual-pocket system.

A cosmetic assembly according to the invention may advantageously be used in a method of treating body odor in which it is desired to stop the action of the peptide over time without user intervention after application of the deodorant formula. The assembly is then composed of a first composition containing at least one antimicrobial peptide as described above and a second composition, different from the first, containing a protease capable of inactivating said at least one antimicrobial peptide. The cosmetic process according to the invention will then comprise the premixing of the two compositions of the cosmetic assembly according to the invention before application of the resulting mixture to the part of the skin to be treated. The action of the peptide will then be progressively stopped by digestion of said peptide with said protease.

An object of the invention also relates to the use of an antimicrobial peptide as described above, as a deodorant active agent for the treatment of unpleasant body odors, in particular underarms and feet.

Another subject of the invention relates to a method for treating body odors, in particular underarms and feet, comprising applying to the surface of the skin an effective amount of a composition comprising at least one antimicrobial peptide as described herein. -above.

According to a particular embodiment, the body odor treatment method according to the invention is carried out in two or more times. A formula containing the peptide is first applied and then, with or without intermediate rinsing, a formula that does not contain the peptide (for example a spray) is applied. The order can be reversed.

The invention may also allow the treatment of the skin, in particular the skin of the armpits or feet, in a spaced manner, for example once every two weeks, once a week, or once every two or four weeks. three days. The method according to the invention also comprises the daily application of the composition according to the invention, or even an application several times a day. The process according to the invention can also be carried out according to the following methods: a first composition according to the invention is applied on the first day (for example containing 10 μM of peptide), then it is maintained by regular applications, for example once per week, underarms or feet, for example, by applying compositions containing small amounts of peptide (1 μM peptide).

The applications of the composition according to the invention can be alternated with more conventional treatments. Thus, one can start with the application of a conventional antiperspirant and / or deodorant (based on aluminum salts or chemical antibacterial), then apply peptide-based compositions according to the invention. In this case, the application of the compositions according to the invention serves to maintain the cleanliness of the skin. The order of the applications can be reversed.

In one embodiment of the method according to the invention, the application of a conventional composition for treating body odor and a composition according to the invention is alternated. Thus one can apply, the same day for example, a spray based on traditional active against body odors and an antimicrobial peptide-based spray according to the present invention. The frequency of treatments can be adapted. Thus, it may be envisaged to use a conventional composition one day, then a composition according to the invention the next day, thus alternating the type of composition each day. According to another frequency, one of the compositions is used for one week, and the other composition is used the following week.

In another embodiment, the method according to the invention comprises the application of a composition according to the invention as described above, then after a exposure time of between 10 minutes and 48 hours, the application of a second composition comprising a protease capable of inactivating the antimicrobial peptide present in the composition according to the invention. Thus, the user can stop the antimicrobial effect of the peptide when it deems that the deodorant effect obtained is sufficient. Other approaches may be employed: application of a reducing solution, oxidizing or denaturing, or application of a complexing composition.

According to a particular embodiment, the method according to the invention comprises the application of the composition according to the invention and then the application of water, for example by means of a spray, at regular intervals in order to prevent the composition according to the invention is dry.

According to another embodiment, when the user wears a garment that has days, or stitches, it is possible to apply the product according to the invention (the powders in particular but also the fluids) on the garment. The small amount of product necessary for the desired activity makes this embodiment possible, and this, unlike other assets, without affecting the quality or appearance of the fabric (no discoloration of clothing, marks, visible traces). Washing machine and laundry contact do not cause staining.

In a particular embodiment of the invention, the peptides are included in the textile. They can also be introduced into the textile washing bath. They can also be used on other pieces of fabrics, such as sheets, blankets, lounge chair or car. The following examples serve to illustrate the present invention. Example 1 A synthetic DPh1 peptide is produced by chemical peptide synthesis according to the conventional methods well known to those skilled in the art. The peptide DPh1 is introduced at a rate of 12 mg per 92 g of water, 4 g of isododecane and 4 g of nonionic surfactant APG (alkylpolyglucoside). The same formulation is carried out with the PS7 peptide, at the rate of 18 mg instead of 12 mg.

The formulations are agitated at the time of use and applied to the skin at the armpits or feet.

EXAMPLE 2 Examples of Formulations and Application a) Lotion Phylloseptin peptide PS-7 is produced by chemical peptide synthesis. A composition containing (per 100 g) is made: • 0.01 g of PS7 • 20 g of ethanol • Water qs 100 g

3o After completion, this composition is applied to the armpits at a rate of 2 g per armpit. Then, the composition is allowed to dry.

b) Non-rinsed gel A composition containing (per 100 g) 15 • 0.02 g of PS-7 • 0.8 g of Jaguar HP 105 (hydroxypropyl guar, Rhodia) • Water qs 100 g The gel is applied on the underarms (2 g per armpit). The formula dries without leaving any traces.

c) Spray A composition containing (for 65 g) • 0.020 g of PS-7 • 1 g of AQ 38S (Polyester-5, Eastman Chemicals) • Eaugs65g

This composition is introduced into an aerosol can. Pressurized by introducing under pressure 35 g of dimethyl ether. The spray is applied on the armpits (0.8 g per armpit, about 2 seconds)

d) Lotion The peptide dermaseptin DPh1 is produced by chemical peptide synthesis.

A composition containing (per 100 g): 0.01 g of DPh-1 50 g of ethanol Water qs 100 g After completion, it is applied on the underarms (2 g per armpit). Then, after drying, a second composition is applied in the form of a 5% Mexomer-based spray in ethanol, pressurized with DME (Scheme 65/35).

e) Gel A composition containing (per 100g) • 0.005 g of Dph-1 • 0.6 g of Jaguar HP 105 • Water qs 100g The gel is applied on the underarms (2 g per armpit). The perspiration rehydrates the armpits and triggers the activity of the product. You can also rehydrate with a spray of water regularly to prevent the gel from drying. f) Spray A composition containing (for 65 g) • 0.020 g of PS-7 • 0.010 g of DPh-1 • 1 g of AQ 38S (Eastman Chemicals) • Eaugs65g

This composition is introduced into an aerosol can. Pressurized by introducing under pressure 35 g of dimethyl ether. We apply 2 per armpit. g) Powder A powder containing: • 1 g of PS-7 • 1 g of DPh-1 • 1 g of glycerol • Talc qs 100g After mixing, the product is taken with a brush (make-up brush). About 0.4 g per armpit is applied.

h) Compacted powder A powder containing: • 1 g PS-7 • 1 g DPh-1 • 2 g glycerol • Talc qs 100g The whole is compacted after mixing with a press. About 0.4 g per armpit is applied.

Claims (16)

REVENDICATIONS1. Composition comprising in a cosmetically acceptable medium at least one phylloseptine antimicrobial peptide or dermaseptin, a functional variant or a salt of such a peptide. 2. Composition according to claim 1, the peptide being a phylloseptine peptide of formula (I) SLIPHAINAVS-XI-X2-X3-X4-H-X5 (I) in which, XI and X5, independently, correspond to an acid hydrophobic or hydrophilic neutral amine; X2 and X3, independently, correspond to a hydrophobic amino acid; X4 is a neutral alkaline or hydrophilic amino acid. 3. Composition according to claim 2, the peptide being a peptide of formula (I '): FLSLIPHAINAVS-XI-X2-X3-X4-H-X5 (I') in which X1, X2, X3, X4 and X5 are such as defined in claim 1. 4. Composition according to any one of claims 1 to 3, wherein the peptide is selected from the group consisting of: - PS-7: FLSLIPHAINAVSAIAKHF-NH2 (SEQ ID NO: 7), - PS-1: FLSLIPHAINAVSAIAKHN-NH2 (SEQ ID NO: 1), -SP-2: FLSLIPHAINAVSTLVHHF-NH2 (SEQ ID NO: 2), -SP-3: FLSLIPHAINAVSALANHG-NH2 (SEQ ID NO: 3), -SP-4: FLSLIPHAINAVSTLVHHSG-NH2 (SEQ ID NO: 2) ID NO: 4), PS-5: FLSLIPHAINAVSAIAKHS-NH2 (SEQ ID NO: 5), and-PS-6: SLIPHAINAVSAIAKHF-NH2 (SEQ ID NO: 6). 5. A composition according to claim 1, the peptide being a dermaseptin peptide of formula (II) Xa- (L or M) -W-Xb-Xc-K-Xd-XeXf-Xg (II) in which: Xa denotes an acid apolar amine (F, G, I, L, V or A); Xb is an amino acid sequence comprising two or three amino acids; Xc denotes an apolar amino acid (F, G, I, L, V or A); Xd denotes an amino acid or a sequence of two amino acids; Xe denotes an apolar amino acid (F, G, I, L, V or A) or K; Xf is a set of two amino acids selected from the group consisting of GK, SK, AK, LK and GT; Xg represents an amino acid sequence comprising between 10 and 25 amino acids; and wherein Xg comprises at least 50% non-polar amino acids (F, G, I, L, V or A), based on the number of amino acids included in Xg; more than 50% of the amino acids of the peptide of formula (I) are apolar amino acids (F, G, I, L, V or A); the number of cationic residues (K, R or H) is less than or equal to 5; the number of cationic residues (K, R or H) minus the number of anionic residues (D or E) is an integer between 0 and 3 inclusive. 6. The composition according to claim 5, wherein the dermaseptin peptide is a peptide of formula (II ') Xa-LW-Xb-Xc-K-Xd-Xe Xf-Xg (II') in which: Xa is chosen from A and BOY WUT; Xb is SK or ST, preferably ST; Xc is selected from I and L; Xe is selected from the group consisting of A, I, L and V; Xf is GK; Xg is an amino acid sequence comprising 14 amino acids; - Xg comprises 12 apolar amino acids; and the peptide comprises at least one amino acid chosen from D and E. A composition according to claim 5 or 6, wherein the dermaseptin peptide is selected from the group consisting of: DPh-1: GLWSTIKNVGKEAAIAAGKAALGAL-NH2 (SEQ ID NO: 14), DS 01: GLWSTIKQKGKEAAIAAAKAAGQAALGAL-NH2 (SEQ ID NO: 8), DD L: ALWKTLLKNVGKAAGKAALNAVTDMVNQ (SEQ ID NO: 9), DRS B1: AMWKDVLKKIGTVALHAGKAALGAVADTISQ-NH2 (SEQ ID NO: 10), DRS B5: GLWNKIKEAASKAAGKAALGFVNEMV-NH2 (SEQ ID NO: 11), DRS Si: ALWKTMLKKLGTMALHAGKAALGAAADTISQGTQ (SEQ ID NO: 12), DRS S2: ALWFTMLKKLGTMALHAGKAALGAAANTISQGTQ (SEQ ID NO: 13), and Dermaseptin-L1: GLWSKIKEAAKAAGKAALNAVTGLVNQGDQPS (SEQ ID NO: 15). 8. Composition according to one of claims 1 to 7, characterized in that the peptide is PS-7 (SEQ ID NO: 7) or DPh-1 (SEQ ID NO: 14). 9. Use of an antimicrobial phylloseptine peptide or dermaseptin, a functional variant or a salt of such a peptide as a deodorant active. 10. Use according to claim 9, the peptide being a phylloseptine peptide of formula (I) S-L-I-P-H-A-I-N-AVSX I-X2-X3-X4-H-X5 (I) ) in which, XI and X5, independently, correspond to a hydrophobic or neutral hydrophilic amino acid; X2 and X3, independently, correspond to a hydrophobic amino acid; X4 is a neutral alkaline or hydrophilic amino acid. 20 11. Use according to claim 10, the peptide being a peptide of formula (I '): FLSLIPHAINAVS-XI-X2-X3-X4-H-X5 (I') in which X1, X2, X3, X4 and X5 are such as defined in claim 10. The use according to any one of claims 9 to 11, wherein the peptide is selected from the group consisting of: - PS-7: FLSLIPHAINAVSAIAKHF-NH2 (SEQ ID NO: 7), 70 - PS-1: FLSLIPHAINAVSAIAKHN- NH 2 (SEQ ID NO: 1), -SP-2: FLSLIPHAINAVSTLVHHF-NH 2 (SEQ ID NO: 2), -SP-3: FLSLIPHAINAVSALANHG-NH 2 (SEQ ID NO: 3), -PS-4: FLSLIPHAINAVSTLVHHSG-NH2 ( SEQ ID NO: 4), PS-5: FLSLIPHAINAVSAIAKHS-NH2 (SEQ ID NO: 5), and 15-PS-6: SLIPHAINAVSAIAKHF-NH2 (SEQ ID NO: 6). 13. Use according to claim 9, wherein the peptide is a dermaseptin peptide of the formula (II) Xa- (L or M) -W-Xb-Xc-K-Xd-Xe-Xf-Xg (II) wherein: Xa denotes an apolar amino acid (F, G, I, L, V or A); Xb is an amino acid sequence comprising two or three amino acids; Xc denotes an apolar amino acid (F, G, I, L, V or A); Xd denotes an amino acid or a sequence of two amino acids; Xe denotes an apolar amino acid (F, G, I, L, V or A) or K; Xf is a set of two amino acids selected from the group consisting of GK, SK, AK, LK and GT; Xg represents an amino acid sequence comprising between 10 and 30 amino acids; and wherein Xg comprises at least 50% of apolar amino acids (F, G, I, L, V or A), based on the number of amino acids included in X g, more than 50% of the amino acids of the peptide of formula (I) are apolar amino acids (F, G, I, L, V or A); the number of cationic residues (K, R or H) is less than or equal to 5; the number of cationic residues (K, R or H) minus the number of anionic residues (D or E) is an integer between 0 and 3 inclusive. 14. Use according to claim 13, the dermaseptine peptide being a peptide of formula (II ') Xa-LW-Xb-Xc-K-Xd-Xe Xf-Xg (II') in which: -) (a is chosen from A and G; Xb is SK or ST, preferably ST; Xc is selected from I and L; Xe is selected from the group consisting of A, I, L and V; Xf is GK; Xg is an amino acid sequence comprising 14 amino acids; Xg comprises 12 apolar amino acids; and the peptide comprises at least one amino acid selected from D and E. 15. Use according to claim 13 or 14, the peptide dermaseptin being selected from the group consisting of: DPh-1: GLWSTIKNVGKEAAIAAGKAALGAL-NH2 (SEQ ID NO: 14), DS 01: GLWSTIKQKGKEAAIAAAKAAGQAALGAL-NH2 (SEQ ID NO: 8), DD L: ALWKTLLKNVGKAAGKAALNAVTDMVNQ (SEQ ID NO: 9), DRS B1: AMWKDVLKKIGTVALHAGKAALGAVADTISQ-NH2 (SEQ ID NO: 10), DRS B5: GLWNKIKEAASKAAGKAALGFVNEMV-NH2 (SEQ ID NO: 11), DRS Si: ALWKTMLKKLGTMALHAGKAALGAAADTISQGTQ (SEQ ID NO: 12 ), DRS S2: ALWFTMLKKLGTMALHAGKAALGAAANTISQGTQ (SEQ ID NO: 13), and Dermaseptin-L1: GLWSKIKEAAKAAGKAALNAVTGLVNQGDQPS (SEQ ID NO: 15). 16. A method of treating body odor, particularly armpits or feet, comprising applying to the skin surface a composition according to any one of claims 1 to 8.