FI56790C - FAERGLOESNINGSMEDEL FOER TRYCKKAENSLIGT REGISTRERINGSMATERIAL - Google Patents
FAERGLOESNINGSMEDEL FOER TRYCKKAENSLIGT REGISTRERINGSMATERIAL Download PDFInfo
- Publication number
- FI56790C FI56790C FI222672A FI222672A FI56790C FI 56790 C FI56790 C FI 56790C FI 222672 A FI222672 A FI 222672A FI 222672 A FI222672 A FI 222672A FI 56790 C FI56790 C FI 56790C
- Authority
- FI
- Finland
- Prior art keywords
- solvent
- direct
- carbon atoms
- paper
- color
- Prior art date
Links
Classifications
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B41—PRINTING; LINING MACHINES; TYPEWRITERS; STAMPS
- B41M—PRINTING, DUPLICATING, MARKING, OR COPYING PROCESSES; COLOUR PRINTING
- B41M5/00—Duplicating or marking methods; Sheet materials for use therein
- B41M5/124—Duplicating or marking methods; Sheet materials for use therein using pressure to make a masked colour visible, e.g. to make a coloured support visible, to create an opaque or transparent pattern, or to form colour by uniting colour-forming components
- B41M5/165—Duplicating or marking methods; Sheet materials for use therein using pressure to make a masked colour visible, e.g. to make a coloured support visible, to create an opaque or transparent pattern, or to form colour by uniting colour-forming components characterised by the use of microcapsules; Special solvents for incorporating the ingredients
- B41M5/1655—Solvents
Landscapes
- Color Printing (AREA)
Description
IT.'W . I Tri KUULUTUSJULKAISUIT.'W. I Dr. ANNOUNCEMENT
Ä UTLÄGGNI NGSSKMFT 5679QÄTLÄGGNI NGSSKMFT 5679Q
e^S (4S) ^ (51) Kv.ik.»/tnt.ci.· B 41 M 5/12 (21) P*t*nttlh»k*mui — P*(«ntan$eknln| (22) Hiktmltpllyl — AntPknlnpdif 11,!'?'.e ^ S (4S) ^ (51) Kv.ik. »/ tnt.ci. · B 41 M 5/12 (21) P * t * nttlh» k * mui - P * («ntan $ eknln | (22 ) Hiktmltpllyl - AntPknlnpdif 11,! '?'.
(23) Alkupllyt —Glkl|h»t»di| l’.’ (41) Tullut |ulklt«li>l — Bllvlt ofT«ntll| ·,,0.\ V ·(23) Alkupllyt —Glkl | h »t» di | l '.' (41) Tullut | external «to> Bllvlt ofT« ntll | · ,, 0. \ V ·
Patentti· )a rekisterihallitus (44) NthxMMpmM „ kuuL)ulktl«un pym. —Patent ·) a Board of Registration (44) NthxMMpmM „kuLL ulktl« un pym. -
Patent- och registerttyrelsen An»ök»n uclifd och utUkrlfttn publktrtd -1.) (32)(33)(31) Pyydetty •tuolkmit — Baglrd prlerlttt 1,71 ··.·,' l ί -v< ( i: " ·..··:.· · ’ 7 , :· LiL .1 · vh:·.: , ;’>· . Loui s , M: i , *·'.%*>» "· ( ) .···!:··, -r -*.r -v-.-·, .;r: , Mrirtin Wilbur F-irt-ir,Patent- och registrerttyrelsen An »ök» n uclifd och utUkrlfttn publktrtd -1.) (32) (33) (31) Pyydetty • tuolkmit - Baglrd prlerlttt 1,71 ··. ·, 'L ί -v <(i: " · .. ··:. · · '7,: · LiL .1 · vh: · .:,;'> ·. Loui s, M: i, * · '.% *> »" · (). · ··!: ··, -r - *. R -v -.- ·,.; R:, Mrirtin Wilbur F-irt-ir,
Kirfcw· i, Vi.·.· -:ri, LV ' ; ·:.) ·. 1.! *. “ r Ab ( !.) · :i:: 'b’Tk:i:; r**fcss*-«»rC':: *«*.:r.ia - FTirflLi5:;i:.rrr.·'J'·! - kkunril i r* :*··/:’"- r-τ; ·. *'r: uiKirfcw · i, Vi. ·. · -: ri, LV '; · :.) ·. 1.! *. “R Ab (!.) ·: I :: 'b’Tk: i :; r ** fcss * - «» rC ':: * «* .: r.ia - FTirflLi5:; i: .rrr. ·' J '·! - kkunril i r *: * ·· /: '"- r-τ; ·. *' r: ui
Tavanomaiset rekisteröintiainekset muodostuvat leimausnesteestä eli väristä Ja kiinte&Btä, tämän kanssa reagoivasta aineesta, Jotka on mahdollisimman tasaisesti levitetty väriä kantavalle Ja väriä vastaanottavalle paperille, Joita erottava este hävi&ä paineen vaikutuksesta. Eräs tällainen re-kisteröintiaines muodostuu ensimmäisestä paperista, Joka mahdollisimman tasaisesti sisältää paineessa rikkoutuvia kapseleita, joissa lelaausnesteenä en lluottlaeen liuotettua kromogeeniainesta sekä toisesta paperista, Jossa ensimmäisen arkin kapseleita vastapäätä on Jatkuva päällyste kiinteätä, hapanta herkistysainesta, joka reagoidessaan leimaueneste^n kanssa muodostaa värillisen reaktiotuotteen. Leimaus-.estettä sisältävien kapselien lukumääri Ja tilavuus riittävät muodostamaan Jatkuvan kuvion, kun niihin kohdistetaan kuvion muotoa noudattava paine.Conventional recording materials consist of a stamping liquid, i.e., a dye and a solid, a reactive substance thereof, which is spread as evenly as possible on the color-bearing and dye-receiving paper, the separating barrier of which is removed by pressure. One such recording agent consists of a first paper containing, as uniformly as possible, pressure-breakable capsules in which no chromogenic substance is dissolved in the pouring liquid, and a second paper. The number and volume of capsules containing the stamping liquid are sufficient to form a continuous pattern when subjected to a pressure corresponding to the shape of the pattern.
Ensimmäisen paperin kapselien sisältämän leimamsnesteen koostumus voi vaihdella. Edellytyksenä on, että nestekoostumukset muodostavat värillisen jäljen reagoidessaan kiinteän aineen kanissa. Leimausnesteen yleisesti toivottavia ominaisuuksia ovat kapselien helppo täyttö tavanomaisin keinoin, 56790 2 hyvä säilyvyys kapseleissa enkä stabiilisuus suhteellisen korkeissa lämpötiloissa. On myös tärkeätä, että leimausnestsen Ja kiinteän aineen reaktiossa syntyvä Jälki kehittyy nopeasti, on haalietumissnkestävä sekä kestää kapillaari- tai muita pintailmiöitä valumatta tai pintaa karhentamatta.The composition of the stamping liquid contained in the capsules of the first paper may vary. It is a prerequisite that the liquid compositions form a colored mark on reaction with the solid in the rabbit. Commonly desirable properties of the labeling fluid are easy filling of the capsules by conventional means, 56790 2 good shelf life in the capsules and not stability at relatively high temperatures. It is also important that the Trace of the Labeling Liquid-Solid Reaction develops rapidly, is resistant to fading, and resists capillary or other surface phenomena without draining or roughening the surface.
Mieluiten lelmausneste on värittömän tai lähes värittömän kromogeenl-aineksen liuos. Joka siuodostaa värin Joutuessaan kosketukseen Ja reagoidessaan kiinteän, herkistävän aineknen kanssa.Preferably, the leaching fluid is a solution of a colorless or nearly colorless chromogenic material. Which dissolves color when in contact with and reacts with solid, sensitizing substances.
Tällaisen aineksen etuna on, että rikkoutuessaan vahingossa käsille, vaatteille tai muille pinnoille se ei värjää niitä.The advantage of such a material is that if it is accidentally broken on hands, clothes or other surfaces, it will not stain them.
Tällaisten leimausnestelden kaneina reagoivia kiinteitä eli herklstys-aineita ovat hienojakoiset, happamet yhdisteet, Jotka neutraalimuodossaan ovat myös värittömiä tai melkein värittömiä. Tavallisesti käytetään orgaanisia polymeerejä Ja epäorgaanisia savia, Jotka levitetään paperin pinnalle sopivassa paperipinnoiteliimassa, esim. tärkkelyksessä, kaseiinissa, polymeerissä tai lateksissa.The solid or sensitizing substances which react as rabbits in such labeling liquids are finely divided, acidic compounds which, in their neutral form, are also colorless or almost colorless. Usually organic polymers and inorganic clays are used, which are applied to the surface of the paper in a suitable paper coating adhesive, e.g. starch, casein, polymer or latex.
J '.uottlmen tehtävänä on toimia kromogeenikantajana Ja kromogeenin Ja happaman herkistysaineen välisen reaktion väliaineena. Yleensä kromogeeni liuotetaan liuottimeen liuokseksi, Joka kapseloituna voidaan levittää rekls-teröintipaperin toiselle puolelle. Liuottimen on kyettävä pitämään kromogeeni liuenneena kapselissa, siirtämään leimausneete herkistettyyn paperiin kapselia rikottaessa sekä edistämään värin kehittymistä reagoivassa, kiinteässä aineessa tai ainakaan se ei saa estää tätä kehittymistä. Koska varomaton käsittely saattaa vahingossa rikkoa kapselin, on liuoksen lisäksi oltava vaaratonta eikä se saa vahingoittaa ihoa, vaatteita tai ympäristöä.The function of the solvent is to act as a chromogen carrier and as a medium for the reaction between the chromogen and the acidic sensitizer. Generally, the chromogen is dissolved in a solvent to form a solution which, when encapsulated, can be applied to one side of the advertising paper. The solvent must be able to keep the chromogen dissolved in the capsule, transfer the labeling fluid to the sensitized paper when the capsule is broken, and promote or at least prevent the development of color in the reactive solid. As careless handling may accidentally break the capsule, in addition to the solution, it must be safe and must not damage the skin, clothing or the environment.
Liuotin on tärkeä tekijä rekieteröintiaineksen laadun kannalta, Jonka tunnusmerkkejä ovat paperin lämmön- Ja varastointlkestävyys, värin kehittymisnopeus, värin kehittymisen laajuus Ja lelmau läljen pysyvyys. Kuitenkin on ko. alalla aikaisemmin kiinnitetty vain vähän huomiota liuottimiin Ja sen sijaan on keskitytty parantamaan kroraogeenejä Ja herkistysaineita. Liuottimina on käytetty harvoja yhdisteitä, esim. maaöljyjä Ja niiden Jakelta, tolueenia, perkloorieteenia, ksyleeniä, kloorattuja parafiineja, kloorattuja difenyylejä, alkyloituja difenyylejä, hydrattuja terfenyylejä, dloktyyliftalaattia Ja metyylisalieylaattia. Joskin monilla näistä liuottimista on saavutettu hyviä tuloksia viisoctikaisissa sovellutuksissa, tähän saakka ei kuitenkaan täysin ole otettu huomioon liuottimen tärkeää osuutta rekieteröintiaineksen suorituskyvyn kannalta.The solvent is an important factor in the quality of the recrystallization material, which is characterized by the heat and storage resistance of the paper, the rate of color development, the extent of color development and the stability of the film. However, there are in the field previously paid little attention to solvents And instead has focused on improving chorogens And sensitizers. Few compounds have been used as solvents, e.g. petroleum and their Jake, toluene, perchlorethylene, xylene, chlorinated paraffins, chlorinated diphenyls, alkylated diphenyls, hydrogenated terphenyls, doctyl phthalate and methyl salicylate. Although many of these solvents have achieved good results in fiveoctic applications, so far the important role of the solvent in the performance of the recoating material has not been fully taken into account.
Siten käsiteltävänä olevan keksinnön eräänä kohteena on tarjota nykyisiä parempia liuottimia Ja lluotinryhmiä käytettäviksi rekiateröintiainek-sisea parantamaan leimausmerkin kehittymisnopeutta, värinvoimakkuutta Ja kestävyyttä paperissa. Keksinnön :iäoä Ja muut kohteet käyvät ilmi seuraavasta 3 56790 kuvauksesta Ja esimerkeistä.Thus, it is an object of the present invention to provide improved solvents and solvent groups for use in a recoating agent to improve the rate, color intensity and durability of a label in paper. The invention and other objects will become apparent from the following description of the following 3,56790 and examples.
Paineherkiesä rekisterölntialneksissa käytettyjen kromogeenien parannetut liuottimet ovet alkyylisubstituoituja, aromaattisia hiilivetyjä, Jois-ea »1kyyliryhmä on noin 3 “ 12 hiiliatomia sisältävä suora hiilivety. Alkyy-liradlkaali voi olla kiinnittynyt aromaattiseen radikaaliin ketjun minkä tahansa hiiliatomin kohdalla. Käsiteltävänä olevaan keksintöön kuuluvat kaavaa E' H - CB - ir olevat yhdisteet, Joiden kaavassa R on 2-n. 11 hiiliatomia sisältävä suora a. -kyyliradikaali, R· on vety tai 1-n. 6 hiiliatomia sisältävä suora alkyyli-radikaali, Jolloin summa H ♦ Ä' on noin 2-11 hiiliatomia Ja Ar on aryylira-dikaali tai metyyllsubstituoitu aryyliradikaali, Joissa aryyllna on fenyyli, difenyyli Ja naftäiseni.The improved solvents for the chromogens used in the pressure sensitive registration doors are alkyl-substituted aromatic hydrocarbons. The alkyl group is a straight hydrocarbon containing about 3 to 12 carbon atoms. The alkyl radical may be attached to an aromatic radical at any carbon atom in the chain. The present invention includes compounds of formula E 'H - CB - ir, wherein R is 2-n. A straight α. -Alkyl radical containing 11 carbon atoms, R · is hydrogen or 1-n. A straight alkyl radical of 6 carbon atoms, wherein the sum H ♦ Ä 'is about 2-11 carbon atoms And Ar is an aryl radical or a methyl-substituted aryl radical, In which the aryl is phenyl, diphenyl And naphthenic.
Nämä liuottimet kestävät paremmin lämpöä Ja kehittävät värin nopeammin muovilla tai savella päällystetyllä paperilla kuin vastaavat haarautuneet alkyy liar o maa ti tThese solvents are more heat resistant and develop color faster on plastic or clay coated paper than their corresponding branched alkyl esters.
Paineherkkiä rekisterölntipapereita, Joisea käytetään kromogeeneistä Ja käsiteltävänä olevan keksinnön parannetuista liuottimista muodostuvia värittömiä väriaineliuoksia, voidaan valmistaa hyvin tunnettujen, tavanomaisten menetelmien avulla. Kirjallisuudesta löytyy menetelmäkuvauksia sekä väriä kantavan paperin että muovilla tai savella päällystetyn alustapaperin valmistamiseksi, eivätkä tällaiset menetelmät muodosta osaa käsiteltävänä olevasta keksinnöstä. Kuitenkin voidaan tässä Julkistetuilla liuottimilla yleensä korvata tavanomaisia värilluottlmla paranneltujen reklsteröintlpape-rlen valmistamiseksi tällaisten tavanomaisten menetelmien avulla.Pressure-sensitive recording papers, which use colorless dye solutions of chromogens and the improved solvents of the present invention, can be prepared by well-known, conventional methods. Descriptions of methods for making both color-bearing paper and substrate paper coated with plastic or clay can be found in the literature, and such methods do not form part of the present invention. However, the solvents disclosed herein can generally be used to replace conventional color releases for the production of improved advertising paper by such conventional methods.
Käsiteltävänä olevan keksinnön lluottlnla käytetään mieluiten yhdistettyinä yhteen tai useampaan tavanomaiseen, normaalisti värittömään kromogee-nlin. Eräs tällainen kromogeeniryhmä muodostuu värittömistä, aromaattisista kaksoissldoksia sisältävistä orgaanisista yhdisteistä, Jotka ret^goldessaan happanen herkistysaineksen kanssa muuttuvat poolieemmaksi, konjugoiduksi Ja värilliseksi muodoksi. Erittäin suositeltavaan kromogeeniryhmään kuuluvat ftalldltyypplset yhdisteet, esim. kldeviolettllaktoni, so. 3,J-bis-(p-dime-tyyllaminofenyyli)-6-diaetyyllaminoftalidl Ja malakllttivlhreälaktoni, so.According to the present invention, it is preferably used in combination with one or more conventional, normally colorless chromogens. One such chromogenic group consists of colorless, aromatic double-bonded organic compounds which, on contact with an acidic sensitizer, become more polar, conjugated, and colored. A highly preferred group of chromogens includes phthalide-type compounds, e.g. crystal violet lactone, i.e. 3, J-bis- (p-dimethylaminophenyl) -6-diaethylaminophthalide and malachtyl green lactone, i.
3,3-bis-(p-dimetyyliaminofenyyli)-ftalidi. Kulta kromogeenisla ftalidiJohdannaisia ovat J»3“Me~(p~*”diProPyyllaainofenyyli.)-i“talidi, jt3-bls-(p-ne-tyyllaminofenyyli)-ftalidi, 3-(i>nyyli)«3-(indol-3-yyli)-rtalldit, esim. 3-(p-dimetyyliominofenyyli)-3-( 1,2-dinetyyli-indol4-3-yyli)-ftalidi, 3,3-bis-( f’enyyli«indol»3**yyAi)“f tai idit, esim. 3»3-bie-(l»2-dinetyyli-indol-3-yyli)-ftalidi, 3-(fenyyli-3-heterosykliseBti substituoidut) italidlt, esim. 3-(p- 4 S6790 l dinetyylift*inofenyyli)-3-(l-metyylipyr-3-yyli)-6-dimetyylia*inoftalidi,indoli, kerbateolisubetituoidut ftalidit, esim. 3,3-bis-(l,2-dimetyyli-indol-3-yyli)- 5-dimetyyliaminoftalidi Ja 313-bis-(9-etyylikarbatsol-3-yyli)-5-dinetyylia-minoftalidi sekä substituoidnt indoliftalidit, euim. 3-(l,2-dimetyyii-indol- 3-yyli)-3-(2-metyyli-indol-3-yyli)-rtalidi.3,3-bis (p-dimethylaminophenyl) phthalide. Gold chromogenic phthalide Derivatives are J »3“ Me ~ (p ~ * ”diProPhyllainophenyl.) - i“ thalide,? 3-bs- (p-neylaminaminophenyl) phthalide, 3- (iyl)-3- (indole) 3-yl) salts, e.g. 3- (p-dimethylaminophenyl) -3- (1,2-dimethylindol-4-yl) phthalide, 3,3-bis- (phenyl «indole) 3 * * yyAi) f or idites, e.g. 3- (3-bie- (1,2-dimethylindol-3-yl) phthalide, from 3- (phenyl-3-heterocyclic substituted) italides, e.g. 3- (p - 4 S6790 l dimethylphthalophenyl) -3- (1-methylpyr-3-yl) -6-dimethyl * inophthalide, indole, kerbateol-substituted phthalides, e.g. 3,3-bis- (1,2-dimethylindol-3 -yl) -5-dimethylaminophthalide and 313-bis- (9-ethylcarbazol-3-yl) -5-dimethylaminophthalide and substituted indole phthalides, euim. 3- (1,2-Dimethyl-indol-3-yl) -3- (2-methyl-indol-3-yl) -phthalide.
Muita tämän keksinnön toteuttaaissssa käyttökelpoisia, kromogeenisia väriyhdisteitä orat ayös indolisubstituoldut pyroaellitidit, esla. 3,5-bis-(p-dietyyliftminofenyyli)-3,5-bis-(1,2-dia*tyyli-indol-3-yyli)-pyroaellitidi, 3,7-bis-(p-dietyyliaminofenyyli)-3,7-bi β-(1,2-dimetyyli-indol-3-yyli)-pyro-aellitidi, 3,3,7•7”tstrakis-(l,2-diaetyyll-indol-3“y7li)-pyroaellitidi, 3.3,5.5-tetrskis-(1,2-dia#tyyli-indol-3-yyli)-pyroaellitidi, leukauraaiinit Ja substituoidut leukauraaiinit, esim. p-ksylyylileukauraailnl Ja fenyyli-leukauraaiini. Häihin yhdisteisiin kuuluvat ayös ortohydroksibentsoaseto-fenoni, 2,4-bis-[p~(p-dimetyyliaminofenyyliatso)-anilino]-6-hydroksi-sym.-trlatsiini, R,3»3“tri*®tyyli-indolino-benteoepiropyraanit Ja R,3,3-triae-tyyli«indolino-(!l-naftoepiropyraanit.Other chromogenic dye compounds useful in the practice of this invention include sprouts and indole-substituted pyroellitides, esla. 3,5-bis- (p-diethylphenophenyl) -3,5-bis- (1,2-dialylindol-3-yl) -pyroellitide, 3,7-bis- (p-diethylaminophenyl) -3, 7-Bβ- (1,2-dimethyl-indol-3-yl) -pyrroleellitide, 3,3,7 • 7 ”tstrakis- (1,2-diaethyl-indol-3H-yl) -pyrroleellitide, 3.3 , 5,5-tetrskis- (1,2-dialylindol-3-yl) -pyroaellitide, leucaurines And substituted leucaurines, e.g. p-xylyl-leucaurine and phenyl-leucuraine. These compounds also include orthohydroxybenzoaceto-phenone, 2,4-bis- [β- (p-dimethylaminophenylazo) -anilino] -6-hydroxy-sym-trazazine, R, 3, 3 “tri * ®tyl-indolino-benzoepiropyrans, and R, 3,3-triae-style «indolino - (l-naftoepiropyraanit.
T11Ä. Mainittujen kromogeenlen ohella voidaan käyttää apuväriainetta haalistuaisen estämiseksi. Monilla ftalidiyhdisteille, esia. kidevioletti-laktonille on oainaista nopea värin kehittynlnen Ja värin haalistuainen ajan aittaan. Sopiva apuväriaine on bentsoyyllleukoaetyleenlslni, Joka paperille Joutuessaan hapettuu vähitellen pysyväksi siniseksi väriksi. Thdlstäaällä ftalidikromogeeni Ja tällainen väritön, hapettuva apuvärlaine saadaan koos-tuaus, Joka kehittää värin nopeasti Ja keet*£ haalistumatta.T11Ä. In addition to said chromogens, an auxiliary dye can be used to prevent fading. For many phthalide compounds, pre. the crystal violet lactone is oasis of rapid color development And color fading over time. A suitable excipient is benzoyl leukoaethylene, which, on contact with paper, gradually oxidizes to a permanent blue color. With this phthalide dichromogen, and such a colorless, oxidizing auxiliary dye is obtained, which develops the color rapidly and boils without fading.
Tämän keksinnön lluottiaet ovat kaavaa Γ R - CH - Ar olevia suoraketjuisia alkyylisubstituoituja aromaattisia yhdisteitä Ja niiden seoksia. Kaavasra R on 2-n. 11 hiiliatomia sisältävä suora alkyyliradi-kaali, R’ on vety tai 1-n. 6 hiiliatomia sisältävä suora alkyyllradikaali. Jolloin summa E ♦ 8' on n. 2-3* hiiliatomia Ja Ar on aryyllradikaall tai metyylisubstltuoitu aryyllradikaall, Joissa aryylina on fenyyli, difenyyli Ja naftaleeni.The solvent fractions of this invention are straight chain alkyl substituted aromatic compounds of the formula ka R-CH-Ar And mixtures thereof. The formula R is 2-n. A straight alkyl radical containing 11 carbon atoms, R 'is hydrogen or 1-n. Direct alkyl radical containing 6 carbon atoms. Where the sum E ♦ 8 'is about 2-3 * carbon atoms And Ar is an aryl radical or a methyl-substituted aryl radical, wherein the aryl is phenyl, diphenyl and naphthalene.
Suositeltavia liuottimia, Joissa R* on vety tai metyyli, voidaan valmistaa alkyloimalla sopivaa aromaattia suoraketjuisella alkyylihalogenidll-la tai vastaavasti 1-olefiinilla. Erityisen suositeltavia liuottimia ovat suora butyylidifenyyli, suora heksyylidifenyyli, suora oktyylldifenyyli, suorien Cg-C^g -alkyylidifenyylien seokset, suora heksyylinaftaleeni, suora oktyyllnaftäiseni, suorien Cg-Cj^-alkyylinaftaimenien seokset, suora heksyy-libentseeci, suora oktyylibentseeni, suorien Cg-C^-alkyyllbentseenien seokset, suora dodesyyllbentseenl Ja näiden seokset.Preferred solvents in which R * is hydrogen or methyl can be prepared by alkylation of the appropriate aroma with a straight-chain alkyl halide or 1-olefin, respectively. Particularly preferred solvents are direct butyldiphenyl, direct hexyldiphenyl, direct octyldiphenyl, mixtures of direct C 8 -C 18 alkyldiphenyls, direct hexylnaphthalene, direct octylnaphthene, direct C 6 -C 6 alkylbenzene, mixtures of direct C 6 -C 6 alkylbenzene, straight Mixtures of ^ -alkylbenzenes, direct dodecylbenzenel And mixtures thereof.
5 56790 Tämän keksinnön liuottimet voivat muodostaa seoksia yhden tai υ e etunaan liuottimen tai laimentimen kanssa, Jotka eivät ole suoraketjuisia alkyyli-aromaattiyhdieteitä. Erityisesti voidaan tämän keksinnön liuottimia sekoittaa esim. O-n. 5 osaan laiaenninta kutakin liuotinosaa kohti, jolloin lalnenti-nena on kivsnnäis- tai kasvisöljy, esim. keroseeni, parafiiniöljy, bensiini-Jakeet, puuvillasieaenöljy, kookosöljy tai rapsiöljy. Näiden laimentiaien tehtävänä on muuttaa liuottimen fysikaalisia ominaisuuksia, esim. viskositeettia ja höyrynpainetta Ja ne saattavat olla toivottuja käsittely- Ja pro-sessisyistä. Laimentlmet saattavat myös vähentää liuottimien kokonaiskustannuksia ja joissakin tapauksissa ne voivat parantaa liuottimen tehoa erityisesti haalistumisen tai pinnan nukkautumlsen suhteen.The solvents of this invention may form mixtures with one or more of a solvent or diluent which are not straight chain alkyl aromatic compounds. In particular, the solvents of this invention can be mixed with e.g. O-n. 5 parts of a diluent for each solvent part, the lalentent being a mineral or vegetable oil, e.g. kerosene, paraffin oil, petrol fractions, cottonseed oil, coconut oil or rapeseed oil. These diluents have the function of altering the physical properties of the solvent, e.g., viscosity and vapor pressure, and may be undesirable for treatment and process reasons. Diluents may also reduce the overall cost of solvents and in some cases may improve the effectiveness of the solvent, especially with respect to fading or fluffing of the surface.
Liuottimet voivat myös sisältää määrättyjä lisäaineita, joiden erityistarkoituksena on muuttaa tai säätää nesteen lopullisia ominaisuuksia. Tällaisia lisäaineita ovat esim. viskositeetin säätöaineet, höyrynpalneen säätöaineet, jäätymispistettä alentavat aineet, hajuneatoalneet, hepettumlses-toalneet, väriaineet jne.Solvents may also contain certain additives with the specific purpose of altering or adjusting the final properties of the liquid. Such additives include, for example, viscosity modifiers, vapor barrier modifiers, freezing point depressants, odorless, hepettumestal, colorants, and the like.
Kromogeenialnes liuotetaan mieluiten sopivaan lluottimeen rekisteröin-tinesteeksi, Joka pystyy reagoimaan happanen, kiintoän aineen kanssa. Hapan aines voi olla Levis-hapon tapainen yhdiste, so. se vastaanottaa elektronin kroaogeenistä, Jolloin kromogeeni muuttuu värilliseksi· Lisäksi hapan, kiinteä aines toimii lelmausnesteen adnorbolntlaineena Ja muodostunut merkki siirtyy siihen. Yleisesti käytettyjä happamia aineksia ovat happanet savet ja happanet orgaaniset polymeerit, esim. fenolipolymeerit, fenoliasetyleeni-polyneerit, maleiinihappo-hartsimuovit, osittain tai täysin hydrolysoidut styreeniäsieiinianhydridisekapolyneerit, eteenimalellnianhydridlsekapoly-meerit, karboksipolymetyleeni, osittain tai täysin hydrolysoitu vinyyliae-tyylieetteri-malellnianhydridisekapolymeeri sekä niiden seokset.The chromogen is preferably dissolved in a suitable solvent as a recording fluid, which is capable of reacting with an acidic solid. The acidic substance may be a Levis acid-like compound, i. it receives an electron from the chaogenic, whereby the chromogen becomes colored · In addition, the acidic, solid material acts as an adnorbolnt wave of the lymph and the formed sign passes into it. Commonly used acid materials are leavened leavened clays and organic polymers, e.g. phenolic, fenoliasetyleeni-polyneerit, hartsimuovit maleic acid, partially or fully hydrolyzed styreeniäsieiinianhydridisekapolyneerit, eteenimalellnianhydridlsekapoly-polymers, carboxypolymethylene, partially or fully hydrolyzed vinyyliae-ether-malellnianhydridisekapolymeeri and mixtures thereof.
Seuraavassa esimerkissä kuvataan tavanomaisten menetelmien avulla tapahtuvaa suoraketjuisten alkyylisubstituoitujen aromaattlliuottialen valmistusta, jolloin määrättyä aromaattia alumllnlkloridlalkyloldaan 1-olefUnilla.The following example describes the preparation of straight-chain alkyl-substituted aromatic solvent bases by conventional methods, in which case a certain aromatic is alkylated with 1-olefin.
Suoraketjuisen heksyylidifenyylin valmistus.Preparation of straight chain hexyldiphenyl.
Reaktiokolviin lisätään 462 g difenyyllä ja kuumennetaan 80°Cteen. Lisätään 2,0 g AlCl^ Ja kolvia huuhdellaan 5»5 g»11a kloorivetykaasua. Lämpötila pidetään 75° ~ 80°Ctssa ja samalla lisätään hitaasti kahden tunnin aikana 151 g bekseeni-lttä. Hekseenl-ltn lisäyksen päätyttyä reagoivia aineita eeleotetaan reektiolämpötilaaea 15 minuuttia Ja huuhdellaan sitten 15 minuuttia typellä. Typplhuuhtelun Jälkeen reaktloseoe neutraloidaan lisäämällä 2,9 E kalslumhydroksidia Ja 2,7 ml vettä. Beaktlotuote euodatetaan ja Halataan, jolloin saadaan reagoimatonta difenyyllä Ja 197 E heksyylidlfe-nyyliä värittömänä öljynä, kp. 166° - 180° C/530 Pe.To the reaction flask is added 462 g of diphenyl and heated to 80 ° C. Add 2.0 g of AlCl 2 and purge the flask with 5 x 5 g of hydrogen chloride gas. The temperature is maintained at 75 ° ~ 80 ° C while 151 g of benzene are slowly added over two hours. At the end of the addition of hexene, the reactants are eluted at the reaction temperature for 15 minutes and then purged with nitrogen for 15 minutes. After purging with nitrogen, the reaction mixture is neutralized by adding 2.9 E of calcium hydroxide and 2.7 ml of water. The reaction product is filtered off and halated to give unreacted diphenyl and 197 E hexyldiphenyl as a colorless oil, b.p. 166 ° - 180 ° C / 530 Pe.
Samalla tavoin valmistetaan euoraketjulnen butyylldifenyyli buteeni-listä 6In a similar manner, euryl chain butyldiphenyl butene 6 is prepared
S67 y OS67 y O
ja difenyylistä. Tuot· saadaan vaaleankeltaisena tisleenä, kp. 140° - 177°C/ 21'; Ta.and diphenyl. The product is obtained as a pale yellow distillate, b.p. 140 ° - 177 ° C / 21 '; Ta.
Suoraketjuinen oktyylinaftuleeni valmistetaan samalla tavoin käyttäen kuitenkin heptaanla liuottimena. Oktyylinaftäiseni saadaan talteen reaktiovä-liaineesta vaaleankeltaisena tisleenä, kp. 145° ** 167°C/120 Pa.Straight-chain octylnaphthylene is prepared in a similar manner, but using heptane as the solvent. My octyl naphthalene is recovered from the reaction medium as a pale yellow distillate, b.p. 145 ° ** 167 ° C / 120 Pa.
Erilaisten liuottimien vaikutus värlnkehittymisen nopeuteen ja voimakkuuteen määritettiin laboratoriomenetelmän avulla, jrasa valmistettiin kokeiltavaa liuotinta Ja siihen liuotettua kromogeenlä sisältävä leimausneste, neste siirrettiin savella tai muovilla päällystetylle paperille Ja värinke-hittymlsen voimakkuus Ja nopeus mitattiin heijastuamittarilla.The effect of different solvents on the rate and intensity of color development was determined by a laboratory method, and a test solvent was prepared.
Seursaviesa esimerkeissä valmistettiin standardileimausneste liuottamalla 0,5 g kideviolettilaktonia 10 gtaan liuotinta sekoittaen Ja liukenemisen niin vaatiessa lämmittäen 100° - 120°^teen. Liuos jäähdytettiin huoneenlämpötilaan, ympättiin muu teolla kromogeenikiteellä ja seisotettiin useita vuorokausia silloin tällöin sekoittaen yllkyllästymisen estämiseksi.In the following examples, a standard labeling liquid was prepared by dissolving 0.5 g of crystal violet lactone in 10 g of solvent with stirring and, if required, heating to 100 ° to 120 °. The solution was cooled to room temperature, otherwise seeded with chromogenic crystal and allowed to stand for several days, stirring occasionally, to prevent supersaturation.
▼ärinkehityskokeessa lelnausnestettä siirrettiin lääketiputtimella poiklttaisvyöhykkeeksl 5,2 cm leveälle, Joko savella tai muovilla päällystetylle aluetapaptrieulkaleelle. Sekuntikello käynnistettiin Ja vyöhyke levitettiin parranajoterällä paperisulkaleella. Viiden sekunnin väliajoin välittömästi päällystämisen jälkeen ja sen jälkeen ennalta määrätyin väliajoin mitattiin paperin heijastus Photovoltheijastuemittarilla. Mittari kalibroitiin osoittamaan 100 heijastusta, kun mitattiin pelkällä liuottimelle kostutetun, valkoisella standardiposlllnllevyllä olovan paperin heijastusta. Kuivan leimatun paperin lopulliset heijaetusmlttaukeet suoritettiin 16 tunnin kuluttua, Jolloin mittari oli kalibroitu näyttämään 100 £tn heljaetusta kuivalla, leimaamattomalla paperilla.. "Prosentuaalinen väri" eli värinkehitty-misen voimakkuus laskettiin kaavaeta 100 - heijaatusarvo, so. mitä euurempl prosentuaalinen väriarvo on, sitä tummempi on kehittynyt väri.In the business development experiment, the liquor was transferred by drip to a cross-sectional area 5.2 cm wide, coated with either clay or plastic. The stopwatch was started and the zone was applied with a shaving blade with a paper feather. At five-second intervals immediately after coating and at predetermined intervals thereafter, the paper reflectance was measured with a Photovolt reflectometer. The meter was calibrated to show 100 reflections by measuring the reflection of solvent-moistened paper on a white standard plate only. Final reflectance measurements of the dry labeled paper were performed after 16 hours, at which time the meter was calibrated to show 100 pounds of annealed paper on the dry, unlabeled paper. The "percentage color," or intensity of color development, was calculated to be the 100-reflection value, i.e. the percentage of euurempl in color, the darker the developed color.
Leituausneriteen lämmönkestävyyn määritettiin kuumentamalla nestettä hitaasti 150° - 160°Cteen ja pitämällä sitä tässä lämpötilassa noin 15 - 60 minuuttia. Tämän Jälkeen liuoksen annettiin Jäähtyä huoneenlämpötilaan ja nesteen mahdolliset värinmuutoknet merkitään muistiin. Sitten tätä IsImus-neetettä käytettiin yllä kuvatulla tavalla värlnkehltyekokeeaaa lämpökäaitts-lyn värlnkehltyllien nopeuteen ja voimakkuuteen vaikuttavien seikkojen selvittämiseksi slkupsrälslluoksssn verrattuna.The heat resistance of the baking netting was determined by slowly heating the liquid to 150 ° to 160 ° C and maintaining it at this temperature for about 15 to 60 minutes. Thereafter, the solution was allowed to cool to room temperature and any color changes in the liquid were noted. This IsImus rivet was then used as described above to determine the factors affecting the speed and intensity of the heat treatment of the heat shield compared to the slurry.
Näiden kokeiden tulokset ilmenevät taulukosta I, josta nähdään tämän keksinnön liuottimien ylivoimainen suorituskyky Ja suoraketjulaten alkyyli-substituoltujen aromaattien sdulllsuus verrattuina haarautuneisiin alkyyll-substltuoltulhin yhdisteisiin. Taulukossa määritelty mines on vmln esimerkkinä eikä käsiteltävänä oleva keksintö rajoitu siihen.The results of these experiments are shown in Table I, which shows the superior performance of the solvents of this invention and the suitability of straight-chain alkyl-substituted aromatics compared to branched alkyl-substituent compounds. The Mines defined in the table are an example of vmln and the present invention is not limited thereto.
7 S6790 «β -rt 3 CM ·** 4->7 S6790 «β -rt 3 CM · ** 4->
-4 3 Irt H :« 3 > M-4 3 Irt H: «3> M
»H"B
BC O® CD UN rj- KN CD |— Ti -f NNBC O® CD AND rj- KN CD | - Ti -f NN
•p4 Ή VO CfV UN UN VO VO UN UN t}· MO VO• p4 Ή VO CfV AND UN VO VO AND UNIT} MO VO
O C M G rt 3 t: *> 4> I pH II II CVJ CM pH CD I CD f— C VD VO UN Ti LTV u*v Ή ·O C M G rt 3 t: *> 4> I pH II II CVJ CM pH CD I CD f— C VD VO UN Ti LTV u * v Ή ·
u rt Gu rt G
:rt C -h > rt a: rt C -h> rt a
4* ON VO O C— PN Γ~~ H CO KNO KN4 * ON VO O C— PN Γ ~~ H CO KNO KN
QXH Ti rr 'ti- NN *i Tf pH Ti KN CMQXH Ti rr 'ti- NN * i Tf pH Ti KN CM
Φ O · G .* Λ •H C 0) ph rt e rt *">Φ O · G. * Λ • H C 0) ph rt e rt * ">
rt rt O rf on on KN irvo ovi— cm TT Ort rt O rf on is KN irvo ovi— cm TT O
3 NN Tj· NN CM CM CM KN Ti CM CM3 NN Tj · NN CM CM CM KN Ti CM CM
♦» n · C SJI v *> (I rt -H rt♦ »n · C SJI v *> (I rt -H rt
O JSO JS
h «O O^t pH CD CM CM VO LfN pH O VOh «O O ^ t pH CD CM CM VO LfN pH O VO
III JH CM pH pH H H Ni CM pHIII JH CM pH pH H H Ni CM pH
c ·>& e ** Φ M -4 rc ·> & e ** Φ M -4 r
O β rt O II BO β rt O II B
> -4 rt VO> -4 rt VO
H Ή O OH Ή O O
rt rt -4 rH (Hrt rt -4 rH (H
rt rt ·rt rt ·
M K 3 J< GM K 3 J <G
4» +* 0¾¾. —4 r4 »+ * 0¾¾. —4 r
0-4 c rt o B CM UN0-4 c rt o B CM UN
M JS Φ -4 O LTV CM O Γ— -4 «HM JS Φ -4 O LTV CM O Γ— -4 «H
J4 ® β B uv vo ή m o pH MMJ4 ® β B uv vo ή m o pH MM
SM O rt pH VO :rt :rt pH c u ** > > 3 -H Oi H*SM O rt pH VO: rt: rt pH c u **>> 3 -H Oi H *
“ :S · SS“: S · SS
> n rt o N HV OO CNJ KN> n rt o N HV OO CNJ KN
jrtrtNi cm r<v vn on u-n äB jd C O -4jrtrtNi cm r <v vn is u-n äB jd C O -4
« -4¾¾. β H«-4¾¾. β H
M M HfO pH pH vOO O kn •H :rt O pH CM KN t}· KVKV Tj·M M HfO pH pH vOO O kn • H: rt O pH CM KN t} · KVKV Tj ·
< > KN<> CN
e rt c c Φ M Φ Φ c 2 g ae rt c c Φ M Φ Φ c 2 g a
*H *H *H «H* H * H * H «H
C rt P. rt rt Φ *> 4»C rt P. rt rt Φ *> 4 »
a Pl μ iH pHa Pl μ iH pH
m rt φ e> Φ rtm rt φ e> Φ rt
O m β ·* -WO m β · * -W
3 2 G r: c c 2 -h rt rt rt *o rt :o -4 pH φ o φ 4» ® 4> o.3 2 G r: c c 2 -h rt rt rt * o rt: o -4 pH φ o φ 4 »® 4> o.
—4—4 pH pH pH —4 pH —4 —H—4-4 pH pH pH44 pH -4H
M M rt rt rt IHrt U UM M rt rt rt IHrt U U
xt xl rt rt rt rrtrt :rt ®xt xl rt rt rt rrtrt: rt ®
t» > ►► > ►► > Β It »> ►►> ►►> Β I
—4 «H —4—4 «H —4
—H · · C pH pH—H · · C pH pH
pH O C · K -4 I -4 Φ I kkpH O C · K -4 I -4 Φ I kk
SB-4 BpHh>-4 h* cl MSB-4 BpHh> -4 h * cl M
G UN pH UN rt pH «pHG AND pH UN rt pH «pH
• pH K pH 4> pH K pH I «m rt «M ►» \ «M ^ k \ . -41• pH K pH 4> pH K pH I «m rt« M ► »\« M ^ k \. -41
-4 0** O rt O -*J O .* tJO-4 0 ** O rt O - * J O. * TJO
•e o 3 o aojrf o · -4 ph• e o 3 o aojrf o · -4 ph
—40.0 0-400 o rt -4 pH O—40.0 0-400 o rt -4 pH O
pH VO VO pH UN UN C KpH VO VO pH UN AND C K
a K Ö H C C pH KCpH t C pH t· k Ia K Ö H C C pH KCpH t C pH t · k I
-4 KO 4» O K O H*0 4* « 5»-4 KO 4 »O K O H * 0 4 *« 5 »
4* 4» 4» p P 4» p 4» 4* p P 4* p pm M VO4 * 4 »4» p P 4 »p 4» 4 * p P 4 * p pm M VO
o 3 rt ·£ g W4* M Λ 4» H -4 rt ♦» 5 4» Φ C.' 4* 3 Ort4* 3 -4 i 4* O fl 4* 3 a 9 4> 3 o SS -4o 3 rt · £ g W4 * M Λ 4 »H -4 rt ♦» 5 4 »Φ C. ' 4 * 3 Ort4 * 3 -4 i 4 * O fl 4 * 3 a 9 4> 3 o SS -4
-4 9· 4* pH 3 · 3· H* · β · 4* · CpH-4 9 · 4 * pH 3 · 3 · H * · β · 4 * · CpH
•a * G 3 k □ ti4*g 3 · 4* c d j> t 4» κ• a * G 3 k □ ti4 * g 3 · 4 * c d j> t 4 »κ
• aa rt k c 3 rt c 3 «h d e 3-4 m rt K• aa rt k c 3 rt c 3 «h d e 3-4 m rt K
»4·· M G · « U Φ Φ U m Φ Φ H pH C o c § 3 5 3£33 §33 3 CS 3 9 3 fc 3 § £ se s s r s s s scsi rasi rs r rs • · * · · ♦ ·»4 ·· M G ·« U Φ Φ U m Φ Φ H pH C o c § 3 5 3 £ 33 §33 3 CS 3 9 3 fc 3 § £ se s s r s s s scsi rasi rs r rs • · * · · ♦ ·
·< 05 O O U b. O· <05 O O U b. O
56790 s56790 s
Taulukon I liuottimien tarkemmat tiedot ovati Liuotin A. Valmistettu buteenl-lxstä ja buteeni-2«cta.Details of the solvents in Table I were solvent A. Prepared from butene-1x and butene-2.
Liuotin B. Valmistettu buteeni-lxn Ja buteeni-2/p-tert.-butyylidifenyylin 50t50-seokseeta.Solvent B. Prepared from a 50t50 mixture of butene-1xn and butene-2 / p-tert-butyldiphenyl.
Liuotin C. Valmistettu oktseni-1*stä*Solvent C. Prepared from octene-1 *
Liuotin D. Valmistettu di-isobutyleeniatä.Solvent D. Prepared from diisobutylene.
Liuotin E. Valmistettu sek. -amyylihalogenidista.Solvent E. Prepared sec. -amyylihalogenidista.
Liuotin E. Valmistettu hekseenl-l:ntä.Solvent E. Prepared from hexene-1.
Liuotin G. Valmistettu hekseenl-lin okteeni-ltn ja dekeeni-ltn seoksesta.Solvent G. Prepared from a mixture of hexene-octene-ltn and decene-ltn.
Taulukon I arvot ilmentävät seuraavia käsiteltävänä olevaan keksintöön liittyviä vaikutuksia.The values in Table I illustrate the following effects associated with the present invention.
Vftrinkehltysnopeus. Verrattaessa kohtaa A kohtaan B ja kohtaa C kohtaan 1) havaitaan, että "suorat" alkyyliyhdisteet kehittävät värin nopeammin kuin "haarautuneet" yhdisteet.Vftrinkehltysnopeus. Comparing point A to point B and point C to point 1), it is found that "straight" alkyl compounds develop color faster than "branched" compounds.
Värinkehltyksen voimakkuus. Kalkkien suorien alkyyllliuottinien kehittämä väri on noin 60 - 64 kun "haarautuneiden" alkyyliliuottimien vastaava arvo on 44 - 58 f>. Verrattaessa kohtaa A kohtaan B ja kohtaa C kohtaan D huomataan, että suorat yhdisteet kehittävät värin hieman, sutta selvästikin paremmin kuin vastaavat haarautuneet yhdisteet.Intensity of color development. The color developed by the straight alkyl solvents of lime is about 60 to 64 when the corresponding value of the "branched" alkyl solvents is 44 to 58 f>. Comparing point A to point B and point C to point D, it is observed that the direct compounds develop color slightly, clearly better than the corresponding branched compounds.
Väriliuoksen lämaönkestäTyys. Verrattaess kohtien A, B, C Ja P kuumennettuja ja kuumentamattomia näytteitä huomataan, että kuumentaminen kaikissa tapauksissa vaikuttaa haitallisesti värinkehittymisen nopeuteen Ja voimakkuuteen, mutta tällainen haitta on selvästi pienempi suoralla alkyyli-cinekaella A Ja C kuin haaraa tunteella alkyyllaineksella B ja D. Siten on selvää, että suorat yhdisteet kestävät paremmin lämpöä kuin vastaavat haarautuneet yhdisteet.Color fastness of the dye solution. Comparing the heated and unheated samples at A, B, C, and P, it is found that heating in all cases adversely affects the rate and intensity of color development, but such a disadvantage is clearly less with direct alkylcine A and C than with branching with alkyl waves B and D. Thus it is clear that the direct compounds are more heat resistant than the corresponding branched compounds.
Suorien alkyyliaromaattien parempi lämaönkestävyys ilmenee myös itse leimausnesteen lämmön aiheuttamasta värjäytymisestä. Vertaamalla taulukon I kohtia A, B, C Ja D havaitaan, että kuumennettaecsa suorat alkyyliyhdisteet värjäytyvät vaalean meripihkan tai vaaleankeltaisiksi kun taas vastaavat haarautuneet yhdisteet tulevat tummemman meripihkan värisiksi.The better impact resistance of direct alkyl aromatics is also evident from the heat-induced discoloration of the labeling liquid itself. Comparing points A, B, C and D of Table I, it is observed that when heated, the straight alkyl compounds turn pale amber or pale yellow while the corresponding branched compounds turn darker amber.
TIU mainitun lisäksi näyttää suorilla alkyyliaromaattiväriliuottimillp kehitetty väri olevan haalistumiskeatävämpi kuin vastaavilla haarautuneilla alkyyliyhdisteillä kehitetty väri. Esim. suora butyylidiienyyli (liuotin A), Jonk» kehittämä maksimiväriarvo oli 60, ai neljän kuukauden kuluttua ollut haalistunut lainkaan, kun taas haarautunut butyylidlfenyyll (liuotin B) oli haalistunut arvosta 58 arvoon 56. Kuumennetuista näytteistä suora yhdiste haalistui arvosta 58 arvoon 54 ja haarautunut yhdiste arvosta 53 arvoon 48.In addition, the TIU shows that the color developed with direct alkyl aromatic dye solvents is more fading than the color developed with the corresponding branched alkyl compounds. For example, direct butyldiienyl (solvent A), which had a maximum color value of 60, had not faded at all after four months, while branched butyldiphenyl (solvent B) had faded from 58 to 56. From the heated samples, the direct compound faded from 58 to 54 and branched. compound from 53 to 48.
Joskin tämän keksinnön suositeltavana toteuttamismuotona on kaksl-arkkijärjestelmä. Jossa hapan aluata-alnes on toimessa orkissa ja krcmo- β··η1& Ja liuotinta sisältävä lslme.usnsste on toisessa arkissa, jostaAlthough a preferred embodiment of the present invention is a double-sheet system. Where the acidic aluata-Alnes is in action in the orc and krcmo- β ·· η1 & And the solvent-containing lslme.usnsste is in the second sheet, of which
9 567'JO9 567'JO
leimausneste vapautuu happamelle ainekselle paineen vaikutuksesta, keksintö ei rajoitu pelkästään tällaisiin järjestelmiin. Painehsrkässä rekisteröintijärjestelmässä on ainoana tärkeänä vaatimuksena, että ennen paineen käyttämistä kroaogeeni Ja hapan herkietysalnes ovat erillään eli reagoimattoaassa tilassa Ja että painetta käytettäessä täaän keksinnön uudet liuottinet vapautuvat niin, että kroaogeeni Ja hapan aines reagoivat keskenään. Hiinpä on aahdollieta säilyttää kroaogeeni Ja hapan aines kuivassa ja reagoimattoaassa tilassa Jollakin tavallisella alueta-aineella Ja pelkkä liuotin erillisellä alustalla. Painetta käytettäessä liuotin vapautuu kromogeenln Ja happaaen aineksen seokseen Ja edistää paikallista reaktiota Ja värin kehittymistä.the labeling fluid is released to the acidic material under pressure, the invention is not limited to such systems. The only important requirement in a pressure-sensitive recording system is that before the pressure is applied, the cryogenic and acidic sensitization troughs are separate, i.e., in an unreacted state, and that the new solvents of the present invention are released so that the cryogenic and acidic substances react with each other. Thus, it is possible to store the cryogenic And acidic substance in a dry and unreacted state with some common area substance And a simple solvent on a separate medium. When pressure is applied, the solvent is released into the mixture of chromogenic and acidic material and promotes local reaction and color development.
On llaelstä, että voidaan ajatella liuottlaen ja leiaausalneksen monia muita järjestelyjä, ulkomuotoja Ja suhteita niitä alusta-arkille tai -rainalle kapseloitaessa Ja sijoitettaessa ja tällaiset järjestelyt kuuluvat käsiteltävänä olevan keksinnön patenttisuojapiiriin. Hiinpä esia. on aahdollieta päällystää yksittäinen paperi tai alusta-aine täaän Järjestelmän kaikilla komponenteilla muodostamaan itsetoimiva yksikkö, joka piirtimellä tai anulla esineellä painettaessa leiaaa paperin pinnalle. Tällaiset paperit sopivat erityisen hyvin käytettäviksi austeettomissa rekisteröintilaitteissa.It is contemplated that many other arrangements, shapes, and relationships of the solvent and leaching vessel may be contemplated when encapsulating and placing them on a substrate sheet or web, and such arrangements are within the scope of the present invention. That's right. it is possible to coat a single paper or substrate with all the components of the system to form a self-contained unit which, when printed with a pen or other object, finds the paper on the surface. Such papers are particularly well suited for use in unearthed recording devices.
Siten käsiteltävänä olevan keksinnön suojapiiriin kuuluvat paineherkät rekisteröintipaperijärjestelaät, joissa tärkeimpinä leiaausaerkin reagoidessaan muodostavina aineina käytetään kroaogeeniainesta, hapanta herkistypainetta ja liuotinta, Joka on suoraketjuinen alkyyliaroaaattinen yhdiste. Ko. alan asiantuntijalle on selvää, että valmistettaessa paineherkkiä rekiste-röintipaperijärjestelaiä voidaan näitä .reagoivia aineita vaihdella ja yhdistellä monin tavoin. Tällaiset vaihtelut Ja yhdistelyt riippuvat esia* valitusta kromogesnialnestyypistä, päällysteen luonteesta ja sen lisäystavasta, käytettyjen alusta-aineiden määrästä ja järjestelmän käyttötarkoituksesta. Hiinpä käsiteltävänä oleva keksintö ei rajoitu yllä olevan kuvauksen ja esimerkkien yksityiskohtiin.Thus, within the scope of the present invention are pressure-sensitive recording paper system rolls in which a cryogenic agent, an acidic sensitizer pressure and a solvent, which is a straight-chain alkyl aromatic compound, are used as the main constituents of the reaction. Ko. It will be apparent to one skilled in the art that in the manufacture of a pressure sensitive recording paper system, these reactants can be varied and combined in many ways. Such variations and combinations will depend on the type of chromogenesis selected, the nature of the coating and how it is applied, the amount of substrates used and the intended use of the system. Accordingly, the present invention is not limited to the details of the above description and examples.
Claims (6)
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US17132371A | 1971-08-12 | 1971-08-12 | |
US17132371 | 1971-08-12 |
Publications (2)
Publication Number | Publication Date |
---|---|
FI56790B FI56790B (en) | 1979-12-31 |
FI56790C true FI56790C (en) | 1980-04-10 |
Family
ID=22623332
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
FI222672A FI56790C (en) | 1971-08-12 | 1972-08-11 | FAERGLOESNINGSMEDEL FOER TRYCKKAENSLIGT REGISTRERINGSMATERIAL |
Country Status (11)
Country | Link |
---|---|
JP (1) | JPS4827811A (en) |
BE (1) | BE787459A (en) |
BR (1) | BR7205517D0 (en) |
CH (1) | CH566220A5 (en) |
DE (1) | DE2239699A1 (en) |
ES (1) | ES405783A1 (en) |
FI (1) | FI56790C (en) |
FR (1) | FR2150106A5 (en) |
GB (1) | GB1368707A (en) |
IT (1) | IT963964B (en) |
SE (1) | SE385280B (en) |
Families Citing this family (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
JPS5347709Y2 (en) * | 1972-12-14 | 1978-11-15 | ||
JPS5320843Y2 (en) * | 1973-11-13 | 1978-06-01 | ||
JPS50110177U (en) * | 1974-02-19 | 1975-09-09 | ||
US4547222A (en) * | 1984-05-21 | 1985-10-15 | Ncr Corporation | High print intensity marking fluid |
Family Cites Families (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
JPS5339415B2 (en) * | 1972-02-22 | 1978-10-21 | ||
JPS522732B2 (en) * | 1972-04-19 | 1977-01-24 | ||
JPS5316483B2 (en) * | 1972-06-20 | 1978-06-01 |
-
0
- BE BE787459D patent/BE787459A/en unknown
-
1972
- 1972-08-11 FI FI222672A patent/FI56790C/en active
- 1972-08-11 GB GB3760072A patent/GB1368707A/en not_active Expired
- 1972-08-11 JP JP47080015A patent/JPS4827811A/ja active Pending
- 1972-08-11 ES ES405783A patent/ES405783A1/en not_active Expired
- 1972-08-11 SE SE1045172A patent/SE385280B/en unknown
- 1972-08-11 DE DE19722239699 patent/DE2239699A1/en active Pending
- 1972-08-11 IT IT2815472A patent/IT963964B/en active
- 1972-08-11 FR FR7229198A patent/FR2150106A5/fr not_active Expired
- 1972-08-11 CH CH1190872A patent/CH566220A5/xx not_active IP Right Cessation
- 1972-08-14 BR BR551772A patent/BR7205517D0/en unknown
Also Published As
Publication number | Publication date |
---|---|
BE787459A (en) | 1973-02-12 |
IT963964B (en) | 1974-01-21 |
CH566220A5 (en) | 1975-09-15 |
DE2239699A1 (en) | 1973-02-22 |
SE385280B (en) | 1976-06-21 |
FI56790B (en) | 1979-12-31 |
ES405783A1 (en) | 1975-07-16 |
GB1368707A (en) | 1974-10-02 |
BR7205517D0 (en) | 1973-07-03 |
JPS4827811A (en) | 1973-04-12 |
FR2150106A5 (en) | 1973-03-30 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US3937864A (en) | Heat-sensitive recording sheets having improved stability | |
FI65190C (en) | UPPTECKNINGSMATERIAL | |
FI65188C (en) | TRYCKKAENSLIGT KOPIERINGSSYSTEM | |
FI62548B (en) | SAOSOM FAIRGBILDARE ANVAENDBARA DIAMINOSUBSTITUERADE FLUORANFOERENINGAR | |
JPS5882788A (en) | Heat-sensitive recording material | |
FI56790C (en) | FAERGLOESNINGSMEDEL FOER TRYCKKAENSLIGT REGISTRERINGSMATERIAL | |
FI71693B (en) | CHROME COMPOSITION FOR FARING REQUIREMENTS | |
FI59051C (en) | TRYCKKAENSLIGT UPPTECKNINGSSYSTEM OMFATTANDE ETT KROMOGENT MNINGSMEDEL ATERIAL ETT MED DETTA REACTIVE MATERIAL OCH ETT TERFENYLLOES | |
FI74963C (en) | CHROMOGENE DIHYDROFUROPYRIDINONER. | |
FI56646C (en) | TRYCKKAENSLIGT KOPIERINGSSYSTEM | |
US4291901A (en) | Pressure-sensitive or heat-sensitive recording material | |
US4183553A (en) | Pressure- or heat-sensitive recording material and novel chromano compounds used therein | |
US3968301A (en) | Pressure-sensitive record material and dye solvents therefor | |
EP0056177A1 (en) | Pressure sensitive recording materials | |
US3691203A (en) | Fluoran derivatives for pressure sensitive copying paper | |
US3979324A (en) | Dye solvents for pressure-sensitive copying systems | |
KR0140098B1 (en) | Heat sensitive recording material | |
US4309047A (en) | Pressure-sensitive or heat-sensitive recording material | |
JPS585289A (en) | Thermograph recording composition and thermograph recording supporter from said composition | |
US3984605A (en) | Heat sensitive recording material containing decolorizing agent | |
KR950011115B1 (en) | Bis(phenoxymethyl-and naphthoxymethyl)benzene derivatives | |
FI87070B (en) | CHROMOGENIC BIS-QUINAZOLINE FUELENARAR, FOERFARANDE FOER DERAS FRAMSTAELLNING OCH ANVAENDNING DAERAV SOM FAERGBILDARE I TRYCKKAENSLIGA ELLER VAERMEKAENSLIGA UPPTECKNINGSMATERIAL. | |
FR2382338A1 (en) | HEAT SENSITIVE RECORDING COMPOSITIONS WITH COLORED PRECURSORS, BASED ON MIXTURES OR LACTON OR SPIROPYRANE ADDITIONS WITH A CYCLIC POLYKETONIC COLOR PRECURSOR | |
GB2207687A (en) | Recording materials | |
KR950010647B1 (en) | Heat-sensitive recording material |