ES2651192B2 - ALBUMS AND PEPTIDES ABLE TO HYDROLYZE ORGANOPHOSPHORATED COMPOUNDS AND CARBAMATES, AND USES OF THE SAME - Google Patents
ALBUMS AND PEPTIDES ABLE TO HYDROLYZE ORGANOPHOSPHORATED COMPOUNDS AND CARBAMATES, AND USES OF THE SAME Download PDFInfo
- Publication number
- ES2651192B2 ES2651192B2 ES201630997A ES201630997A ES2651192B2 ES 2651192 B2 ES2651192 B2 ES 2651192B2 ES 201630997 A ES201630997 A ES 201630997A ES 201630997 A ES201630997 A ES 201630997A ES 2651192 B2 ES2651192 B2 ES 2651192B2
- Authority
- ES
- Spain
- Prior art keywords
- seq
- sequence
- present
- composition according
- albumin
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Active
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/70—Carbohydrates; Sugars; Derivatives thereof
- A61K31/7088—Compounds having three or more nucleosides or nucleotides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K33/00—Medicinal preparations containing inorganic active ingredients
- A61K33/06—Aluminium, calcium or magnesium; Compounds thereof, e.g. clay
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K33/00—Medicinal preparations containing inorganic active ingredients
- A61K33/24—Heavy metals; Compounds thereof
- A61K33/26—Iron; Compounds thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K33/00—Medicinal preparations containing inorganic active ingredients
- A61K33/24—Heavy metals; Compounds thereof
- A61K33/30—Zinc; Compounds thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K33/00—Medicinal preparations containing inorganic active ingredients
- A61K33/24—Heavy metals; Compounds thereof
- A61K33/32—Manganese; Compounds thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K33/00—Medicinal preparations containing inorganic active ingredients
- A61K33/24—Heavy metals; Compounds thereof
- A61K33/34—Copper; Compounds thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/38—Albumins
- A61K38/385—Serum albumin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P39/00—General protective or antinoxious agents
-
- A—HUMAN NECESSITIES
- A62—LIFE-SAVING; FIRE-FIGHTING
- A62D—CHEMICAL MEANS FOR EXTINGUISHING FIRES OR FOR COMBATING OR PROTECTING AGAINST HARMFUL CHEMICAL AGENTS; CHEMICAL MATERIALS FOR USE IN BREATHING APPARATUS
- A62D3/00—Processes for making harmful chemical substances harmless or less harmful, by effecting a chemical change in the substances
- A62D3/02—Processes for making harmful chemical substances harmless or less harmful, by effecting a chemical change in the substances by biological methods, i.e. processes using enzymes or microorganisms
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/465—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from birds
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/76—Albumins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Epidemiology (AREA)
- Organic Chemistry (AREA)
- Molecular Biology (AREA)
- Inorganic Chemistry (AREA)
- Toxicology (AREA)
- Biochemistry (AREA)
- Zoology (AREA)
- Gastroenterology & Hepatology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Engineering & Computer Science (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Biomedical Technology (AREA)
- Microbiology (AREA)
- Business, Economics & Management (AREA)
- Emergency Management (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Immunology (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Abstract
Albúminas y péptidos capaces de hidrolizar compuestos organofosforados y carbamatos, y usos de los mismos.#La presente invención divulga la secuencia amino terminal de la albúmina de aves unida a cationes divalentes tales como cobre o zinc, así como cualquier proteína recombinante o de fusión que comprenda dicha secuencia para su uso como medicamento, específicamente para el tratamiento de intoxicaciones producidas por compuestos organofosforados. La presente invención también describe composiciones y métodos de tratamiento para dicho tipo de intoxicaciones. Por otro lado, la presente invención divulga el uso de dichas secuencias y péptidos que las comprenden para la descontaminación y/o biorremediación de zonas o superficies contaminadas por compuestos organofosforados y para el aislamiento de compuestos quirales.Albumin and peptides capable of hydrolyzing organophosphorus compounds and carbamates, and uses thereof. # The present invention discloses the amino terminal sequence of bird albumin bound to divalent cations such as copper or zinc, as well as any recombinant or fusion protein that comprise said sequence for use as a medicine, specifically for the treatment of poisonings produced by organophosphorus compounds. The present invention also describes compositions and methods of treatment for said type of poisonings. On the other hand, the present invention discloses the use of said sequences and peptides that comprise them for the decontamination and / or bioremediation of areas or surfaces contaminated by organophosphorus compounds and for the isolation of chiral compounds.
Description
55
1010
15fifteen
20twenty
2525
3030
3535
ALBUMINAS Y PEPTIDOS CAPACES DE HIDROLIZAR COMPUESTOS ORGANOFOSFORADOS Y CARBAMATOS, Y USOS DE LOS MISMOS.ALBUMS AND PEPTIDES ABLE TO HYDROLYZE ORGANIC PHOSPHORED COMPOUNDS AND CARBAMATES, AND USES OF THE SAME.
DESCRIPCIONDESCRIPTION
CAMPO TECNICOTECHNICAL FIELD
La presente invencion se refiere a un peptido aislado que se corresponde con la region amino terminal de la albumina de aves y que es capaz de hidrolizar compuestos organofosforados y carbamatos. La invencion tambien se refiere a constructos de acidos nucleicos, protelnas de fusion, vectores, celula huesped y composiciones que comprenden los polinucleotidos o peptidos, asl como metodos para producir y usar los polipeptidos.The present invention relates to an isolated peptide that corresponds to the amino terminal region of the albumine of birds and which is capable of hydrolyzing organophosphorus compounds and carbamates. The invention also relates to nucleic acid constructs, fusion proteins, vectors, host cell and compositions comprising polynucleotides or peptides, as well as methods for producing and using the polypeptides.
ESTADO DE LA TECNICASTATE OF THE TECHNIQUE
Los plaguicidas son productos de slntesis qulmica que comprenden compuestos del tipo organoclorados, organofosforados y carbamatos, que ocasionaron fuertes problemas de contamination al medio ambiente y resistencia de los insectos, ademas de efectos nocivos a los organismos no blanco. Los compuestos organofosforados (OPs) son esteres, amidas o tioles derivados del acido fosforico o fosforotioico y los carbamatos son esteres del acido carbamico. El 30% de los compuestos organofosforados son mezclas racemicas que desarrollan una potente neurotoxicidad estereoselectiva en los seres vivos. En este sentido, la Organization Mundial de la Salud (OMS) ha reportado que las intoxicaciones humanas por compuestos organofosforados, afecta a una alta proportion de personas en la agricultura, considerandose, ademas un problema de salud publica y de salud ambiental. Los compuestos organofosforados son empleados para la elaboration de lubricantes, agentes nerviosos empleados en conflictos belicos y sobre todo insecticidas y plaguicidas para el control de insectos (vectores) en salud publica y en las actividades agricolas. Anualmente se sintetizan cientos de toneladas de estos compuestos entre los que se encuentran el malation, paration, clorpirifos, metamidofos, monocrotofos, tricloronato, metamidofos, acefato y diazinon, entre otros. A pesar del desarrollo de bioinsecticidas, la demanda de compuestos organofosforados de origen industrial es requerida por su alta eficacia para el mejor control de insectos sobre todo en palses tropicales.Pesticides are products of chemical synthesis that include compounds of the organochlorine, organophosphorus and carbamate type, which caused strong problems of contamination to the environment and resistance of insects, in addition to harmful effects on non-white organisms. Organophosphorus compounds (OPs) are esters, amides or thiols derived from phosphoric or phosphorothioic acid and carbamates are esters of carbamic acid. 30% of organophosphorus compounds are racemic mixtures that develop potent stereoselective neurotoxicity in living beings. In this regard, the World Health Organization (WHO) has reported that human poisoning by organophosphorus compounds affects a high proportion of people in agriculture, and is also considered a public health and environmental health problem. Organophosphorus compounds are used for the preparation of lubricants, nerve agents used in warlike conflicts and especially insecticides and pesticides for the control of insects (vectors) in public health and in agricultural activities. Hundreds of tons of these compounds are synthesized annually, including malation, paration, chlorpyrifos, methamidophos, monocrotophos, trichloronate, methamidophos, acetate and diazinon, among others. Despite the development of bioinsecticides, the demand for organophosphorus compounds of industrial origin is required due to their high efficiency for the best control of insects, especially in tropical countries.
55
1010
15fifteen
20twenty
2525
3030
3535
Generalmente, en los ambientes de trabajo en los que existe presencia de compuestos OPs no existen sistemas de seguridad, tipo sensores, ni de degradation, tipo biocatalizadores, eficientes para la detection en aire y para el control de desechos llquidos de estos compuestos por falta de sistemas enzimaticos que los degraden in situ, evitando asl la intoxication y contamination a la que dan lugar. Por estas razones, el control de las emisiones de OPs durante su production, asl como la elimination de residuos industriales y de las cantidades almacenadas de estos compuestos por parte de la industria qulmica representan un riesgo ocupacional y ambiental de toxicidad para los ecosistemas.Generally, in work environments where OPs are present, there are no safety systems, sensors, or degradation systems, biocatalysts, efficient for air detection and for the control of liquid waste of these compounds due to lack of Enzymatic systems that degrade them in situ, thus avoiding the intoxication and contamination to which they give rise. For these reasons, the control of OP emissions during their production, as well as the elimination of industrial waste and the stored quantities of these compounds by the chemical industry represent an occupational and environmental risk of ecosystem toxicity.
Otro campo en el que existe la necesidad de sistemas eficaces de eliminacion de compuestos organofosforados, es a nivel mundial en la destruccion de las miles de toneladas de arsenales de armas qulmicas (gases de guerra). Los metodos qulmicos y de incineration representan un alto riesgo, por lo que aproximaciones biotecnologicas con biocatalizadores en medios con condiciones suaves de temperatura y pH, son una alternativa deseable y de importante potencial aplicacion.Another field in which there is a need for effective systems of elimination of organophosphorus compounds is worldwide in the destruction of the thousands of tons of chemical weapons arsenals (war gases). The chemical and incineration methods represent a high risk, so biotechnological approaches with biocatalysts in mediums with mild temperature and pH conditions, are a desirable alternative and of important potential application.
En la actualidad, se emplean en la cllnica medica dos tipos estrategias farmacologicas para el tratamiento de intoxicaciones por OPs: a) antagonistas de acetilcolina (atropina) y, b) agentes nucleofilicos reactivadores de la acetilcolinestrerasa acetilcolinesterasa (oximas). A pesar de estas alternativas farmacologicas en casos graves de intoxicacion se presenta la muerte en lapsos cortos de tiempo (24-72 horas) debido a las altas concentraciones de dichos compuestos en el organismo. Por esta razon la busqueda de alternativas biologicas que degraden o hidrolicen dichos compuestos son una necesidad urgente a nivel mundial.Currently, two types of pharmacological strategies are used in the medical clinic for the treatment of PO poisonings: a) acetylcholine antagonists (atropine) and, b) acetylcholinesterase acetylcholinesterase reactive nucleophilic agents (oximes). Despite these pharmacological alternatives in severe cases of intoxication, death occurs in short periods of time (24-72 hours) due to the high concentrations of these compounds in the body. For this reason, the search for biological alternatives that degrade or hydrolyze these compounds is an urgent need worldwide.
En este sentido, existe en el estado de la tecnica un contado numero de protelnas que hidrolizan compuestos OPs llamadas fosfotriesterasas, entre las mas estudiadas y utilizadas se encuentra la paraoxonasa-1 (PON1) de suero de mamlferos y la fosfotriesterasa de Psedomonas diminuta. Ambas metaloprotelnas dependen de cationes divalentes para su actividad, con la particularidad que en presencia del cation divamente cobre (Cu2+) pierden su capacidad hidrolizante, es decir el Cu2+ es un inhibidor de enzimas fosfotriesterasas. A pesar de los esfuerzos realizados, no se han obtenido resultados satisfactorios con respecto al tratamiento y degradacion de compuestos OPs por parte de dichas enzimas. Por ejemplo, la enzima PON1 es unaIn this sense, there is a small number of proteins in the state of the art that hydrolyze OPs compounds called phosphotriesterases, among the most studied and used are paraoxonase-1 (PON1) from mammalian serum and phosphotriesterase from Psedomonas diminuta. Both metalloprotins depend on divalent cations for their activity, with the particularity that in the presence of copper-divated cation (Cu2 +) they lose their hydrolyzing capacity, that is, Cu2 + is an inhibitor of phosphotriesterase enzymes. Despite the efforts made, no satisfactory results have been obtained with respect to the treatment and degradation of OPs compounds by said enzymes. For example, the enzyme PON1 is a
55
1010
15fifteen
20twenty
2525
3030
3535
enzima muy limitada en cuanto al numero de compuestos OPs que hidroliza, asl como por su inactividad enzimatica estereoselectiva frente a OPs quirales. En cuanto a las fosfotriesterasas bacterianas, a pesar de que hidrolizan compuestos OPs a mayor velocidad que la enzima PON1, generalmente son estereoselectivas a favor de los isomeros menos toxicos, y muestran efectos adversos inmunologicos durante su aplicacion in vivo en mamlferos incluyendo el ser humano. Por otro lado, tambien es conocido que la albumina presenta la capacidad de hidrolizar compuestos organofosforados. Se ha identificado el sitio 411 (Tyr411) de la albumina de pollo como el sitio responsable de la hidrolisis del compuesto organofosforado O-hexil,O-2,5 diclorofenilfosforamidato (HDCP) (Sogorb et al., Chem. Res. Toxicol. 1998; 11:14411446). De la misma manera, otros estudios hablan sugerido la interaction de compuestos organofosforados con el sitio 411 de la albumina de mamlferos empleando compuestos organofosforados de interes toxicologico como el diisopropilfluorofosfato (DFP) (Schuh, Arch. Toxicol. 1970; 26:262-72). Dicha actividad hidrolizante de compuestos organofosforados de las albuminas de pollo, conejo, gallina y humana es muy baja haciendo que dichas enzimas, en su estado original, no puedan ser utilizadas en los campos de la biomedicina y la biotecnologla para la degradation de compuestos organofosforados.Very limited enzyme in terms of the number of OPs compounds it hydrolyzes, as well as its stereoselective enzymatic inactivity against chiral OPs. As for bacterial phosphotriesterases, although they hydrolyse OPs compounds at a faster rate than the PON1 enzyme, they are generally stereoselective in favor of less toxic isomers, and show immunological adverse effects during in vivo application in mammals including humans. On the other hand, it is also known that albumin has the ability to hydrolyze organophosphorus compounds. Site 411 (Tyr411) of chicken albumin has been identified as the site responsible for the hydrolysis of the organophosphorus compound O-hexyl, O-2,5 dichlorophenylphosphoramidate (HDCP) (Sogorb et al., Chem. Res. Toxicol. 1998 ; 11: 14411446). Likewise, other studies have suggested the interaction of organophosphorus compounds with the 411 site of mammalian albumin using organophosphorus compounds of toxicological interest such as diisopropylfluorophosphate (DFP) (Schuh, Arch. Toxicol. 1970; 26: 262-72) . Said hydrolyzing activity of organophosphorus compounds of chicken, rabbit, chicken and human albumines is very low, since said enzymes, in their original state, cannot be used in the fields of biomedicine and biotechnology for the degradation of organophosphorus compounds.
Por lo tanto, existe en el estado de la tecnica una necesidad de encontrar alternativas biologicas a las descritas anteriormente que sean capaces de degradar eficazmente los compuestos OPs y carbamatos, sin dar lugar a efectos adversos inmunologicos.Therefore, there is a need in the state of the art for finding biological alternatives to those described above that are capable of effectively degrading OPs and carbamates compounds, without giving rise to immunological adverse effects.
DESCRIPCION DE LA INVENCIONDESCRIPTION OF THE INVENTION
En un primer aspecto, la presente invention se refiere a un peptido aislado, a partir de aqul lo denominaremos "peptido de la invencion”, que consiste en una secuencia de aminoacidos que tiene al menos un 95%, 96%, 97%, 98%, 99% de identidad con la secuencia de aminoacidos de SEQ ID NO: 1, en una realization mas preferida el peptido de la invencion comprende una secuencia de aminoacidos que tiene al menos un 95%, 96%, 97%, 98%, 99% de identidad con la secuencia de aminoacidos de SEQ ID NO NO: 2.In a first aspect, the present invention relates to an isolated peptide, from here we will call it "peptide of the invention", which consists of an amino acid sequence having at least 95%, 96%, 97%, 98 %, 99% identity with the amino acid sequence of SEQ ID NO: 1, in a more preferred embodiment the peptide of the invention comprises an amino acid sequence having at least 95%, 96%, 97%, 98%, 99% identity with the amino acid sequence of SEQ ID NO NO: 2.
Dichas secuencias SEQ ID NOs: 1 o 2 se corresponden con las regiones N-terminal de las albuminas de aves, mas preferentemente de las albuminas de pollo o pavo. Dichas secuencias peptldicas aisladas se demuestra en la presente invencion que sonSaid sequences SEQ ID NOs: 1 or 2 correspond to the N-terminal regions of the bird albumins, more preferably of the chicken or turkey albumines. Such isolated peptide sequences are demonstrated in the present invention that are
las regiones concretas dentro de los peptidos de las albuminas de aves, preferentemente de las albuminas de pollo y pavo, a las que se une al menos un cofactor de tipo cation metalico, permitiendo que dichas protelnas presenten actividad organofosfatasa, siendo por tanto capaces de hidrolizar compuestos 5 organofosforados, esteres carbamicos y/o carboxllicos.the specific regions within the peptides of the bird albumins, preferably of the chicken and turkey albumines, to which at least one metal cation cofactor is attached, allowing said proteins to exhibit organophosphatase activity, thus being able to hydrolyze 5 organophosphorus compounds, carbamic and / or carboxylic esters.
En la Tablal se muestra una comparativa de los aminoacidos presentes en la zona N- terminal de albuminas de diferentes especies, especlficamente aquellos aminoacidos a los que se unen los cationes divalentes metalicos para posibilitar la funcion de 10 hidrolisis de compuestos organofosforados y/o carbamicos por parte de las albuminas de aves. En dicha Tabla 1 se muestra la secuencia aminoacldica de la region N- terminal de albuminas tal y como se encuentran en suero tras las modificaciones postraduccionales de las protelnas precursoras. Tal y como se observa en dicha comparativa de la Tabla 1 la albumina de las especie humana, conejo, bovina, cerdo, 15 y perro, no tienen el glutamico (E) en la posicion 3 y las regiones N-terminal de las albuminas de cobra y lamprea no presentan ninguna homologla con la region N- terminal de la albumina de pavo o pollo (SEQ ID NO: 2).The Table shows a comparison of the amino acids present in the N-terminal zone of albumins of different species, specifically those amino acids to which the divalent metal cations are attached to enable the function of hydrolysis of organophosphorus and / or carbamic compounds by part of the bird albumines. Table 1 shows the amino acid sequence of the N-terminal region of albumin as they are in serum after post-translational modifications of the precursor proteins. As can be seen in this comparison of Table 1, the albumine of the human species, rabbit, bovine, pig, 15 and dog, does not have the glutamic (E) in position 3 and the N-terminal regions of the albumins of Cobra and lamprey do not present any homologla with the N-terminal region of turkey or chicken albumine (SEQ ID NO: 2).
Tabla 1. Comparativa de los aminoacidos presentes en la zona N-terminal de 20 albuminas de diferentes especies.Table 1. Comparison of the amino acids present in the N-terminal zone of 20 albumines of different species.
- Especie Species
- Aminoacidos SEQ ID NO: Amino Acids SEQ ID NO:
- Pollo Chicken
- DAEHK 2 DAEHK 2
- Pavo Turkey
- DAEHK 2 DAEHK 2
- Humano Human
- DA-HK 5 DA-HK 5
- Conejo Rabbit
- EA-HK 6 EA-HK 6
- Oveja Sheep
- DT-HK 7 DT-HK 7
- Bovino Bovine
- DT-HK 8 DT-HK 8
- Cerdo Pork
- DT-YK 9 DT-YK 9
- Perro Dog
- EA-YK 10 EA-YK 10
- Rata Rat
- EA-HK 11 EA-HK 11
- Cobra Cobra
- TSSTG 12 TSSTG 12
- Lamprea Lamprey
- EDESF 13 EDESF 13
La zona N-terminal de las albuminas de pollo (SEQ ID NO: 14) y pavo (SEQ ID NO: 15), espedficamente la region que va del aminoacido 1 al 40, es identica en ambas especies, excepto que el aminoacido localizado en la posicion 24 de la region N- terminal de la albumina de pollo (SEQ ID NO: 14) es F, mientras que en la misma 5 region en la albumina de pavo (SEQ ID NO: 15) es V (Ver Tabla 2), pero dichas posiciones de estos aminoacidos estan fuera de la region concreta de SEQ ID NO: 1 y mas espedficamente la SEQ ID NO: 2, a la que se une el cation metalico divalente y que proporciona la capacidad espedfica de hidrolizar compuestos organofosforados y/o carbamicos, por lo que no afecta a la capacidad hidrolrtica de dichos compuestos.The N-terminal zone of chicken albumins (SEQ ID NO: 14) and turkey (SEQ ID NO: 15), specifically the region that goes from amino acid 1 to 40, is identical in both species, except that the amino acid located in position 24 of the N-terminal region of chicken albumin (SEQ ID NO: 14) is F, while in the same 5 region in turkey albumin (SEQ ID NO: 15) is V (See Table 2) , but said positions of these amino acids are outside the specific region of SEQ ID NO: 1 and more specifically SEQ ID NO: 2, to which the divalent metal cation is attached and which provides the specific ability to hydrolyze organophosphorus compounds and / or carbamics, so it does not affect the hydrolytic capacity of said compounds.
1010
En la Tabla 2 se muestra la zona N-terminal de las albuminas y precursores de albuminas de diferentes especies. Subrayado se muestra la region de interes a la que se une el cation divalente metalico para dotar de la actividad de hidrolisis de compuestos organofosforados y/o esteres carbamicos descrita en la presente 15 invencion.Table 2 shows the N-terminal zone of albumin and albumin precursors of different species. Underlined is the region of interest to which the metal divalent cation is attached to provide the hydrolysis activity of organophosphorus compounds and / or carbamic esters described in the present invention.
Tabla 2. Zona N-terminal de las albuminas y precursores de albuminas de diferentes especies.Table 2. N-terminal zone of albumins and albumine precursors of different species.
- Especie Species
- Region N-terminal SEQ ID NO: Region N-terminal SEQ ID NO:
- Precursor albumina serica de pollo [Gallus gallus] Seric chicken albumin precursor [Gallus gallus]
- MKWVTLISFIFLFSSATSRNLQRFARDAEHK S 14 MKWVTLISFIFLFSSATSRNLQRFARDAEHK S 14
- Albumina de pavo [Meleagris gallopavo] Turkey albumina [Meleagris gallopavo]
- MKWVTLISFIFLFSSATSRNLQRVARDAEHK SEIA 15 MKWVTLISFIFLFSSATSRNLQRVARDAEHK SEIA 15
- Albumina humana [Homo sapiens] Human albumin [Homo sapiens]
- MKWVTFISLLFLFSSAYSRGVFRRDAHKSEV 16 MKWVTFISLLFLFSSAYSRGVFRRDAHKSEV 16
- Precursor de la albumina de conejo Rabbit albumin precursor
- MKWVTFISLLFLFSSAYSRGVFRREAHKSEI AHR 17 MKWVTFISLLFLFSSAYSRGVFRREAHKSEI AHR 17
- Albumina perro [Canis lupus familiaris] Albumina dog [Canis lupus familiaris]
- EAYKSEIAHR 18 EAYKSEIAHR 18
- Albumina de rata [Rattus norvegicus] Rat albumin [Rattus norvegicus]
- MKWVTFLLLLFISGSAFSRGVFRREAHKSEI AHR 19 MKWVTFLLLLFISGSAFSRGVFRREAHKSEI AHR 19
55
1010
15fifteen
20twenty
2525
3030
Como se observa en las Tablas 1 y 2 la secuencia (SEQ ID NO: 2) de la region N- terminal de las albuminas de aves, mas en particular de las albuminas de pavo y pollo, es una region diferente a la que presentan las albuminas del resto de vertebrados. Dicha region de SEQ ID NO: 2 unida a cationes divalentes metalicos, preferentemente a cationes tales como zinc (Zn2+) y/o cobre (Cu2+), configuran un centro catalltico en la secuencia proteica de las albuminas de aves capaz de hidrolizar de manera efectiva y sin efectos inmunologicos adversos, compuestos organosfosforados y/o carbamatos, que son compuestos toxicos tanto para animales, incluido el hombre, como para el medio ambiente. Ademas, dadas las propiedades y relacion estructura-actividad que presentan los compuestos organofosforados y/o carbamatos con otros compuestos del tipo esteres o amidas, la secuencia SEQ ID NO: 2, asl como cualquier protelna recombinante o albumina de ave que comprenda dicha secuencia SEQ ID NO: 2, se puede utilizar para realizar modificaciones qulmicas en compuestos candidatos a su uso como medicamento, por ejemplo, fosforamidatos derivados de (-)-beta-D-(2T,4R)- diolano-timina (DOT) que se han propuesto como antivirales, o farmacos derivados de esteres clclicos tales como lactonas.As can be seen in Tables 1 and 2, the sequence (SEQ ID NO: 2) of the N-terminal region of the bird albines, more particularly of the turkey and chicken albines, is a different region from the one presented by the albumines of the rest of vertebrates. Said region of SEQ ID NO: 2 linked to divalent metal cations, preferably cations such as zinc (Zn2 +) and / or copper (Cu2 +), form a catallotic center in the protein sequence of bird albumins capable of effectively hydrolyzing and without adverse immunological effects, organosphosphorus compounds and / or carbamates, which are toxic compounds for both animals, including man, and the environment. In addition, given the properties and structure-activity relationship that organophosphorus compounds and / or carbamates have with other compounds of the esters or amides type, the sequence SEQ ID NO: 2, as well as any recombinant protein or bird albumin comprising said sequence SEQ ID NO: 2, can be used to make chemical modifications in candidate compounds for use as a medicine, for example, phosphoramidates derived from (-) - beta-D- (2T, 4R) - diolano-thymine (DOT) that have been proposed as antivirals, or drugs derived from clinical esters such as lactones.
La capacidad catalltica de degradar y/o hidrolizar compuestos organofosforados (actividad organofosfatasa) y/o esteres carbamicos de la secuencia SEQ ID NO: 2, viene dada por la presencia en dicha secuencia SEQ ID NO: 2 del aminoacido acido el glutamico (E) y el aminoacido histidina (H), en posiciones 3 y 4, respectivamente. Por lo tanto, los aminoacidos identificados como Xaa en las posiciones 1, 2 y 5 de la SEQ ID NO: 1 podrla ser cualquier aminoacido.The catalytic ability to degrade and / or hydrolyze organophosphorus compounds (organophosphatase activity) and / or carbamic esters of the sequence SEQ ID NO: 2, is given by the presence in said sequence SEQ ID NO: 2 of the amino acid acid glutamic (E) and the amino acid histidine (H), in positions 3 and 4, respectively. Therefore, the amino acids identified as Xaa at positions 1, 2 and 5 of SEQ ID NO: 1 could be any amino acid.
A efectos de la presente invencion el termino "actividad organofosfatasa" se define aqul como la actividad dirigida a catalizar la hidrolisis de los compuestos OPs. Los peptidos y/o enzimas que presentan dicha actividad, actuan sobre los compuestos OPs tales como malation, paration, clorpirifos, metamidofos, monocrotofos, tricloronato, acetafo, diaxinon, diazinon, paraoxin, entre otros, incluyendo esteres de acidos fosfonicos y fosflnicos y esteres de acidos carbamicos y esteres carboxllicos. En la Tabla 3 se muestra un listado de compuestos oganofosforados y carbamatos.For the purposes of the present invention the term "organophosphatase activity" is defined herein as the activity directed to catalyze the hydrolysis of OPs compounds. The peptides and / or enzymes that exhibit this activity, act on OPs compounds such as malation, paration, chlorpyrifos, methamidophos, monocrotophos, trichloronate, acetafo, diaxinon, diazinon, paraoxin, among others, including esters of phosphonic and phosphonic acids and esters of carbamic acids and carboxylic esters. A list of oganophosphorus compounds and carbamates is shown in Table 3.
Tabla 3. Listado de plaguicidas organofosforados y carbamatos.Table 3. List of organophosphorus pesticides and carbamates.
- ORGANOFOSFORADOS ORPHANOPHOSPHORATED
- CARBAMATOS CARBAMATES
- Metamidofos Methamidophos
- Metomilo Methoxy
- Acefato Acetate
- Carbarilo Carbaryl
- Diazinon Diazinon
- Pirimicarb Pirimicarb
- Clorpirifos Chlorpyrifos
- Carbofurano Carbofuran
- Fenamifos Fenamiphos
- Oxamilo Oxamilo
- Profenofos Profenofos
- Esfenvalerato Sphevalerate
- Metidation Metidation
- Carbarilo Carbaryl
- Dimetoato Dimethoate
- Fenpiroximato Phenypiroxate
- Etoprofos Etoprofos
- Metomilo Methoxy
- Azinfos metilo Methyl azinphs
- Fenoxicarb Phenoxycarb
- Paraoxon Paraoxon
- Fosmet Fosmet
- Malation Malation
- Caduzafos Caduzafos
- Crotoxifos Cryptoxyphos
- Dialifor Dialifor
- Fonofos Phonophos
- Fensulfotion Fensulfotion
- Isofenfos Isophenphs
- Tricloronato Trichloronate
Los compuestos organofosforados (OPs) son esteres organofosforados sinteticos y compuestos relacionados tales como fosforoamidatos. Tienen la formula general 5 (RR'X)P=O o (RR'X)P=S, donde R y R' son grupos de cadena corta. Para los insecticidas organofosforados la molecula X es un buen grupo saliente aromatico o alifatico, el cual es un requisito para la inhibicion irreversible de la acetilcolinesterasa. Los peptidos descritos en la presente invencion, donde se incluyen las albuminas de pollo y pavo que comprenden la SEQ ID NO: 2 de la invencion, hidrolizan los enlaces 10 fosfoester de los compuestos OPs. Estos OPs pueden ser OPs de tipo oxon y/o tion tales como el HDCP y el tricloronato, entre otros (ver Tabla 3). Ademas de los compuestos descritos en la Tabla 3, los peptidos descritos en la presente invencion son capaces de hidrolizar compuestos del tipo gases de guerra tales como sarin, ciclosarin, tabun, soman, VX).Organophosphorus compounds (OPs) are synthetic organophosphorus esters and related compounds such as phosphoramidates. They have the general formula 5 (RR'X) P = O or (RR'X) P = S, where R and R 'are short chain groups. For organophosphorus insecticides molecule X is a good aromatic or aliphatic leaving group, which is a requirement for irreversible inhibition of acetylcholinesterase. The peptides described in the present invention, which include chicken and turkey albumines comprising SEQ ID NO: 2 of the invention, hydrolyze the phosphoester bonds of the OPs compounds. These OPs can be oxon and / or tion type OPs such as HDCP and trichloronate, among others (see Table 3). In addition to the compounds described in Table 3, the peptides described in the present invention are capable of hydrolyzing war gas type compounds such as sarin, cyclosarin, tabun, soman, VX).
55
1010
15fifteen
20twenty
2525
3030
3535
A efectos de la presente invention, se utilizan indistintamente los terminos “peptido”, “polipeptido”, o “secuencia peptidica”, para referirnos al peptido o peptidos de la invencion. El termino "polipeptido aislado" o “peptido aislado” tal como se utiliza aqw, se refiere a un polipeptido que es al menos 20% puro, preferiblemente al menos 40% puro, mas preferiblemente al menos 60% puro, incluso mas preferiblemente al menos 80% puro, mas preferiblemente al menos 90% puro, e incluso mas preferiblemente al menos 95%, 96%, 97%, 98%, 99% puro, como se determina por cualquier tecnica conocida por el experto en la materia, tal como, SDS-PAGE. Por "polipeptido sustancialmente purificado" o “peptido sustancialmente puro”, entendemos un peptido que generalmente ha sido separado de los lipidos, acidos nucleicos, otros peptidos, y otras moleculas contaminantes con las cuales se asocia en su estado nativo. Preferiblemente, el peptido sustancialmente purificado es al menos 60% libre, mas preferiblemente al menos 75% libre, mas preferiblemente al menos 90%, mas preferiblemente al menos 95%, mas preferiblemente al menos 96% puro, mas preferiblemente al menos 97% puro, mas preferiblemente al menos 98% puro, incluso mas preferiblemente al menos 99%, mas preferiblemente al menos 99,5% puro, e incluso mas preferiblemente 100% puro, libre de otros componentes con los cuales se asocian naturalmente o de forma nativa. Los polipeptidos de la presente invencion estan preferiblemente en una forma sustancialmente pura. Esto se puede lograr, por ejemplo, mediante la preparation del polipeptido por medio de metodos recombinantes bien conocidos o por metodos clasicos de purification. En este documento, el termino "polipeptido sustancialmente puro" es sinonimo de los terminos "polipeptido aislado" y "polipeptido en forma aislada."For the purposes of the present invention, the terms "peptide", "polypeptide", or "peptide sequence" are used interchangeably to refer to the peptide or peptides of the invention. The term "isolated polypeptide" or "isolated peptide" as used herein, refers to a polypeptide that is at least 20% pure, preferably at least 40% pure, more preferably at least 60% pure, even more preferably at least 80% pure, more preferably at least 90% pure, and even more preferably at least 95%, 96%, 97%, 98%, 99% pure, as determined by any technique known to the person skilled in the art, such as , SDS-PAGE. By "substantially purified polypeptide" or "substantially pure peptide", we mean a peptide that has generally been separated from lipids, nucleic acids, other peptides, and other contaminating molecules with which it is associated in its native state. Preferably, the substantially purified peptide is at least 60% free, more preferably at least 75% free, more preferably at least 90%, more preferably at least 95%, more preferably at least 96% pure, more preferably at least 97% pure. , more preferably at least 98% pure, even more preferably at least 99%, more preferably at least 99.5% pure, and even more preferably 100% pure, free of other components with which they are naturally or natively associated. The polypeptides of the present invention are preferably in a substantially pure form. This can be achieved, for example, by the preparation of the polypeptide by means of well-known recombinant methods or by classical purification methods. In this document, the term "substantially pure polypeptide" is synonymous with the terms "isolated polypeptide" and "isolated polypeptide."
En la presente invencion el termino "homologia" se refiere al concepto de "homologia de secuencia", refiriendose al grado de similitud entre dos secuencias de aminoacidos o nucleotidos. En la presente invencion el termino "ortologo" se refiere a dos cadenas de aminoacidos o nucleotidos, procedentes de dos organismos distintos, que comparten un alto grado de homologia.In the present invention the term "homology" refers to the concept of "sequence homology", referring to the degree of similarity between two amino acid or nucleotide sequences. In the present invention the term "orthologue" refers to two chains of amino acids or nucleotides, from two different organisms, which share a high degree of homology.
El termino "identidad", tal y como se utiliza en esta description, hace referencia a la proportion de aminoacidos o nucleotidos identicos entre dos secuencias de aminoacidos o nucleotidos que se comparan. Preferiblemente, se entiende por “identidad” la relacion de residuos de acidos nucleicos o aminoacidos que son identicos entre dos secuencias de acidos nucleicos o de aminoacidos, con respecto a la longitud completa de la secuencia de referencia. El tanto por ciento de identidadThe term "identity", as used in this description, refers to the proportion of identical amino acids or nucleotides between two amino acid sequences or nucleotides that are compared. Preferably, "identity" means the ratio of nucleic acid or amino acid residues that are identical between two nucleic acid or amino acid sequences, with respect to the full length of the reference sequence. The percent identity
55
1010
15fifteen
20twenty
2525
3030
3535
existente entre dos secuencias de aminoacidos puede ser identificado facilmente por un experto en la materia, por ejemplo, con la ayuda de un programa informatico apropiado para comparar secuencias. A modo de ejemplo, se puede determinar el grado de identidad mediante el metodo de ClustalW, el metodo de Wilbur-Lipman, el programa GAG, que incluye GAP, BLAST o BLASTN, EMBOSS Needle y FASTA. Ademas, se puede utilizar el algoritmo de Smith Waterman con el fin de determinar el grado de identidad entre dos secuencias.existing between two amino acid sequences can be easily identified by one skilled in the art, for example, with the help of an appropriate computer program to compare sequences. As an example, the degree of identity can be determined by the ClustalW method, the Wilbur-Lipman method, the GAG program, which includes GAP, BLAST or BLASTN, EMBOSS Needle and FASTA. In addition, the Smith Waterman algorithm can be used to determine the degree of identity between two sequences.
Para la comparacion de secuencias, tlpicamente una de las secuencias actua como secuencia de referencia con la cual se comparan las secuencias “problema”. Cuando se usa un algoritmo de comparacion de secuencias para determinar su identidad, la secuencia de referencia y la/s secuencia/s problema se introducen en el programa, y se configuran los parametros del mismo. Se pueden usar los parametros del programa que aparecen por defecto o bien ser configurados. Preferiblemente dichos parametros seran los que aparecen por defecto. Asl, el algoritmo de comparacion de secuencias calcula el porcentaje de identidad entre la/s secuencia/s problema y la secuencia de referencia en base a los parametros del programa. Dos ejemplos de algoritmos que son utiles para determinar el porcentaje de identidad de secuencia son BLAST y BLAST 2.0, descritos en Altschul et al. (1997) Nucleic Acids Res 25(17):3389-3402 y Altschul et al. (1990) J. Mol Biol 215(3)-403-410, respectivamente. Preferiblemente, el grado de identidad al que se refiere la presente invencion se calcula mediante BLAST. El software para llevar a cabo el analisis BLAST se encuentra disponible publicamente en el National Center for Biotechnology Information (NCBI).For sequence comparison, typically one of the sequences acts as a reference sequence with which the "problem" sequences are compared. When a sequence comparison algorithm is used to determine its identity, the reference sequence and the problem sequence (s) are entered into the program, and the parameters thereof are configured. You can use the program parameters that appear by default or be configured. Preferably said parameters will be those that appear by default. Thus, the sequence comparison algorithm calculates the percentage of identity between the problem sequence (s) and the reference sequence based on the program parameters. Two examples of algorithms that are useful for determining percent sequence identity are BLAST and BLAST 2.0, described in Altschul et al. (1997) Nucleic Acids Res 25 (17): 3389-3402 and Altschul et al. (1990) J. Mol Biol 215 (3) -403-410, respectively. Preferably, the degree of identity referred to in the present invention is calculated by BLAST. The software to carry out the BLAST analysis is publicly available in the National Center for Biotechnology Information (NCBI).
En una realizacion particular, el polipeptido o secuencia peptldica de la invencion presenta una identidad de secuencia con la SEQ ID NO: 1 de al menos un 96%, mas preferentemente de al menos un 97%, mas preferentemente de al menos un 98%, mas preferentemente de al menos un 99% y mas preferentemente de al menos un 100%.In a particular embodiment, the polypeptide or peptide sequence of the invention has a sequence identity with SEQ ID NO: 1 of at least 96%, more preferably at least 97%, more preferably at least 98%, more preferably at least 99% and more preferably at least 100%.
En otra realizacion preferida, el polipeptido de la invencion comprende al menos una de las secuencias seleccionadas entre cualquiera de las siguientes: SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 14, SEQ ID NO: 15 y/o cualquiera de sus combinaciones. En otra realizacion mas preferida, el polipeptido de la invencion consiste al menos una secuencia seleccionada de entre cualquiera de las siguientes:In another preferred embodiment, the polypeptide of the invention comprises at least one of the sequences selected from any of the following: SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 14, SEQ ID NO: 15 and / or any of its combinations. In another more preferred embodiment, the polypeptide of the invention consists of at least one sequence selected from any of the following:
55
1010
15fifteen
20twenty
2525
3030
3535
SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 14, SEQ ID NO: 15 y/o cualquiera de sus combinaciones.SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 14, SEQ ID NO: 15 and / or any combination thereof.
Tal y como se demuestra en los ejemplos incluidos en el presente documento, las albuminas de aves, especlficamente las albuminas de pollo (SEQ ID NO: 3) y pavo (SEQ ID NO: 4), que comprende en su region N-terminal la SEQ ID NO: 2, actuan como biocatalizadores para la degradation de compuestos organofosforados, esteres carbamicos y/o esteres carboxllicos, siempre en presencia de al menos un cation metalico.As demonstrated in the examples included herein, the bird albumines, specifically the chicken albumins (SEQ ID NO: 3) and turkey (SEQ ID NO: 4), which comprises in their N-terminal region the SEQ ID NO: 2, act as biocatalysts for the degradation of organophosphorus compounds, carbamic esters and / or carboxylic esters, always in the presence of at least one metal cation.
En otra realization preferida, el polipeptido de la invention se caracteriza por que se encuentra unido covalentemente a al menos un cofactor, siendo dicho cofactor preferentemente un cation metalico con carga 2+.In another preferred embodiment, the polypeptide of the invention is characterized in that it is covalently linked to at least one cofactor, said cofactor being preferably a metal cation with 2+ charge.
A efectos de la presente invencion, el termino “cofactor” se refiere a cualquier componente qulmico, no proteico, termoestable y de bajo peso molecular, necesario para la action de una protelna o enzima, ya sean iones metalicos, moleculas organicas o coenzimas. Ejemplos de cofactores son, pero sin limitarnos, cationes divalentes, preferentemente Zn2+, Fe2+, Cu2+, K+, Mn2+ o Mg2+, as! como otros cofactores organicos como vitaminas, NAD(P)+, NAD(P)H, ATP, ADP o FAD.For the purposes of the present invention, the term "cofactor" refers to any chemical, non-protein, thermostable and low molecular weight component necessary for the action of a protein or enzyme, whether metal ions, organic molecules or coenzymes. Examples of cofactors are, but not limited to, divalent cations, preferably Zn2 +, Fe2 +, Cu2 +, K +, Mn2 + or Mg2 +, as! like other organic cofactors like vitamins, NAD (P) +, NAD (P) H, ATP, ADP or FAD.
En una realizacion mas preferida de la presente invencion, los cofactores son preferentemente cationes divalentes y mas preferentemente cationes tales como zinc (Zn2+) o cobre (Cu2+), siendo preferido el cobre, Cu2+.In a more preferred embodiment of the present invention, the cofactors are preferably divalent cations and more preferably cations such as zinc (Zn2 +) or copper (Cu2 +), with copper, Cu2 + being preferred.
En otra realizacion preferida, el polipeptido de la invencion se caracteriza por que la SEQ ID NO: 1, y mas especlficamente, la SEQ ID NO: 2, son las secuencias amino terminal de la albumina de aves.In another preferred embodiment, the polypeptide of the invention is characterized in that SEQ ID NO: 1, and more specifically, SEQ ID NO: 2, are the amino terminal sequences of bird albumin.
En otra realizacion mas preferida, el polipeptido de la invencion se caracteriza por que la albumina de aves es una albumina serica. En otra realizacion preferida, la albumina de aves se selecciona preferentemente de entre albumina de pollo (SEQ ID NO: 3) o de pavo (SEQ ID NO: 4).In another more preferred embodiment, the polypeptide of the invention is characterized in that the bird albumin is a serine albumin. In another preferred embodiment, the bird albumin is preferably selected from chicken albumin (SEQ ID NO: 3) or turkey (SEQ ID NO: 4).
A efectos de la presente invencion, la "albumina" se refiere de forma general a albumina de tipo nativo o recombinante de cualquier especie. Estudios bioqulmicosFor the purposes of the present invention, "albumin" generally refers to native or recombinant albumin of any species. Biochemical studies
55
1010
15fifteen
20twenty
2525
3030
3535
han revelado que las albuminas de origen animal presentan una homologla estructural del 60%. Mas preferiblemente, la albumina es de aves, mamlferos y/o reptiles. Mas preferiblemente, la albumina es de origen aviar. Aun mas preferiblemente, la albumina utilizada es albumina serica aviar nativa o recombinante, preferentemente, albumina de pollo o de pavo.have revealed that albumins of animal origin have a structural homologla of 60%. More preferably, albumin is from birds, mammals and / or reptiles. More preferably, the albumine is of avian origin. Even more preferably, the albumine used is native or recombinant avian serine albumine, preferably chicken or turkey albumine.
En otro aspecto, la presente invention se refiere a variantes artificiales o mutantes del peptido de la invencion, que comprenden una sustitucion conservadora, deletion, y/o insertion de uno o mas aminoacidos de la SEQ ID NO: 1 o SEQ ID NO: 2. Estas variantes se refieren a variaciones limitadas en la secuencia aminoacldica, que permiten el mantenimiento de la funcionalidad del peptido. Preferiblemente, cambios de aminoacidos son de una naturaleza menor, es decir sustituciones conservadoras de aminoacidos o inserciones que no afectan significativamente al plegamiento y/o actividad de la protelna. Ejemplos de sustituciones conservadoras estan dentro del grupo de aminoacidos basicos (arginina, lisina e histidina), aminoacidos acidos (acido glutamico y acido aspartico), aminoacidos polares (glutamina y asparagina), aminoacidos hidrofobicos (leucina, isoleucina y valina), aminoacidos aromaticos (fenilalanina, triptofano y tirosina), y aminoacidos pequenos (glicina, alanina, serina, treonina y metionina).In another aspect, the present invention relates to artificial or mutant variants of the peptide of the invention, which comprise a conservative substitution, deletion, and / or insertion of one or more amino acids of SEQ ID NO: 1 or SEQ ID NO: 2 These variants refer to limited variations in the amino acid sequence, which allow the maintenance of the functionality of the peptide. Preferably, amino acid changes are of a minor nature, that is conservative amino acid substitutions or insertions that do not significantly affect the folding and / or activity of the protein. Examples of conservative substitutions are within the group of basic amino acids (arginine, lysine and histidine), acidic amino acids (glutamic acid and aspartic acid), polar amino acids (glutamine and asparagine), hydrophobic amino acids (leucine, isoleucine and valine), aromatic amino acids ( phenylalanine, tryptophan and tyrosine), and small amino acids (glycine, alanine, serine, threonine and methionine).
Las variaciones pueden ser variaciones generadas artificialmente como, por ejemplo, mediante mutagenesis o slntesis directa. Estas variaciones no provocan modificaciones esenciales en las caracterlsticas o propiedades esenciales del peptido. Por ello, dentro del alcance de la presente invencion tambien se incluyen los peptidos o polipeptidos cuya secuencia de aminoacidos sea identica u homologa a las secuencias descritas en la presente invencion. Ademas, de los 20 aminoacidos estandar, aminoacidos no estandar (tales como A-hidroxiprolina, 6 - [lambda] lisina /- metilo, acido 2-aminoisobutlrico, isovalina, y alfa-metil serina) pueden ser sustituidos para los residuos de aminoacidos de un polipeptido de tipo salvaje. Un numero limitado de aminoacidos no conservadores, aminoacidos que no son codificados por el codigo genetico, y aminoacidos no naturales puede ser sustituido por residuos de aminoacidos. Adicionalmente, si se desea, los aminoacidos no naturales o analogos de aminoacidos qulmicos se pueden introducir como una sustitucion o adicion en el peptido de la presente invencion. Tales aminoacidos incluyen, pero no se limitan a, los D-isomeros de los aminoacidos comunes, acido 2,4-diaminobutlrico, acido a-amino isobutlrico, acido 4-aminobutlrico, acido 2-aminobutlrico, acido 6-amino hexanoico,Variations can be artificially generated variations, such as by mutagenesis or direct synthesis. These variations do not cause essential modifications in the characteristics or essential properties of the peptide. Therefore, peptides or polypeptides whose amino acid sequence is identical or homologous to the sequences described in the present invention are also included within the scope of the present invention. In addition, of the 20 standard amino acids, non-standard amino acids (such as A-hydroxyproline, 6 - [lambda] lysine / -methyl, 2-aminoisobutyric acid, isovaline, and alpha-methyl serine) can be substituted for amino acid residues of a wild type polypeptide. A limited number of non-conservative amino acids, amino acids that are not encoded by the genetic code, and unnatural amino acids can be substituted by amino acid residues. Additionally, if desired, unnatural amino acids or analogs of chemical amino acids can be introduced as a substitution or addition into the peptide of the present invention. Such amino acids include, but are not limited to, the D-isomers of the common amino acids, 2,4-diaminobutyric acid, a-amino isobutyl acid, 4-aminobutyl acid, 2-aminobutyl acid, 6-amino hexanoic acid,
55
1010
15fifteen
20twenty
2525
3030
3535
acido 2-amino isobutirico, acido 3-amino propionico, ornitina, norleucina, norvalina, hidroxiprolina, sarcosina, citrulina, homocitrulina, acido cisteico, tbutilglicina, t- butilalanina, fenilglicina, ciclohexilalanina, p-alanina, fluoro-aminoacidos, aminoacidos de diseno tales como p-metil aminoacidos, Ca-metil aminoacidos, Na-metil aminoacidos, y analogos de aminoacidos en general.2-amino isobutyric acid, 3-amino propionic acid, ornithine, norleucine, norvaline, hydroxyproline, sarcosine, citrulline, homocitrulline, cysteic acid, t-butylglycine, t-butylalanine, phenylglycine, cyclohexylalanine, p-alanine, amino fluoroamino acid such as p-methyl amino acids, Ca-methyl amino acids, Na-methyl amino acids, and amino acid analogs in general.
Tambien se incluyen dentro del alcance de la invention los peptidos de la presente invention que se modifican diferencialmente durante o despues de la slntesis, por ejemplo, por biotinilacion, bencilacion, glicosilacion, acetilacion, fosforilacion, amidacion, union de llpidos (por ejemplo acidos grasos), derivatizacion por conocidos grupos protectores/bloqueo, division proteolltica, enlace con una molecula de anticuerpo u otro ligando celular, etc. Estas modificaciones pueden servir para aumentar la estabilidad y/o bioactividad del peptido de la invencion.Also included within the scope of the invention are the peptides of the present invention that are differentially modified during or after the synthesis, for example, by biotinylation, benzylation, glycosylation, acetylation, phosphorylation, amidation, lipid binding (for example fatty acids ), derivatization by known protective / blocking groups, proteolytic division, binding with an antibody molecule or other cellular ligand, etc. These modifications may serve to increase the stability and / or bioactivity of the peptide of the invention.
Los peptidos de la presente invencion se pueden producir en una variedad de formas, incluyendo la production y recuperation de protelnas naturales, production y recuperation de protelnas recombinantes, y slntesis qulmicas de las protelnas. En una modalidad, un peptido aislado de la presente invencion se produce por el cultivo de una celula capaz de expresar el peptido bajo condiciones efectivas para producir el peptido, y la recuperacion del peptido. Las condiciones de cultivo efectivas incluyen, pero no se limitan a, medios efectivos, bioreactor, condiciones de temperatura, pH y oxlgeno que permiten la produccion de protelnas. Un medio efectivo se refiere a cualquier medio en el cual una celula se cultiva para producir un peptido de la presente invencion. Tal medio, por lo general, comprende un medio acuoso que tiene fuentes de nitrogeno, fosfato y carbono asimilable, y sales, minerales, metales apropiados y otros nutrientes, tales como vitaminas. Las celulas de la presente invencion se pueden cultivar en bioreactores de fermentation convencionales, matraces oscilantes, tubos de prueba, placas de microtitulacion, y cajas de petri. El cultivo se puede llevar a cabo a una temperatura, pH y contenido de oxlgeno apropiados para una celula recombinante. Tales condiciones de cultivo estan dentro de la habilidad de un experto en el oficio.The peptides of the present invention can be produced in a variety of ways, including the production and recovery of natural proteins, production and recovery of recombinant proteins, and chemical synthesis of the proteins. In one embodiment, an isolated peptide of the present invention is produced by the cultivation of a cell capable of expressing the peptide under conditions effective to produce the peptide, and the recovery of the peptide. Effective culture conditions include, but are not limited to, effective media, bioreactor, temperature, pH and oxygen conditions that allow the production of proteins. An effective medium refers to any medium in which a cell is cultured to produce a peptide of the present invention. Such a medium generally comprises an aqueous medium having sources of nitrogen, phosphate and assimilable carbon, and salts, minerals, appropriate metals and other nutrients, such as vitamins. The cells of the present invention can be grown in conventional fermentation bioreactors, oscillating flasks, test tubes, microtiter plates, and petri dishes. The culture can be carried out at a temperature, pH and oxygen content appropriate for a recombinant cell. Such cultivation conditions are within the skill of an expert in the trade.
Debido a la degeneration del codigo genetico, en el cual diversos tripletes de nucleotidos dan lugar a un mismo aminoacido, existen diversas secuencias de nucleotidos que dan lugar a una misma secuencia aminoacldica. Por ello, otro aspecto de la invencion se refiere a un polinucleotido aislado o nucleotido aislado, de ahora enDue to the degeneracy of the genetic code, in which several nucleotide triplets give rise to the same amino acid, there are several nucleotide sequences that give rise to the same amino acid sequence. Therefore, another aspect of the invention relates to an isolated polynucleotide or isolated nucleotide, now in
55
1010
15fifteen
20twenty
2525
3030
3535
adelante “polinucleotido de la invention”, que codifica al menos un polipeptido de la invention.hereinafter "polynucleotide of the invention", which encodes at least one polypeptide of the invention.
Los terminos “secuencia nucleotidica”, “secuencia de nucleotidos”, “acido nucleico”, “oligonucleotido” y “polinucleotido” se usan aqu de manera intercambiable y se refieren a una forma polimerica de nucleotidos de cualquier longitud que pueden estar o no, quimica o bioquimicamente modificados. Se refieren, por tanto, a cualquier polirribonucleotido o polidesoxirribonucleotido, tanto de cadena sencilla como de doble hebra. El polinucleotido de la invencion puede ser, por tanto, ADN, ARN, o derivados tanto de ADN como de ARN, incluyendo ADNc. El polinucleotido de la invencion puede obtenerse de manera artificial mediante metodos de donation y selection convencionales, o mediante secuenciacion. El polinucleotido, adicionalmente a la secuencia codificante, puede llevar otros elementos, como por ejemplo aunque sin limitarse, intrones, secuencias no codificantes en los extremos 5’ o 3’, sitios de union a ribosomas, o secuencias estabilizadoras. Estos polinucleotidos adicionalmente pueden incluir secuencias codificantes para aminoacidos adicionales que puedan ser utiles, por ejemplo, aunque sin limitarse, para aumentar la estabilidad del peptido generado a partir de el o permitir una mejor purification del mismo.The terms "nucleotide sequence", "nucleotide sequence", "nucleic acid", "oligonucleotide" and "polynucleotide" are used interchangeably herein and refer to a polymeric form of nucleotides of any length that may or may not be chemical or biochemically modified. They refer, therefore, to any polyiribonucleotide or polydeoxyribonucleotide, both single-stranded and double-stranded. The polynucleotide of the invention can therefore be DNA, RNA, or derivatives of both DNA and RNA, including cDNA. The polynucleotide of the invention can be obtained artificially by conventional donation and selection methods, or by sequencing. The polynucleotide, in addition to the coding sequence, can carry other elements, such as, but not limited to, introns, non-coding sequences at the 5 'or 3' ends, ribosome binding sites, or stabilizing sequences. These polynucleotides can additionally include coding sequences for additional amino acids that may be useful, for example, but not limited, to increase the stability of the peptide generated from it or allow a better purification thereof.
El termino "polinucleotido aislado" o “nucleotido aislado” tal como se utiliza aqui, se refiere a un polinucleotido que es al menos 20% puro, preferiblemente al menos 40% puro, mas preferiblemente al menos 60% puro, incluso mas preferiblemente al menos 80% puro, mas preferiblemente al menos 90% puro, e incluso mas preferiblemente al menos 95% puro, como se determina por cualquier tecnica conocida por el experto en la materia, tal como, SDS-PAGE. El termino "polinucleotido sustancialmente puro" como se usa aqu se refiere a una preparation de polinucleotido libre de otros nucleotidos extranos o indeseados y en una forma adecuada para uso dentro de sistemas de production de protemas creadas geneticamente. Esto se puede lograr, por ejemplo, mediante la preparacion del polinucleotido por medio de metodos recombinantes bien conocidos o por metodos clasicos de purificacion. En este documento, el termino "polinucleotido sustancialmente puro" es sinonimo de los terminos " polinucleotido aislado" y "polinucleotido en forma aislada". Los polinucleotidos de la presente invencion estan preferiblemente en una forma sustancialmente pura.The term "isolated polynucleotide" or "isolated nucleotide" as used herein refers to a polynucleotide that is at least 20% pure, preferably at least 40% pure, more preferably at least 60% pure, even more preferably at least 80% pure, more preferably at least 90% pure, and even more preferably at least 95% pure, as determined by any technique known to the person skilled in the art, such as, SDS-PAGE. The term "substantially pure polynucleotide" as used herein refers to a polynucleotide preparation free of other foreign or unwanted nucleotides and in a form suitable for use within genetically created protein production systems. This can be achieved, for example, by preparing the polynucleotide by means of well-known recombinant methods or by classical purification methods. In this document, the term "substantially pure polynucleotide" is synonymous with the terms "isolated polynucleotide" and "isolated polynucleotide." The polynucleotides of the present invention are preferably in a substantially pure form.
55
1010
15fifteen
20twenty
2525
3030
3535
Las secuencias de acido nucleico que codifican los polipeptidos de la invention pueden, por ejemplo, disenarse en base a las secuencias de aminoacidos proporcionadas en la presente invencion. Por lo tanto, otro objeto descrito en la presente invencion se refiere a una secuencia nucleotldica aislada que codifica para el polipeptido de la invencion. En una realization mas preferida el polinucleotido de la invencion comprende al menos una de las secuencias seleccionadas de entre cualquiera de las siguientes: SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23 y/o cualquier combination de las mismas. En otra realizacion mas preferida, el polipeptido de la invencion consiste en al menos una de las secuencias seleccionadas de entre cualquiera de las siguientes: SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23 y/o cualquier combinacion de las mismas.Nucleic acid sequences encoding the polypeptides of the invention can, for example, be designed based on the amino acid sequences provided in the present invention. Therefore, another object described in the present invention relates to an isolated nucleotide sequence encoding the polypeptide of the invention. In a more preferred embodiment the polynucleotide of the invention comprises at least one of the sequences selected from any of the following: SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23 and / or any combination thereof. In another more preferred embodiment, the polypeptide of the invention consists of at least one of the sequences selected from any of the following: SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23 and / or any combination thereof.
Otro aspecto de la presente invencion se refiere a un polinucleotido aislado que comprende una secuencia nucleotldica complementaria al polinucleotido de la invencion.Another aspect of the present invention relates to an isolated polynucleotide comprising a nucleotide sequence complementary to the polynucleotide of the invention.
El polinucleotido de la invencion puede introducirse en una construction genica, por ejemplo, en un vector de donation o vector de expresion, para permitir su replication o su expresion. Preferiblemente, dicho vector es un vector apropiado para la expresion y purification del polipeptido de la invencion. Por todo ello, otro aspecto de la invencion se refiere a una construccion genica que comprende al menos uno de los polinucleotidos de la invencion, de ahora en adelante "construccion genica de la invencion”, unido operativamente a una o mas secuencias de control que dirigen la produccion del polipeptido en un huesped.The polynucleotide of the invention can be introduced into a genetic construct, for example, into a donation vector or expression vector, to allow its replication or expression. Preferably, said vector is an appropriate vector for the expression and purification of the polypeptide of the invention. Therefore, another aspect of the invention relates to a genetic construct comprising at least one of the polynucleotides of the invention, hereafter referred to as the "genetic construct of the invention", operatively linked to one or more control sequences that direct Polypeptide production in a host.
El termino "construccion genica" tal como se utiliza aqul se refiere a una molecula de acido nucleico, tanto monocatenaria como bicatenaria, que se alsla de un gen de origen natural o que es modificada para contener segmentos de acidos nucleicos de una manera que lo contrario no existirlan en la naturaleza. El termino "construccion genica” o "construccion genica” es sinonimo del termino "casete de expresion" cuando el constructo de acidos nucleicos contiene las secuencias de control requeridas para la expresion de una secuencia codificante de la presente invencion. Por tanto, la construccion genetica de la invencion puede comprender ademas una o mas secuencias control o reguladoras de la expresion genica, tales como secuencias promotoras, secuencias llder, secuencias terminadoras de la transcription, secuencias de poliadenilacion, secuencias senal, etc. Un polinucleotido aislado que codifica unThe term "genetic construction" as used herein refers to a nucleic acid molecule, both single-stranded and double-stranded, that is isolated from a gene of natural origin or that is modified to contain nucleic acid segments in a manner that would otherwise They will not exist in nature. The term "genetic construction" or "genetic construction" is synonymous with the term "expression cassette" when the nucleic acid construct contains the control sequences required for the expression of a coding sequence of the present invention. Therefore, the genetic construction of the invention may further comprise one or more control or regulatory sequences of the gene expression, such as promoter sequences, llder sequences, transcription terminator sequences, polyadenylation sequences, signal sequences, etc. An isolated polynucleotide encoding a
55
1010
15fifteen
20twenty
2525
3030
3535
polipeptido de la presente invention puede ser manipulado en una variedad de maneras para proporcionar la expresion del polipeptido. La manipulation de la secuencia del polinucleotido antes de su insertion en un vector puede ser deseable o necesaria dependiendo del vector de expresion. Las tecnicas para modificar secuencias de polinucleotidos utilizando metodos de ADN recombinantes son bien conocidos en la tecnica. La secuencia de control puede ser una secuencia promotora apropiada, una secuencia de nucleotidos que es reconocida por una celula huesped para la expresion de un polinucleotido que codifica un polipeptido de la presente invencion.The polypeptide of the present invention can be manipulated in a variety of ways to provide expression of the polypeptide. Manipulation of the polynucleotide sequence before insertion into a vector may be desirable or necessary depending on the expression vector. Techniques for modifying polynucleotide sequences using recombinant DNA methods are well known in the art. The control sequence may be an appropriate promoter sequence, a nucleotide sequence that is recognized by a host cell for the expression of a polynucleotide encoding a polypeptide of the present invention.
El termino "secuencias de control" tal y como se define aqul incluye todos los componentes que son necesarios o ventajosos para la expresion de un polinucleotido que codifica un polipeptido de la presente invencion. Cada secuencia de control puede ser nativa o extranjera a la secuencia de nucleotidos que codifica el polipeptido. Tales secuencias de control incluyen, pero no se limitan a, un llder, secuencia de poliadenilacion, secuencia de propeptido, promotor, secuencia de peptido senal, y terminador de la transcription. Como mlnimo, las secuencias de control incluyen un promotor, y senales de parada de la traduction y la transcripcion. Las secuencias de control pueden ser provistas de enlaces con el fin de introducir sitios de restriction especlficos que faciliten la ligadura de las secuencias de control con la region de codification de la secuencia de nucleotidos que codifica un polipeptido. Secuencias de control apropiadas para la expresion de un polinucleotido en celulas eucariotas son conocidas en el estado de la tecnica. Como se usa aqul, el termino “promotor” hace referencia a una secuencia nucleotldica, generalmente “aguas arriba” o “upstream” del punto de inicio de la transcripcion, que es capaz de iniciar la transcripcion en una celula. Este termino incluye, por ejemplo, pero sin limitarse, promotores constitutivos, promotores especlficos de tipo celular y promotores inducibles o reprimibles. En general, las secuencias de control dependen del origen de la celula hospedadora.The term "control sequences" as defined herein includes all components that are necessary or advantageous for the expression of a polynucleotide encoding a polypeptide of the present invention. Each control sequence can be native or foreign to the nucleotide sequence encoding the polypeptide. Such control sequences include, but are not limited to, a llder, polyadenylation sequence, propeptide sequence, promoter, signal peptide sequence, and transcription terminator. At a minimum, the control sequences include a promoter, and stop signals for translation and transcription. Control sequences may be provided with links in order to introduce specific restriction sites that facilitate the binding of control sequences with the coding region of the nucleotide sequence encoding a polypeptide. Appropriate control sequences for the expression of a polynucleotide in eukaryotic cells are known in the state of the art. As used herein, the term "promoter" refers to a nucleotide sequence, generally "upstream" or "upstream" of the transcription start point, which is capable of initiating transcription in a cell. This term includes, for example, but not limited to, constitutive promoters, cell-type specific promoters and inducible or repressible promoters. In general, control sequences depend on the origin of the host cell.
El termino "unido operativamente" denota aqul una configuration en la que se coloca una secuencia de control en una posicion apropiada con relacion a la secuencia de codificacion de la secuencia de polinucleotidos de tal manera que la secuencia de control dirige la expresion de la secuencia codificante de un polipeptido.The term "operably linked" denotes a configuration in which a control sequence is placed in an appropriate position in relation to the coding sequence of the polynucleotide sequence such that the control sequence directs the expression of the coding sequence of a polypeptide.
Cuando se usa aqul el termino "secuencia de codificacion" o “secuencia codificante” significa una secuencia de nucleotidos, que especlfica y directamente da lugar a unaWhen used here the term "coding sequence" or "coding sequence" means a nucleotide sequence, which specifically and directly results in a
55
1010
15fifteen
20twenty
2525
3030
3535
secuencia especlfica de aminoacidos de su producto proteico. Los llmites de la secuencia codificante se determinan generalmente por un marco de lectura abierto, que normalmente empieza con el codon de iniciacion ATG o codones de iniciacion alternativos tales como GTG y TTG. La secuencia de codificacion puede ser una secuencia de nucleotidos de ADN, ADNc, o recombinante.specific amino acid sequence of its protein product. The limits of the coding sequence are generally determined by an open reading frame, which normally begins with the ATG initiation codon or alternative initiation codons such as GTG and TTG. The coding sequence can be a nucleotide sequence of DNA, cDNA, or recombinant.
El termino "expresion" incluye cualquier paso implicado en la production del polipeptido incluyendo, pero no limitado a, transcription, modification postranscripcional, traduction, modificacion postraduccional, y secretion.The term "expression" includes any step involved in the production of the polypeptide including, but not limited to, transcription, post-transcriptional modification, translation, post-translational modification, and secretion.
Otro objeto descrito en la presente invention se refiere a un “peptido de fusion” o “polipeptido de fusion” que comprende al menos el polipeptido de la presente invencion.Another object described in the present invention relates to a "fusion peptide" or "fusion polypeptide" comprising at least the polypeptide of the present invention.
En una realization preferida, el peptido de fusion segun la presente invencion se refiere a cualquier peptido nativo o recombinante, al que se le une covalentemente el peptido de la invencion y que es capaz de mantener la actividad organofosfatasa, tal y como se describe en el presente documento.In a preferred embodiment, the fusion peptide according to the present invention refers to any native or recombinant peptide, to which the peptide of the invention is covalently bound and which is capable of maintaining organophosphatase activity, as described in the present document
En una realizacion preferida, la construction genica de la invencion es un vector de expresion. Un “vector de expresion” es una molecula de ADN lineal o circular que comprende al menos un polinucleotido de la invencion, y que se une de manera operativa a nucleotidos adicionales que se proporcionan para su expresion. Dicho vector que comprende el polinucleotido de la invencion, se puede introducir en una celula hospedadora de tal manera que el vector se mantiene como un integrante cromosomico o como un vector extracromosomico autoreplicante.In a preferred embodiment, the genetic construction of the invention is an expression vector. An "expression vector" is a linear or circular DNA molecule that comprises at least one polynucleotide of the invention, and which is operably linked to additional nucleotides that are provided for expression. Said vector comprising the polynucleotide of the invention can be introduced into a host cell such that the vector is maintained as a chromosomal integrant or as a self-replicating extrachromosomal vector.
A efectos de la presente invencion, el termino “vector” o “vector de expresion”, se refiere a un vector recombinante, que incluye al menos una molecula aislada de acido nucleico de la presente invencion que codifica para el polipeptido de la presente invencion, insertada en cualquier vector, y que esta unida operativamente a los nucleotidos adicionales que propician su expresion y que es capaz de entregar la molecula de acido nucleico en una celula huesped. Dicho vector puede contener secuencias heterologas del acido nucleico, es decir secuencias del acido nucleico que no se encuentran naturalmente adyacentes a las moleculas del acido nucleico de la presente invencion y que preferiblemente se derivan de una especie diferente de laFor the purposes of the present invention, the term "vector" or "expression vector" refers to a recombinant vector, which includes at least one isolated nucleic acid molecule of the present invention encoding the polypeptide of the present invention, inserted into any vector, and that is operatively linked to the additional nucleotides that propitiate its expression and that is capable of delivering the nucleic acid molecule into a host cell. Said vector may contain heterologous nucleic acid sequences, that is nucleic acid sequences that are not naturally adjacent to the nucleic acid molecules of the present invention and that are preferably derived from a different species from the
55
1010
15fifteen
20twenty
2525
3030
3535
especie de la cual, la(s) molecula(s) del acido nucleico se derivan. Al crear el vector de expresion, la secuencia codificante se localiza en el vector de tal manera que esta se une operativamente a las secuencias control adecuadas para su expresion. Por tanto, los vectores de expresion a los que se hace referencia en la presente invention comprenden el polinucleotido de la invencion, un promotor, y senales de termination de la transcription y la traduction. Los diversos acidos nucleicos y las secuencias control descritas aqul pueden unirse entre si para producir un vector de expresion recombinante que puede incluir uno o mas sitios de restriction convenientes para permitir la insertion o la sustitucion del polipeptido de la invencion en dichos sitios.species from which, the nucleic acid molecule (s) are derived. When creating the expression vector, the coding sequence is located in the vector such that it is operably linked to the control sequences suitable for its expression. Thus, the expression vectors referred to in the present invention comprise the polynucleotide of the invention, a promoter, and termination signals of transcription and translation. The various nucleic acids and control sequences described herein can be linked together to produce a recombinant expression vector that may include one or more convenient restriction sites to allow insertion or replacement of the polypeptide of the invention at said sites.
El vector de expresion al que se refiere la invencion puede ser cualquier vector, ARN o ADN, ya sea procariota o eucariota, y por lo general es un virus o un plasmido. Preferiblemente, el vector de expresion tambien es capaz de replicar dentro de la celula huesped. Los vectores de expresion de la presente invencion incluyen cualquiera de los vectores que puede funcionar (i.e., expresion directa del gen) en las celulas recombinantes de la presente invencion, incluyendo en las celulas bacterianas, fungicas, de endoparasitos, artropodos, otras celulas animales, y vegetales. La election del vector dependera normalmente de la compatibilidad del vector con la celula hospedadora en la que se va a introducir el mismo. El vector de expresion puede ser un plasmido, un cosmido, un fago, un virus, un cromosoma artificial de bacteria (BAC), un cromosoma artificial de levadura (YAC), o similares. Los vectores pueden ser plasmidos lineales o circulares cerrados. El vector puede ser un vector replicante de forma autonoma, es decir, un vector que existe como una entidad extracromosomica, cuya replication es independiente de la replication cromosomica, por ejemplo, un plasmido, un elemento extracromosomico, un minicromosoma, o un cromosoma artificial. El vector puede contener cualquier medio para asegurar la autorreplicacion. De forma alternativa, el vector puede ser uno que, cuando se introduce en la celula hospedadora, se integra en el genoma y se replica junto con el(los) cromosoma(s) en el(los) que se ha integrado. Ademas, se puede usar un unico vector o plasmido o dos o mas vectores o plasmidos que contienen conjuntamente el ADN total que se va a introducir en el genoma de la celula hospedadora, o un transposon. Los vectores de expresion preferidos de la presente invencion pueden dirigir la expresion del gen en celulas bacterianas, de levaduras, vegetales y de mamlfero.The expression vector to which the invention relates can be any vector, RNA or DNA, either prokaryotic or eukaryotic, and is usually a virus or a plasmid. Preferably, the expression vector is also able to replicate within the host cell. Expression vectors of the present invention include any of the vectors that can function (ie, direct gene expression) in the recombinant cells of the present invention, including in bacterial, fungal, endoparasite, arthropod, other animal cells, and vegetables The choice of the vector will normally depend on the compatibility of the vector with the host cell in which it is to be introduced. The expression vector may be a plasmid, a cosmid, a phage, a virus, an artificial bacterial chromosome (BAC), an artificial yeast chromosome (YAC), or the like. Vectors can be closed linear or circular plasmids. The vector may be an autonomously replicating vector, that is, a vector that exists as an extrachromosomal entity, whose replication is independent of chromosomal replication, for example, a plasmid, an extrachromosomal element, a minichromosome, or an artificial chromosome. The vector may contain any means to ensure self-replication. Alternatively, the vector may be one that, when introduced into the host cell, is integrated into the genome and replicated together with the chromosome (s) in which it has been integrated. In addition, a single vector or plasmid or two or more vectors or plasmids that together contain the total DNA to be introduced into the genome of the host cell, or a transposon can be used. Preferred expression vectors of the present invention can direct gene expression in bacterial, yeast, plant and mammalian cells.
55
1010
15fifteen
20twenty
2525
3030
3535
Los vectores de la presente invention contienen preferiblemente uno o mas marcadores seleccionables que permiten una selection facil de celulas transformadas, transfectadas, transducidas, o similares. Un marcador seleccionable es un gen cuyo producto proporciona resistencia biocida o vlrica, resistencia a metales pesados, prototrofla a auxotrofos, y similares.The vectors of the present invention preferably contain one or more selectable markers that allow easy selection of transformed, transfected, transduced cells, or the like. A selectable marker is a gene whose product provides biocidal or viral resistance, heavy metal resistance, prototroph to auxotrophs, and the like.
Se puede insertar mas de una copia del polinucleotido de la presente invencion en la celula hospedadora para aumentar la production del/los producto/s genico/s. Se puede obtener un aumento en el numero de copias del polinucleotido integrando al menos una copia adicional de la secuencia en el genoma de la celula hospedadora o incluyendo con el polinucleotido un gen marcador seleccionable amplificable, donde las celulas que contienen las copias amplificadas del gen marcador seleccionable, y por tanto, copias adicionales del polinucleotido, se pueden seleccionar cultivando las celulas en presencia del agente de seleccion adecuado.More than one copy of the polynucleotide of the present invention can be inserted into the host cell to increase the production of the genetic product (s). An increase in the number of copies of the polynucleotide can be obtained by integrating at least one additional copy of the sequence into the genome of the host cell or including with the polynucleotide an amplifiable selectable marker gene, where the cells containing the amplified copies of the marker gene selectable, and therefore, additional copies of the polynucleotide, can be selected by culturing the cells in the presence of the appropriate selection agent.
La construction genica de la invencion, como se ha mencionado anteriormente, se puede introducir en una celula hospedadora competente para llevar a cabo la expresion del polipeptido de la invencion. Por ello, otro aspecto de la invencion se refiere a una "celula” o "celula hospedadora” que comprende el polipeptido, la secuencia polinucleotldica o la construccion genica de la invencion, "celula hospedadora de la invencion” o "celula de la invencion”.The genetic construction of the invention, as mentioned above, can be introduced into a competent host cell to carry out the expression of the polypeptide of the invention. Therefore, another aspect of the invention relates to a "cell" or "host cell" comprising the polypeptide, the polynucleotide sequence or the genetic construct of the invention, "host cell of the invention" or "cell of the invention" .
El termino "celula huesped" o "celula huesped recombinante”, como se usa aqul, incluye cualquier tipo de celula que es susceptible de transformation, transfection, transduction, y similares con la construccion genica de la invencion.The term "host cell" or "recombinant host cell", as used herein, includes any type of cell that is susceptible to transformation, transfection, transduction, and the like with the genetic construction of the invention.
Mas de una copia de un polinucleotido de la presente invencion se puede insertar en la celula huesped para aumentar la produccion del producto del gen. Un aumento en el numero de copias del polinucleotido se puede conseguir mediante la integration de al menos una copia adicional de la secuencia en el genoma de la celula huesped o incluyendo un gen marcador seleccionable amplificable con el polinucleotido donde las celulas que contienen copias amplificadas del gen marcador seleccionable, y copias de ese modo adicionales del polinucleotido, pueden ser seleccionadas para cultivando las celulas en presencia del agente seleccionable apropiado. Los procedimientos usados para enlazar los elementos anteriormente descritos para construir los vectoresMore than one copy of a polynucleotide of the present invention can be inserted into the host cell to increase the production of the gene product. An increase in the number of copies of the polynucleotide can be achieved by integrating at least one additional copy of the sequence into the genome of the host cell or by including a selectable marker gene amplifiable with the polynucleotide where cells containing amplified copies of the gene selectable marker, and thereby additional copies of the polynucleotide, can be selected for culturing the cells in the presence of the appropriate selectable agent. The procedures used to link the elements described above to construct the vectors
55
1010
15fifteen
20twenty
2525
3030
3535
de expresion recombinantes de la presente invention son bien conocidos para un experto en la tecnica (vease, por ejemplo, Sambrook et al., 1989, supra).The recombinant expression agents of the present invention are well known to one skilled in the art (see, for example, Sambrook et al., 1989, supra).
La transformation de una molecula de acido nucleico en una celula se puede lograr por cualquier metodo por el cual una molecula de acido nucleico puede ser insertada en la celula. Las tecnicas de transformacion incluyen, pero no se limitan a, transfection, electroporation, microinyeccion, lipofeccion, adsorcion, y fusion de protoplastos. Una celula recombinante puede permanecer unicelular o puede crecer en un tejido, un organo o un organismo multicelular. Las moleculas de acidos nucleicos transformadas de la presente invencion pueden permanecer extracromosomales o pueden integrarse en uno o mas sitios dentro de un cromosoma de la celula transformada (i.e., recombinante) de tal manera que se conserva su capacidad de ser expresada.The transformation of a nucleic acid molecule into a cell can be achieved by any method by which a nucleic acid molecule can be inserted into the cell. Transformation techniques include, but are not limited to, transfection, electroporation, microinjection, lipofection, adsorption, and fusion of protoplasts. A recombinant cell can remain unicellular or can grow in a tissue, an organ or a multicellular organism. The transformed nucleic acid molecules of the present invention can remain extrachromosomal or can be integrated into one or more sites within a chromosome of the transformed (i.e., recombinant) cell such that its ability to be expressed is preserved.
La election de una celula huesped en gran parte depende del gen que codifica el polipeptido y su fuente. La celula huesped puede ser un procariota o un eucariota.The choice of a host cell largely depends on the gene that encodes the polypeptide and its source. The host cell can be a prokaryotic or a eukaryotic.
Las celulas huesped apropiadas para transformar incluyen cualquier celula no- humana que puede ser transformada con un polinucleotido de la presente invencion. Las celulas huesped pueden ser tanto celulas sin transformar como celulas que ya estan transformadas con al menos una molecula de acido nucleico (por ejemplo, moleculas de acidos nucleicos que codifican una o mas protelnas de la presente invencion). Las celulas huesped de la presente invencion pueden ser capaces de producir endogenamente (i.e., naturalmente) las protelnas de la presente invencion o pueden ser capaces de producir las citadas protelnas despues de ser transformadas con al menos una molecula de acido nucleico de la presente invencion. Las celulas huesped de la presente invencion pueden ser cualquier celula capaz de producir al menos una protelna de la presente invencion, e incluyen celulas bacterianas, fungicas (incluyendo levadura), de parasitos, de artropodos, de animales y vegetales. Las celulas huesped preferidas incluyen celulas bacterianas, micobacterianas, de levadura, de vegetales y de animales, preferentemente de mamlfero no-humano. Las celulas huesped mas preferidas incluyen celulas de Agrobacterium, Salmonella, Escherichia, Bacillus, Listeria, Saccharomyces, Spodoptera, Mycobacteria, Trichoplusia, BHK (rinon de crlas de hamster), celulas MDCK (llnea celular de rinon de perro normal para el cultivo del herpesvirus canino), celulas CRFK (llnea celular de rinon de gato normal para el cultivo del herpesvirus felino), celulas CV-1 (llnea celularSuitable host cells for transformation include any non-human cell that can be transformed with a polynucleotide of the present invention. The host cells can be both untransformed cells and cells that are already transformed with at least one nucleic acid molecule (for example, nucleic acid molecules encoding one or more proteins of the present invention). The host cells of the present invention may be capable of endogenously producing (i.e., of course) the proteins of the present invention or may be capable of producing the aforementioned proteins after being transformed with at least one nucleic acid molecule of the present invention. The host cells of the present invention can be any cell capable of producing at least one protein of the present invention, and include bacterial, fungal cells (including yeast), parasites, arthropods, animals and plants. Preferred host cells include bacterial, mycobacterial, yeast, vegetable and animal cells, preferably non-human mammal. The most preferred host cells include Agrobacterium, Salmonella, Escherichia, Bacillus, Listeria, Saccharomyces, Spodoptera, Mycobacteria, Trichoplusia, BHK (hamster kidney) cells, MDCK cells (normal dog kidney cell line for herpesvirus culture) canine), CRFK cells (normal cat kidney cell line for feline herpesvirus culture), CV-1 cells (cell line
55
1010
15fifteen
20twenty
2525
3030
3535
de rinon de mono Africano utilizada, por ejemplo, para cultivar poxvirus de mapache), celulas COS (por ejemplo, COS-7), y celulas Vero. Las celulas huesped particularmente preferidas son E. coli, incluyendo derivados K-12 de E. coli; Salmonella typhi; Salmonella typhimurium, incluyendo cepas atenuadas; Spodoptera frugiperda; Trichoplusia ni; celulas BHK; celulas MDCK; celulas CRFK; celulas CV-1; celulas COS; celulas Vero; y celulas G8 del mioblasto de raton no-tumorugenico (por ejemplo, ATCC CRL 1246). Otras celulas huesped de mamlfero no-humano apropiadas incluyen otras llneas celulares de rinon no-humano, otras llneas celulares de fibroblasto no-humano (por ejemplo, llneas celulares de fibroblasto de embrion de gallina o murina), llneas celulares de mieloma no-humano, celulas de ovario de hamster Chino, celulas de NIH/3T3 de raton y/o celulas de LMTK.of African monkey kidney used, for example, to grow raccoon poxvirus), COS cells (eg, COS-7), and Vero cells. Particularly preferred host cells are E. coli, including K-12 derivatives of E. coli; Salmonella typhi; Salmonella typhimurium, including attenuated strains; Spodoptera frugiperda; Trichoplusia ni; BHK cells; MDCK cells; CRFK cells; CV-1 cells; COS cells; Vero cells; and G8 cells of non-tumorigenic mouse myoblast (for example, ATCC CRL 1246). Other suitable non-human mammalian host cells include other non-human kidney cell lines, other non-human fibroblast cell lines (eg, chicken or murine embryo fibroblast cell lines), non-human myeloma cell lines , Chinese hamster ovary cells, mouse NIH / 3T3 cells and / or LMTK cells.
Las tecnologlas de ADN recombinante se pueden utilizar para mejorar la expresion de moleculas de polinucleotidos transformadas por manipulation, por ejemplo, el numero de copias de las moleculas del polinucleotido dentro de una celula huesped, la eficiencia con la cual las moleculas del polinucleotido se trascriben, la eficiencia con la cual las transcripciones resultantes se traducen, y la eficiencia de modificaciones post- traduccionales. Las tecnicas recombinantes utiles para aumentar la expresion de moleculas del polinucleotido de la presente invention incluyen, pero no se limitan a, moleculas del polinucleotido ligadas operativamente a plasmidos de alto numero de copias, integration de las moleculas del polinucleotido en uno o mas cromosomas de la celula huesped, adicion de secuencias de estabilidad del vector para plasmidos, sustituciones o modificaciones de las senales de control de la transcription (por ejemplo, promotoras, operadoras, potenciadoras), sustituciones o modificaciones de la senales de control de la traduction (por ejemplo, sitios de enlace del ribosoma, secuencias Shine-Dalgarno), modification de las moleculas del polinucleotido de la presente invencion que corresponden al uso del codon de la celula huesped, y la deletion de secuencias que desestabilizan las transcripciones. La actividad de una protelna recombinante expresada de la presente invencion se puede mejorar por fragmentation, modificacion, o derivatizacion de las moleculas del polinucleotido que codifica dicha protelna.Recombinant DNA technologies can be used to improve the expression of polynucleotide molecules transformed by manipulation, for example, the number of copies of the polynucleotide molecules within a host cell, the efficiency with which the polynucleotide molecules are transcribed, the efficiency with which the resulting transcripts are translated, and the efficiency of post-translational modifications. Recombinant techniques useful for increasing the expression of polynucleotide molecules of the present invention include, but are not limited to, polynucleotide molecules operatively linked to high copy plasmids, integration of polynucleotide molecules into one or more chromosomes of the host cell, addition of vector stability sequences for plasmids, substitutions or modifications of the transcription control signals (for example, promoters, operators, enhancers), substitutions or modifications of the translation control signals (for example, ribosome binding sites, Shine-Dalgarno sequences), modification of the polynucleotide molecules of the present invention that correspond to the use of the host cell codon, and the deletion of sequences that destabilize transcripts. The activity of an expressed recombinant protein of the present invention can be enhanced by fragmentation, modification, or derivatization of the polynucleotide molecules encoding said protein.
En una realization preferida, la celula hospedadora de la invencion comprende, por tanto, al menos un polinucleotido de la invencion introducido recombinantemente mediante la construction genica de la invencion. Dichos polinucleotidos pueden codificar el polipeptido maduro o una pre-protelna que consiste en un peptido senalIn a preferred embodiment, the host cell of the invention therefore comprises at least one polynucleotide of the invention recombinantly introduced by the genetic construction of the invention. Such polynucleotides can encode the mature polypeptide or a pre-protein consisting of a signal peptide
55
1010
15fifteen
20twenty
2525
3030
3535
unido a la enzima madura que tendra que procesarse posteriormente con el fin de producir el polipeptido de la invention.bound to the mature enzyme that will have to be further processed in order to produce the polypeptide of the invention.
La celula hospedadora de la invencion expresa al menos uno de los peptidos seleccionados de entre cualquiera de los siguientes SEQ ID NO: 1, SEQ ID NO: 2, asl como cualquier peptido que comprenda dicha secuencias en su region N-terminal de manera que dichos peptidos sean funcionales tal y como se describe en el presente documento, es decir, mantengan su actividad hidrollticas frente a compuestos organosfosforados y/o carbamatos. Entre dichas secuencias peptidicas se encuentran las albuminas de aves, preferentemente, las albuminas de pollo (SEQ ID NO: 3) y la albumina de pavo (SEQ ID NO: 4). El termino “funcional” significa que el(los) peptido(s) expresado(s) retiene(n) su actividad catalltica hidrolizante de esteres fosforicos, carbamicos y/o carboxllicos. Esta actividad puede medirse por medio de cualquier procedimiento adecuado conocido en el estado de la tecnica, preferiblemente por medio de cualquiera de los procedimientos descritos a continuation en los ejemplos que acompanan al presente documento.The host cell of the invention expresses at least one of the peptides selected from any of the following SEQ ID NO: 1, SEQ ID NO: 2, as well as any peptide comprising said sequences in its N-terminal region such that said Peptides are functional as described herein, that is, they maintain their hydrolytic activity against organosphosphorus compounds and / or carbamates. Among these peptide sequences are the bird albumin, preferably chicken albumin (SEQ ID NO: 3) and turkey albumin (SEQ ID NO: 4). The term "functional" means that the expressed peptide (s) retains its hydrolyzing catalytic activity of phosphoric, carbamic and / or carboxylic esters. This activity can be measured by means of any suitable procedure known in the state of the art, preferably by means of any of the procedures described below in the examples that accompany this document.
El termino “expresion” incluye cualquier etapa implicada en la production del peptido de la invencion que incluye, pero no se limita a, transcription, modification post- transcripcional, traduction, modificacion post-traduccional, y secretion.The term "expression" includes any stage involved in the production of the peptide of the invention that includes, but is not limited to, transcription, post-transcriptional modification, translation, post-translational modification, and secretion.
Se puede llevar a cabo la expresion del peptido de la invencion en la celula hospedadora de la invencion por medio de cualquier procedimiento conocido en la tecnica, tal como la transformation de una celula hospedadora adecuada con al menos un polinucleotido de la invencion y/o con cualquier combination de estos, o con la construction genetica de la invencion, y el cultivo de la celula hospedadora transformada en condiciones que induzcan la expresion de dicho polinucleotido con el fin de obtener el peptido secretado y/o cualquier combinacion de estos.The expression of the invention peptide can be carried out in the host cell of the invention by any method known in the art, such as the transformation of a suitable host cell with at least one polynucleotide of the invention and / or with any combination of these, or with the genetic construction of the invention, and the culture of the transformed host cell under conditions that induce the expression of said polynucleotide in order to obtain the secreted peptide and / or any combination thereof.
Se puede cultivar la celula hospedadora en un medio nutritivo adecuado, solido o llquido, para la produccion del peptido de la invencion, en condiciones que permitan expresarlo y/o aislarlo. El cultivo tiene lugar en un medio nutritivo adecuado que comprende fuentes de carbono y nitrogeno y sales inorganicas utilizando procedimientos bien conocidos en la tecnica. Si se secretan los peptidos de la invencion en el medio nutritivo, estos se pueden recuperar directamente del medio.The host cell can be cultured in a suitable nutrient medium, solid or liquid, for the production of the peptide of the invention, under conditions that allow it to be expressed and / or isolated. The cultivation takes place in a suitable nutrient medium comprising carbon and nitrogen sources and inorganic salts using procedures well known in the art. If the peptides of the invention are secreted in the nutrient medium, they can be recovered directly from the medium.
55
1010
15fifteen
20twenty
2525
3030
3535
Por el contrario, si estos permanecen en el interior de la celula hospedadora, se recuperarlan mediante tecnicas conocidas por los expertos en la tecnica.On the contrary, if they remain inside the host cell, they will be recovered by techniques known to those skilled in the art.
A su vez, dichos peptidos de la invention se pueden detectar utilizando procedimientos conocidos en la tecnica especlficos para polipeptidos. Estos procedimientos de detection pueden incluir el uso de anticuerpos especlficos, la formation de un producto, o la desaparicion de un sustrato. Ademas, dichos peptidos se pueden recuperar utilizando procedimientos conocidos en la tecnica. Por ejemplo, a partir del medio nutritivo mediante procedimientos convencionales que incluyen, pero no se limitan a, centrifugation, filtration, extraction, secado mediante pulverization, evaporation, o precipitation.In turn, said peptides of the invention can be detected using methods known in the art specific for polypeptides. These detection procedures may include the use of specific antibodies, the formation of a product, or the disappearance of a substrate. In addition, said peptides can be recovered using methods known in the art. For example, from the nutrient medium by conventional procedures that include, but are not limited to, centrifugation, filtration, extraction, spray drying, evaporation, or precipitation.
Los peptidos de la presente invencion se pueden purificar mediante una variedad de procedimientos conocidos en la tecnica que incluyen, pero no se limitan a, cromatografla (por ejemplo, intercambio ionico, afinidad, hidrofoba,The peptides of the present invention can be purified by a variety of methods known in the art that include, but are not limited to, chromatography (eg, ion exchange, affinity, hydrophobic,
cromatofocalizacion, y exclusion por tamano), procedimientos electroforeticos (por ejemplo, focalizacion isoelectrica preparativa), solubilidad diferencial (por ejemplo, precipitacion en sulfato de amonio), SDS-PAGE, o extraccion.chromatofocalization, and size exclusion), electrophoretic procedures (for example, preparative isoelectric focusing), differential solubility (for example, precipitation in ammonium sulfate), SDS-PAGE, or extraction.
Asl, en otra realization preferida, la celula hospedadora de la invencion puede expresar al menos uno de los peptidos de la invencion, o cualquier combinacion de los mismos, por ejemplo aunque sin limitarnos, los peptidos que comprenden las secuencias SEQ ID NO: 1,2, 3, 4, 14, 15, y/o cualquier combination de los mismos.Thus, in another preferred embodiment, the host cell of the invention can express at least one of the peptides of the invention, or any combination thereof, for example, but not limited to, the peptides comprising the sequences SEQ ID NO: 1, 2, 3, 4, 14, 15, and / or any combination thereof.
Otro objeto descrito en la presente invencion se refiere a una composition, de ahora en adelante "composicion de la invencion”, que comprende las secuencias polinucleotldicas, o las secuencias peptldicas, o la construction genica, o las protelnas de fusion, o los vectores, o las celulas, descritas a lo largo del presente documento, junto con al menos un cofactor caracterizado por que es un cation divalente.Another object described in the present invention relates to a composition, hereafter referred to as "composition of the invention", which comprises polynucleotide sequences, or peptide sequences, or genetic construction, or fusion proteins, or vectors, or the cells, described throughout this document, together with at least one cofactor characterized in that it is a divalent cation.
En una realizacion preferida, la composicion de la invencion se caracteriza por que comprende una secuencia peptldica seleccionada entre cualquiera de las siguientes: SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 14, SEQ ID NO: 15, y/o cualquier combinacion de las mismas; mas preferiblemente las secuencias son la SEQ ID NO: 3 y/o la SEQ ID NO: 4.In a preferred embodiment, the composition of the invention is characterized in that it comprises a peptide sequence selected from any of the following: SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 14, SEQ ID NO: 15, and / or any combination thereof; more preferably the sequences are SEQ ID NO: 3 and / or SEQ ID NO: 4.
55
1010
15fifteen
20twenty
2525
3030
3535
En otra realization mas preferida, la composition de la invention se caracteriza por que los cationes divalentes se selecciona de entre cualquiera de la siguiente lista: Zn2+, Fe2+, Cu2+, Mn2+, Mg2+ y/o cualquiera de sus combinaciones, mas preferiblemente donde cation divalente es Zn2+ o Cu2+, preferentemente Cu2+.In another more preferred embodiment, the composition of the invention is characterized in that the divalent cations are selected from any of the following list: Zn2 +, Fe2 +, Cu2 +, Mn2 +, Mg2 + and / or any combination thereof, more preferably where divalent cation is Zn2 + or Cu2 +, preferably Cu2 +.
En una realization mas preferida, la composition de la invention es una composition que presenta actividad catalltica hidrolizante de compuestos organofosforados tales como malation, paration, clorpirifos, metamidofos, monocrotofos, tricloronato, acetafo, diaxinon, diazinon, paraoxin, entre otros, incluyendo esteres de acidos fosfonicos y fosflnicos y esteres de acidos carbamicos y esteres carboxllicos.In a more preferred embodiment, the composition of the invention is a composition that exhibits hydrolyzing catalytic activity of organophosphorus compounds such as malation, paration, chlorpyrifos, methamidophos, monocrotophos, trichloronate, acetafo, diaxinon, diazinon, paraoxin, among others, including esters of phosphonic and phosphonic acids and esters of carbamic acids and carboxylic esters.
En una realization preferida, la composition de la invention se caracteriza por que es una composition farmaceutica o veterinaria. Dichas composiciones pueden comprender ademas vehlculos o excipientes fisiologicamente aceptables. Un excipiente puede ser cualquier material que los animales, plantas, material vegetal o animal, o ambiente (incluyendo muestras de suelo y agua) que se tratan, puedan tolerar. Ejemplos de tales excipientes incluyen agua, solution salina, solution de Ringer, solution de dextrosa, solution de Hank, y otras soluciones salinas acuosas fisiologicamente balanceadas. Los vehlculos no acuosos, tales como aceites fijos, aceite de ajonjoll, etil oleato, o trigliceridos tambien se pueden utilizar. Otras formulaciones utiles incluyen suspensiones que contienen agentes que mejoran la viscosidad, tal como sodio carboximetilcelulosa, sorbitol, o dextran. Los excipientes tambien pueden contener menores cantidades de aditivos, tales como sustancias que mejoran la isotonicidad y la estabilidad qulmica. Ejemplos de soluciones reguladoras incluyen solution reguladora de fosfato, solution reguladora bicarbonato y solution reguladora Tris, mientras que ejemplos de conservantes incluyen timerosal u o-cresol, formalina y alcohol bencllico. Los excipientes tambien se pueden utilizar para aumentar la vida media de una composition, por ejemplo, pero no se limitan a, vehlculos polimericos de liberation controlada, implantes biodegradables, liposomas, bacterias, virus, otras celulas, aceites, esteres, y glicoles.In a preferred embodiment, the composition of the invention is characterized in that it is a pharmaceutical or veterinary composition. Such compositions may further comprise physiologically acceptable carriers or excipients. An excipient can be any material that the animals, plants, plant or animal material, or environment (including soil and water samples) that are treated, can tolerate. Examples of such excipients include water, saline solution, Ringer's solution, dextrose solution, Hank's solution, and other physiologically balanced aqueous saline solutions. Non-aqueous vehicles, such as fixed oils, sesame oil, ethyl oleate, or triglycerides can also be used. Other useful formulations include suspensions containing viscosity enhancing agents, such as sodium carboxymethyl cellulose, sorbitol, or dextran. Excipients may also contain lower amounts of additives, such as substances that improve isotonicity and chemical stability. Examples of regulatory solutions include phosphate regulatory solution, bicarbonate regulatory solution and Tris regulatory solution, while examples of preservatives include thimerosal or o-cresol, formalin and benzyl alcohol. Excipients can also be used to increase the half-life of a composition, for example, but are not limited to, controlled release polymeric vehicles, biodegradable implants, liposomes, bacteria, viruses, other cells, oils, esters, and glycols.
En otra realization preferida, las composiciones farmaceuticas o veterinarias descritas en la presente invention, pueden comprender ademas otro principio activo. El termino "principio activo", "substantia activa", "substantia farmaceuticamente activa", "ingrediente activo" o "ingrediente farmaceuticamente activo" significa cualquier componente que potencialmente proporcione una actividad farmacologica u otroIn another preferred embodiment, the pharmaceutical or veterinary compositions described in the present invention may also comprise another active ingredient. The term "active ingredient", "active substance", "pharmaceutically active substance", "active ingredient" or "pharmaceutically active ingredient" means any component that potentially provides a pharmacological or other activity
55
1010
15fifteen
20twenty
2525
3030
3535
efecto diferente en el diagnostico, cura, mitigation, tratamiento, o prevention de una enfermedad, o que afecta a la estructura o funcion del cuerpo del hombre u otros animales. El termino incluye aquellos componentes que promueven un cambio qulmico en la elaboration del farmaco y estan presentes en el mismo de una forma modificada prevista que proporciona la actividad especlfica o el efecto.different effect on the diagnosis, cure, mitigation, treatment, or prevention of a disease, or that affects the structure or function of the body of man or other animals. The term includes those components that promote a chemical change in the elaboration of the drug and are present therein in a modified form intended to provide the specific activity or effect.
En una realization preferida, los principios activos que pueden acompanar a las composiciones farmaceuticas o veterinarias descritas en la presente invention, se seleccionan de entre cualquiera de los siguientes: agentes bloqueantes de receptores de acetilcolina, preferentemente atropina (evita los efectos toxicos de organofosforados y carbamatos), oximas, preferentemente pralidoxima, o cualquier sustancia o compuesto capaz de reactivar las colinesterasas inhibidas por organofosforados, bioscavengers no catallticos (protelnas o peptidos que se unen y capturan compuestos organofosforados y/o carbamatos); cualquier otro compuesto capaz de evitar efectos adversos de la intoxication por organofosforados y/o carbamatos, tales como ansiollticos, anticonvulsivos, sedantes, como por ejemplo, el diazepan y/o bloqueantes de calcio.In a preferred embodiment, the active ingredients that can accompany the pharmaceutical or veterinary compositions described in the present invention are selected from any of the following: acetylcholine receptor blocking agents, preferably atropine (avoids the toxic effects of organophosphorus and carbamates ), oximes, preferably pralidoxime, or any substance or compound capable of reactivating cholinesterase inhibited by organophosphates, non-catallotic bioscavengers (protelnas or peptides that bind and capture organophosphorus compounds and / or carbamates); Any other compound capable of avoiding adverse effects of organophosphorus and / or carbamate intoxication, such as anxiolytics, anticonvulsants, sedatives, such as diazepan and / or calcium blockers.
En otra realization preferida, la composition de la invention comprende ademas un vehlculo o excipiente, farmaceutica o veterinariamente aceptable.In another preferred embodiment, the composition of the invention further comprises a pharmaceutically or veterinarily acceptable vehicle or excipient.
El termino "vehlculo” aplicados a las composiciones farmaceuticas y veterinarias descritas en la presente invention se refieren a un diluyente, coadyuvante, excipiente o portador con el que se deben administrar el peptido de la invention, la secuencia nucleotldica que lo codifica, la construction genica, o la celula segun se describe en la invention. La funcion del vehlculo es facilitar la incorporation de otros compuestos, permitir una mejor dosificacion y administration o dar consistencia y forma a la composition. Por tanto, el vehlculo es una sustancia que se emplea en la composition para diluir cualquiera de los componentes de la misma hasta un volumen o peso determinado; o bien que aun sin diluir dichos componentes es capaz de permitir una mejor dosificacion y administration o dar consistencia y forma a la composition. Cuando la forma de presentation es llquida, el vehlculo farmaceuticamente aceptable es el diluyente. Ademas, el vehlculo debe estar permitido y evaluado de modo que no causen dano a los organismos a los que se les administra.The term "vehicle" applied to the pharmaceutical and veterinary compositions described in the present invention refers to a diluent, adjuvant, excipient or carrier with which the peptide of the invention should be administered, the nucleotide sequence encoding it, the genetic construction , or the cell as described in the invention.The function of the vehicle is to facilitate the incorporation of other compounds, allow a better dosage and administration or give consistency and form to the composition.Therefore, the vehicle is a substance that is used in the composition to dilute any of the components thereof to a certain volume or weight; or even without diluting said components it is capable of allowing a better dosage and administration or giving consistency and form to the composition. When the presentation form is In this case, the pharmaceutically acceptable vehicle is the diluent, and the vehicle must be allowed and evaluated so that They do not cause damage to the organisms to which they are administered.
55
1010
15fifteen
20twenty
2525
3030
3535
Un excipiente puede ser cualquier material que, los animales, incluidos el ser humano, puede tolerar. Ejemplos de tales excipientes incluyen agua, solution salina, solution de Ringer, solucion de dextrosa, solucion de Hank, y otras soluciones salinas acuosas fisiologicamente balanceadas. Los vehlculos no acuosos, tales como aceites fijos, aceite de ajonjoll, etil oleato, o trigliceridos tambien se pueden utilizar. Otras formulaciones utiles incluyen suspensiones que contienen agentes que mejoran la viscosidad, tal como sodio carboximetilcelulosa, sorbitol, o dextran. Los excipientes tambien pueden contener menores cantidades de aditivos, tales como sustancias que mejoran la isotonicidad y la estabilidad qulmica. Ejemplos de soluciones reguladoras incluyen solucion reguladora de fosfato, solucion reguladora bicarbonato y solucion reguladora Tris, mientras que ejemplos de conservantes incluyen timerosal u o-cresol, formalina y alcohol bencllico. Los excipientes tambien se pueden utilizar para aumentar la vida media de una composition, por ejemplo, pero no se limitan a, vehlculos polimericos de liberation controlada, implantes biodegradables, liposomas, bacterias, virus, otras celulas, aceites, esteres, y glicoles.An excipient can be any material that animals, including humans, can tolerate. Examples of such excipients include water, saline solution, Ringer's solution, dextrose solution, Hank's solution, and other physiologically balanced aqueous saline solutions. Non-aqueous vehicles, such as fixed oils, sesame oil, ethyl oleate, or triglycerides can also be used. Other useful formulations include suspensions containing viscosity enhancing agents, such as sodium carboxymethyl cellulose, sorbitol, or dextran. Excipients may also contain lower amounts of additives, such as substances that improve isotonicity and chemical stability. Examples of regulatory solutions include phosphate regulatory solution, bicarbonate regulatory solution and Tris regulatory solution, while examples of preservatives include thimerosal or o-cresol, formalin and benzyl alcohol. Excipients can also be used to increase the half-life of a composition, for example, but are not limited to, controlled release polymeric vehicles, biodegradable implants, liposomes, bacteria, viruses, other cells, oils, esters, and glycols.
La composicion de la invention se puede encontrar en estado solido, llquido o en suspension, incluso en el interior de nanopartlculas, preferentemente en disolucion.The composition of the invention can be found in a solid, liquid or suspended state, even inside nanoparticles, preferably in solution.
La composicion de la presente invencion puede administrarse por cualquier via adecuada para una molecula especlfica, directamente (por ejemplo, por via local, tal como por inyeccion, inyeccion subcutanea o administration topica en el lugar del tejido) o por via sistemica (por ejemplo, por via parenteral o por via oral). Cuando la composicion de la presente invencion se va a proporcionar por via parenteral, tal como mediante administracion intravenosa, subcutanea, oftalmica, intraperitoneal, intramuscular, bucal, rectal, vaginal, intraorbital, intracerebral, intracraneal, intraespinal, intraventricular, intratecal, intracisternal, intracapsular, intranasal o mediante administracion por aerosol, la composicion preferentemente comprende parte de una suspension o solucion compatible fisiologicamente fluida o acuosa. Por lo tanto, el vehlculo o excipiente es fisiologicamente aceptable de modo que cuando se suministra el agente deseado al sujeto, la solucion no afecta de forma adversa de otro modo al equilibrio de electrolitos y/o al volumen del sujeto. El medio acuoso para el agente puede comprender por lo tanto solucion salina fisiologica normal.The composition of the present invention can be administered by any suitable route for a specific molecule, directly (for example, locally, such as by injection, subcutaneous injection or topical administration at the site of tissue) or by systemic route (for example, parenterally or orally). When the composition of the present invention is to be provided parenterally, such as by intravenous, subcutaneous, ophthalmic, intraperitoneal, intramuscular, buccal, rectal, vaginal, intraorbital, intracerebral, intracranial, intraspinal, intraventricular, intrathecal, intracisternal, intracapsular administration. , intranasally or by aerosol administration, the composition preferably comprises part of a physiologically fluid or aqueous compatible suspension or solution. Therefore, the vehicle or excipient is physiologically acceptable so that when the desired agent is supplied to the subject, the solution does not otherwise adversely affect the electrolyte balance and / or the volume of the subject. The aqueous medium for the agent can therefore comprise normal physiological saline solution.
En otra realizacion preferida, la composicion de la invencion se caracteriza porque es un biocatalizador.In another preferred embodiment, the composition of the invention is characterized in that it is a biocatalyst.
55
1010
15fifteen
20twenty
2525
3030
3535
A efectos de la presente invention el termino “biocatalizador” se refiere a cualquier protelna o peptido que cataliza una reaction, tlpicamente corresponde al concepto de enzima. Implica que un compuesto qulmico (sustrato o sustratos) en presencia del biocatalizador sufre una transformation qulmica dando lugar a un producto o productos de la reaccion, mientras que de forma espontanea en su ausencia, la reaccion, o bien no ocurre o se produce mas lentamente.For the purposes of the present invention the term "biocatalyst" refers to any protein or peptide that catalyzes a reaction, typically corresponds to the concept of enzyme. It implies that a chemical compound (substrate or substrates) in the presence of the biocatalyst undergoes a chemical transformation resulting in a product or products of the reaction, while spontaneously in its absence, the reaction either does not occur or occurs more slowly .
Otro objeto de la presente invencion se refiere a una formulation de liberation controlada que es capaz de liberar lentamente la composition de la presente invencion en un material animal o vegetal, o el ambiente (incluyendo muestras de suelo y agua). Como se utiliza en este documento, una formulacion de liberacion controlada comprende una composicion de la presente invencion en un vehlculo de liberacion controlada. Vehlculos de liberacion controlada apropiados incluyen, pero no se limitan a, pollmeros biocompatibles, otras matrices polimericas, capsulas, microcapsulas, micropartlculas, preparaciones de bolo, bombas osmoticas, dispositivos de difusion, liposomas, lipoesferas, y sistemas de entrega transdermicos. Las formulaciones preferidas de liberacion controlada son biodegradables (i.e., bioerosionables).Another object of the present invention relates to a controlled release formulation that is capable of slowly releasing the composition of the present invention in an animal or plant material, or the environment (including soil and water samples). As used herein, a controlled release formulation comprises a composition of the present invention in a controlled release vehicle. Appropriate controlled release vehicles include, but are not limited to, biocompatible polymers, other polymeric matrices, capsules, microcapsules, microparticles, bolus preparations, osmotic pumps, diffusion devices, liposomes, lipospheres, and transdermal delivery systems. Preferred controlled release formulations are biodegradable (i.e., bioerodible).
Una formulacion de liberacion controlada preferida, es capaz de liberar la composicion de la presente invencion en suelo o agua que esta en un area atomizada con un compuesto de tipo ester fosforico, carbamico y/o carboxllico. La formulacion preferiblemente se libera durante un periodo de tiempo que oscila de aproximadamente 1 a cerca de 12 meses. Una formulacion preferida de liberacion controlada de la presente invencion es capaz de realizar un tratamiento preferiblemente durante al menos aproximadamente 1 mes, mas preferiblemente por al menos cerca de 3 meses, aun mas preferiblemente por al menos cerca de 6 meses, aun mas preferiblemente por al menos cerca de 9 meses, e incluso mas preferiblemente por al menos cerca de 12 meses.A preferred controlled release formulation is capable of releasing the composition of the present invention in soil or water that is in an atomized area with a phosphoric, carbamic and / or carboxylic ester type compound. The formulation is preferably released for a period of time ranging from about 1 to about 12 months. A preferred controlled release formulation of the present invention is capable of performing a treatment preferably for at least about 1 month, more preferably for at least about 3 months, even more preferably for at least about 6 months, even more preferably for at least less than 9 months, and even more preferably for at least about 12 months.
La concentration y/o cantidad efectiva del polipeptido, secuencia nucleotldica, vector, o celula huesped de la presente invencion que sera necesaria para hidrolizar un compuesto de tipo organofosforado o carbamato, tales como ester fosforico, carbamico y/o carboxllico, dependera de la naturaleza de la muestra que se descontamina, la concentracion del ester en la muestra, y la formulacion de la composicion. La concentracion y/o cantidad efectiva del polipeptido, secuenciaThe concentration and / or effective amount of the polypeptide, nucleotide sequence, vector, or host cell of the present invention that will be necessary to hydrolyze an organophosphorus or carbamate type compound, such as phosphoric, carbamic and / or carboxylic ester, will depend on the nature of the sample that is decontaminated, the concentration of the ester in the sample, and the formulation of the composition. The concentration and / or effective amount of the polypeptide, sequence
55
1010
15fifteen
20twenty
2525
3030
3535
nucieotldica, vector, o celula huesped dentro de la composition se puede determinar facilmente de forma experimental, como sera entendido por un experto.Nucieotldica, vector, or host cell within the composition can be easily determined experimentally, as will be understood by an expert.
Otro objeto descrito en la presente invention se refiere a un biosensor y/o biorremediador que comprende el polipeptido, o el polinucleotido, o la construction de acido nucleico, o el vector, o la celula, o la composicion segun se define en la presente invencion, donde dicho biosensor y/o biorremediador es capaz de hidrolizar y/o degradar compuestos organofosforados y/o carbamatos.Another object described in the present invention relates to a biosensor and / or bioremediator comprising the polypeptide, or the polynucleotide, or the construction of nucleic acid, or the vector, or the cell, or the composition as defined in the present invention. , wherein said biosensor and / or bioremediator is capable of hydrolyzing and / or degrading organophosphorus compounds and / or carbamates.
A efectos de la presente invencion el termino "biosensor” se refiere a un dispositivo analltico que por lo general esta formado por un material biologicamente activo, tal como una enzima y un transductor que convierte una reaction bioqulmica en una senal electronica cuantificable que se puede procesar, transmitir, y medir. Una revision general de biosensores que han sido utilizados para la deteccion de compuestos de tipo ester fosforico, carbamico y/o carboxllico se proporciona por Rekha et al. (Rekha, M. et al. Critical Reviews in Biotechnology. 2000;20: 213-235). Los objetos descritos en la presente invencion, se pueden adaptar para su uso en tales biosensores.For the purposes of the present invention the term "biosensor" refers to an analytical device that is generally formed by a biologically active material, such as an enzyme and a transducer that converts a biochemical reaction into a quantifiable electronic signal that can be processed. , transmit, and measure A general review of biosensors that have been used for the detection of phosphoric, carbamic and / or carboxylic ester compounds is provided by Rekha et al. (Rekha, M. et al. Critical Reviews in Biotechnology. 2000; 20: 213-235) The objects described in the present invention can be adapted for use in such biosensors.
A efectos de la presente invencion se describe el termino "biorremediacion” se refiere al procedimiento para la elimination y/o destruction de compuestos contaminantes mediantes organismos vivos y/o sustancias y/o compuestos sintetizados por estos.For the purposes of the present invention the term "bioremediation" refers to the process for the elimination and / or destruction of contaminating compounds through living organisms and / or substances and / or compounds synthesized by them.
Otro objeto descrito en la presente invencion se refiere al uso del polipeptido, o del polinucleotido, o de una construccion de acido nucleico, o de un vector, o de una celula, o de un polipeptido de fusion, o de una composicion segun la presente invencion, para la elaboration de un medicamento. Alternativamente, la presente invencion se refiere al polipeptido, o al polinucleotido, o a la construccion de acido nucleico, o al vector, o a la celula, o al polipeptido de fusion, o a la composicion segun la presente invencion, para su uso como medicamento.Another object described in the present invention relates to the use of the polypeptide, or of the polynucleotide, or of a nucleic acid construct, or of a vector, or of a cell, or of a fusion polypeptide, or of a composition according to the present. invention for the preparation of a medicine. Alternatively, the present invention relates to the polypeptide, or to the polynucleotide, or to the construction of nucleic acid, or to the vector, or to the cell, or to the fusion polypeptide, or to the composition according to the present invention, for use as a medicament.
El termino "medicamento", tal y como se usa en esta memoria, hace referencia a cualquier sustancia usada para prevention, diagnostico, alivio, tratamiento o curacion de enfermedades en los animales, incluido el ser humano. En el contexto de la presente invencion, la enfermedad se refiere a intoxicaciones producidas por compuestos organofosforados, esteres carbamicos y/o esteres carboxllicos.The term "medication", as used herein, refers to any substance used for prevention, diagnosis, relief, treatment or cure of diseases in animals, including humans. In the context of the present invention, the disease refers to poisonings produced by organophosphorus compounds, carbamic esters and / or carboxylic esters.
55
1010
15fifteen
20twenty
2525
3030
3535
En una realization preferida, la presente invention describe el uso de la albumina de aves, preferiblemente la albumina de pollo (SEQ ID NO: 3) y/o de pavo (SEQ ID NO: 4) junto con un cation divalente, tal y como se describe en el presente documento, para la elaboration de un medicamento. Alternativamente, la presente invention se refiere a la albumina de aves, preferiblemente la albumina de pollo (SEQ ID NO: 3) y/o de pavo (SEQ ID NO: 4) junto con un cation divalente para su uso como medicamento.In a preferred embodiment, the present invention describes the use of bird albumin, preferably chicken albumin (SEQ ID NO: 3) and / or turkey (SEQ ID NO: 4) together with a divalent cation, such as described herein, for the preparation of a medicament. Alternatively, the present invention relates to bird albumin, preferably chicken albumin (SEQ ID NO: 3) and / or turkey (SEQ ID NO: 4) together with a divalent cation for use as a medicine.
Las composiciones de la invention contendran una cantidad profilactica o terapeuticamente efectiva segun se define en el presente documento, para proporcionar el efecto deseado.The compositions of the invention will contain a prophylactic or therapeutically effective amount as defined herein, to provide the desired effect.
Tal como se usa en la presente description, el termino "cantidad terapeutica o profilacticamente efectiva" se refiere a la cantidad de polipeptido(s), secuencia(s) nucleotldica(s) que codifica(n) para el/los peptido(s) de la invention, polipeptido de fusion, vector, celulas de la invention, o composition de la invention que es capaz de producir el efecto deseado. En general, la cantidad terapeuticamente efectiva que debe administrarse dependera entre otros factores, de las propias caracterlsticas del sujeto, la gravedad de la enfermedad y/o infection, la forma de administration, etc.As used herein, the term "therapeutically or prophylactically effective amount" refers to the amount of polypeptide (s), nucleotide sequence (s) encoding the peptide (s). of the invention, fusion polypeptide, vector, cells of the invention, or composition of the invention that is capable of producing the desired effect. In general, the therapeutically effective amount to be administered will depend among other factors, on the subject's own characteristics, the severity of the disease and / or infection, the form of administration, etc.
Otro objeto descrito en la presente invention se refiere al uso del polipeptido, o del polinucleotido, o de una construction de acido nucleico, o de un vector, o de una celula, o de un polipeptido de fusion, o de una composition segun la presente invention para la elaboration de un medicamento para el tratamiento de intoxicaciones por compuestos organofosforados, esteres carbamicos y/o esteres carboxllicos. Alternativamente, la presente invention se refiere al polipeptido, o al polinucleotido, o a la construccion de acido nucleico, o al vector, o a la celula, o al polipeptido de fusion, o a la composition segun la presente invention, para el tratamiento de intoxicaciones por compuestos organofosforados, esteres carbamicos y/o esteres carboxllicos.Another object described in the present invention relates to the use of the polypeptide, or the polynucleotide, or a nucleic acid construct, or a vector, or a cell, or a fusion polypeptide, or a composition according to the present. invention for the preparation of a medicament for the treatment of poisonings by organophosphorus compounds, carbamic esters and / or carboxylic esters. Alternatively, the present invention relates to the polypeptide, or to the polynucleotide, or to the construction of nucleic acid, or to the vector, or to the cell, or to the fusion polypeptide, or to the composition according to the present invention, for the treatment of compound poisoning. organophosphates, carbamic esters and / or carboxylic esters.
En una realization preferida, la presente invention describe el uso de la albumina de aves, preferiblemente la albumina de pollo (SEQ ID NO: 3) y/o de pavo (SEQ ID NO: 4) junto con un cation divalente, tal y como se describe en el presente documento, para la elaboration de un medicamento para el tratamiento de intoxicaciones por compuestos organofosforados, esteres carbamicos y/o esteres carboxllicos.In a preferred embodiment, the present invention describes the use of bird albumin, preferably chicken albumin (SEQ ID NO: 3) and / or turkey (SEQ ID NO: 4) together with a divalent cation, such as It is described herein for the preparation of a medicament for the treatment of poisoning by organophosphorus compounds, carbamic esters and / or carboxylic esters.
55
1010
15fifteen
20twenty
2525
3030
Alternativamente, la presente invention se refiere a la albumina de aves, preferiblemente la albumina de pollo (SEQ ID NO: 3) y/o de pavo (SEQ ID NO: 4) junto con un cation divalente para su uso como medicamento para el tratamiento de intoxicaciones provocadas por compuestos organofosforados, esteres carbamicos y/o esteres carboxllicos.Alternatively, the present invention relates to bird albumin, preferably chicken albumin (SEQ ID NO: 3) and / or turkey (SEQ ID NO: 4) together with a divalent cation for use as a medicament for treatment. of poisoning caused by organophosphorus compounds, carbamic esters and / or carboxylic esters.
Otro objeto descrito en la presente invencion se refiere al uso del polipeptido, o del polinucleotido, o de una construction de acido nucleico, o de un vector, o de una celula, o de un polipeptido de fusion, o de una composition, o de un biosensor segun la presente invencion, para hidrolizar moleculas organofosforadas.Another object described in the present invention relates to the use of the polypeptide, or of the polynucleotide, or of a nucleic acid construct, or of a vector, or of a cell, or of a fusion polypeptide, or of a composition, or of a biosensor according to the present invention, to hydrolyze organophosphorus molecules.
Otro objeto descrito en la presente invencion se refiere al uso del polipeptido, o del polinucleotido, o de una construccion de acido nucleico, o de un vector, o de una celula, o de un polipeptido de fusion, o de una composicion, o de un biosensor segun la presente invencion como biocatalizador en util en los procesos de biorremediacion. En una realization preferida, dicho uso va dirigido preferentemente a catalizar reacciones de hidrolisis y/o degradation de compuestos organofosforados, esteres carbamicos y/o esteres carboxllicos.Another object described in the present invention relates to the use of the polypeptide, or of the polynucleotide, or of a nucleic acid construct, or of a vector, or of a cell, or of a fusion polypeptide, or of a composition, or of a biosensor according to the present invention as a useful biocatalyst in bioremediation processes. In a preferred embodiment, said use is preferably directed to catalyze hydrolysis reactions and / or degradation of organophosphorus compounds, carbamic esters and / or carboxylic esters.
Otro objeto descrito en la presente invencion se refiere al uso del polipeptido, o del polinucleotido, o de una construccion de acido nucleico, o de un vector, o de una celula, o de un polipeptido de fusion, o de una composicion, o de un biosensor segun la presente invencion para el aislamiento de compuestos quirales.Another object described in the present invention relates to the use of the polypeptide, or of the polynucleotide, or of a nucleic acid construct, or of a vector, or of a cell, or of a fusion polypeptide, or of a composition, or of a biosensor according to the present invention for the isolation of chiral compounds.
Otro objeto descrito en la presente invencion se refiere al uso de la albumina de aves para el tratamiento de intoxicaciones por compuestos organofosforados. Alternativamente, se refiere a la albumina de aves para su uso en el tratamiento de intoxicaciones por compuestos organofosforados. En una realizacion preferida, la albumina se selecciona de entre albumina de pavo o albumina de pollo.Another object described in the present invention relates to the use of bird albumin for the treatment of organophosphorus compound poisoning. Alternatively, it refers to bird albumin for use in the treatment of organophosphorus compound poisoning. In a preferred embodiment, albumin is selected from turkey albumin or chicken albumin.
Otro objeto descrito en la presente invencion se refiere al uso de la albumina de aves para hidrolizar moleculas organofosforadas. En una realizacion preferida, la albumina se selecciona de entre albumina de pavo o albumina de pollo.Another object described in the present invention relates to the use of bird albumin to hydrolyze organophosphorus molecules. In a preferred embodiment, albumin is selected from turkey albumin or chicken albumin.
55
1010
15fifteen
20twenty
2525
3030
3535
Otro objeto descrito en la presente invention se refiere al uso de la albumina de aves para procesos de biorremediacion. En una realization preferida, la albumina se selecciona de entre albumina de pavo o albumina de pollo.Another object described in the present invention relates to the use of bird albumin for bioremediation processes. In a preferred embodiment, albumin is selected from turkey albumin or chicken albumin.
Otro objeto descrito en la presente invencion se refiere al uso de la albumina de aves para el aislamiento de compuestos quirales. En una realizacion preferida, la albumina se selecciona de entre albumina de pavo o albumina de pollo.Another object described in the present invention relates to the use of bird albumin for the isolation of chiral compounds. In a preferred embodiment, albumin is selected from turkey albumin or chicken albumin.
Otro objeto descrito en la presente invencion se refiere al uso de la albumina de aves como biosensor. En una realizacion preferida, la albumina se selecciona de entre albumina de pavo o albumina de pollo.Another object described in the present invention relates to the use of bird albumin as a biosensor. In a preferred embodiment, albumin is selected from turkey albumin or chicken albumin.
Otro de los objetos descritos en la presente invencion se refiere a metodos para producir un polipeptido segun la presente invencion, que comprende (a) cultivar una celula, que en su forma de tipo salvaje es capaz de producir el polipeptido, bajo condiciones propicias para la production del polipeptido; (b) recuperar y/o recolectar dichas celulas o tomar una muestra del medio de cultivo de las celulas; c) aislar y purificar el polipeptido.Another of the objects described in the present invention relates to methods for producing a polypeptide according to the present invention, which comprises (a) culturing a cell, which in its wild-type form is capable of producing the polypeptide, under conditions conducive to the polypeptide production; (b) recover and / or collect said cells or take a sample of the cell culture medium; c) isolate and purify the polypeptide.
Preferiblemente, la celula es cualquiera de las celulas descritas en el presente documento, mas preferiblemente, la celula es del genero Saccharomyces cerevisiae, y mas preferiblemente Pichia pastoris.Preferably, the cell is any of the cells described herein, more preferably, the cell is from the genus Saccharomyces cerevisiae, and more preferably Pichia pastoris.
Aunque Escherichia coli (E. coli) fue el primer hospedero empleado para expresar protelnas humanas recombinantes, tiene inconvenientes para hacer algunas modificaciones postraduccionales, como la glicosilacion. Debido a esto, la levadura Saccharomyces cerevisiae (S. cerevisiae) ha sido utilizada. Sin embargo, debido a que forma en las protelnas derivados glicosilados diferente a las celulas humanas, produce protelnas antigenicas. Sin embargo mas recientemente se estan usando otras levaduras no-convencionales, como Pichia pastoris (P. pastoris).Although Escherichia coli (E. coli) was the first host used to express recombinant human proteins, it has drawbacks to make some post-translational modifications, such as glycosylation. Because of this, Saccharomyces cerevisiae (S. cerevisiae) yeast has been used. However, because it forms glycosylated derivative proteins different from human cells, it produces antigenic proteins. More recently, however, other unconventional yeasts are being used, such as Pichia pastoris (P. pastoris).
La presente invencion tambien se refiere a metodos para producir un polipeptido de la presente invencion, que comprende (a) cultivar una celula huesped que comprende una construction genica que comprende una secuencia de nucleotidos que codifica el polipeptido de la invencion bajo condiciones propicias para la produccion delThe present invention also relates to methods for producing a polypeptide of the present invention, comprising (a) culturing a host cell comprising a genetic construct comprising a nucleotide sequence encoding the polypeptide of the invention under conditions conducive to production of the
55
1010
15fifteen
20twenty
2525
3030
3535
polipeptido, y (b) recuperar y/o recolectar dichas celulas o tomar una muestra del medio de cultivo de las celulas; c) aislar y purificar el polipeptido.polypeptide, and (b) recover and / or collect said cells or take a sample of the cell culture medium; c) isolate and purify the polypeptide.
En una realization preferida de los metodos descritos en el presente documento, estos se caracterizan por que en la etapa b) se prepara un extracto crudo o extracto clarificado homogeneizado. En otra realizacion mas preferida del metodo de la invention, es opcional enriquecer el nivel de pureza del peptido en el extracto homogeneizado o en el extracto crudo.In a preferred embodiment of the methods described herein, these are characterized in that in step b) a crude extract or homogenized clarified extract is prepared. In another more preferred embodiment of the method of the invention, it is optional to enrich the level of purity of the peptide in the homogenized extract or in the crude extract.
En los metodos de production de la presente invencion, las celulas se cultivan en un medio nutritivo adecuado para la produccion del polipeptido usando metodos bien conocidos en la tecnica. Por ejemplo, la celula Pichia pastoris puede ser cultivada por cultivo en matraz de agitation, y a pequena escala o fermentation a gran escala (incluyendo continua, por lotes, alimentation por lotes, o fermentaciones en estado solido) en fermentadores de laboratorio o industriales realizados en un medio adecuado y bajo condiciones permitiendo que el polipeptido sea expresado y / o aislado.In the production methods of the present invention, the cells are grown in a nutrient medium suitable for the production of the polypeptide using methods well known in the art. For example, the Pichia pastoris cell can be grown by agitation flask culture, small-scale or large-scale fermentation (including continuous, batch, batch feed, or solid state fermentation) in laboratory or industrial fermenters made in a suitable medium and under conditions allowing the polypeptide to be expressed and / or isolated.
El cultivo se desarrolla en un medio nutritivo adecuado que comprende fuentes de carbono y nitrogeno y sales inorganicas, usando procedimientos conocidos en la tecnica. Los medios adecuados estan disponibles de proveedores comerciales o se pueden preparar segun composiciones publicadas (por ejemplo, en catalogos de la American Type Culture Collection).The culture is grown in a suitable nutrient medium comprising carbon and nitrogen sources and inorganic salts, using methods known in the art. Suitable media are available from commercial suppliers or can be prepared according to published compositions (for example, in catalogs of the American Type Culture Collection).
Si el polipeptido se secreta en el medio nutritivo, el polipeptido puede ser recuperado directamente del medio. Si el polipeptido no se secreta, se puede recuperar a partir de lisados celulares.If the polypeptide is secreted in the nutrient medium, the polypeptide can be recovered directly from the medium. If the polypeptide is not secreted, it can be recovered from cell lysates.
Los polipeptidos pueden ser detectados usando metodos conocidos en la tecnica que son especlficos para los polipeptidos. Estos metodos de detection pueden incluir el uso de anticuerpos especlficos, formation de un producto enzimatico, o desaparicion de un sustrato enzimatico. Por ejemplo, un ensayo enzimatico se puede utilizar para determinar la actividad del polipeptido como se describe en el presente documento.Polypeptides can be detected using methods known in the art that are specific for polypeptides. These detection methods may include the use of specific antibodies, formation of an enzymatic product, or disappearance of an enzyme substrate. For example, an enzymatic assay can be used to determine the activity of the polypeptide as described herein.
El polipeptido resultante puede ser recuperado usando metodos conocidos en la tecnica. Por ejemplo, el polipeptido puede ser recuperado del medio nutritivo porThe resulting polypeptide can be recovered using methods known in the art. For example, the polypeptide can be recovered from the nutrient medium by
55
1010
15fifteen
20twenty
2525
3030
3535
procedimientos convencionales incluyendo, pero no limitado a, centrifugacion, filtracion, extraction, secado por pulverization, evaporation, precipitation, uso de anticuerpos especlficos, la formation de un producto, o la desaparicion de un sustrato.conventional procedures including, but not limited to, centrifugation, filtration, extraction, spray drying, evaporation, precipitation, use of specific antibodies, the formation of a product, or the disappearance of a substrate.
Los polipeptidos de la presente invention se pueden purificar mediante una variedad de procedimientos conocidos en la tecnica, incluyendo, pero no limitados a, cromatografla (por ejemplo, de intercambio ionico, de afinidad, de interaction hidrofobica, de filtracion en gel, HPLC), metodos electroforeticos (isoelectroenfoque preparativo, electroforesis preparativa en geles de poliacrilamida-SDS), solubilidad diferencial (precipitacion con sulfato amonico), ultracentrifugacion preparativa en gradiente de sacarosa. Una vez que se ha alcanzado el grado deseado de pureza, lo que puede requerir mas de un paso cromatografico, es frecuente que sea necesario concentrar la protelna o eliminar sales e iones que puedan ser perjudiciales para su posterior uso. En ese caso, se recurre a tecnicas conocidas, tales como liofilizacion o ultrafiltracion.The polypeptides of the present invention can be purified by a variety of methods known in the art, including, but not limited to, chromatography (eg, ion exchange, affinity, hydrophobic interaction, gel filtration, HPLC), electrophoretic methods (preparatory isoelectric focusing, preparative electrophoresis in polyacrylamide-SDS gels), differential solubility (precipitation with ammonium sulfate), preparative ultracentrifugation in sucrose gradient. Once the desired degree of purity has been reached, which may require more than one chromatographic step, it is often necessary to concentrate the protein or eliminate salts and ions that may be harmful for later use. In that case, known techniques are used, such as lyophilization or ultrafiltration.
Otro objeto descrito en la presente invencion se refiere a un metodo para el aislamiento de isomeros a partir de una mezcla raceminca de compuestos organofosforados que comprende las siguientes etapas: a) incubar una mezcla racemica de compuestos organofosforados con al menos uno de los peptidos, secuencias nucleotldicas, construction de acido nucleico, vector, celula, polipeptido de fusion, composicion, o biosensor descritos en el presente documento, en presencia de al menos un cation metalico, segun se describe en el presente documento; b) recuperar y/o recolectar los compuestos obtenidos; y c) aislar, purificar e identificar el isomero.Another object described in the present invention relates to a method for isolating isomers from a raceminal mixture of organophosphorus compounds comprising the following steps: a) incubating a racemic mixture of organophosphorus compounds with at least one of the peptides, sequences nucleotide, construction of nucleic acid, vector, cell, fusion polypeptide, composition, or biosensor described herein, in the presence of at least one metal cation, as described herein; b) recover and / or collect the compounds obtained; and c) isolate, purify and identify the isomer.
La etapa a) puede llevarse a cabo en reactores en los que se mezclan la mezcla racemica de compuestos organofosforados en presencia de al menos un cation metalico, y el biocatalizador y/o composition de la invencion. La detection de los isomeros obtenidos se realiza por cualquier metodologla conocida por el experto medio en el presente campo tecnico, tales como por ejemplo, sin ser limitativas, tecnicas de extraccion con solventes o tecnicas cromatograflcas.Step a) can be carried out in reactors in which the racemic mixture of organophosphorus compounds is mixed in the presence of at least one metal cation, and the biocatalyst and / or composition of the invention. The detection of the isomers obtained is carried out by any methodology known by the average expert in the present technical field, such as, for example, without being limiting, solvent extraction techniques or chromatographic techniques.
Otro objeto descrito en la presente invencion se refiere a un metodo de desintoxicacion y tratamiento de un sujeto que ha estado expuesto a contaminacion por moleculas organofosforadas que comprende la administracion a dicho sujeto deAnother object described in the present invention relates to a method of detoxification and treatment of a subject that has been exposed to contamination by organophosphorus molecules comprising administration to said subject of
55
1010
15fifteen
20twenty
2525
3030
3535
un cantidad terapeuticamente efectiva del polipeptido, o del polinucleotido, o de la construction de acido nucleico, o del vector, o de la celula, o del polipeptido de fusion, o de la composition, segun se describe a lo largo de la presente invention.a therapeutically effective amount of the polypeptide, or of the polynucleotide, or of the construction of nucleic acid, or of the vector, or of the cell, or of the fusion polypeptide, or of the composition, as described throughout the present invention.
A efectos de la presente invencion el termino sujeto se refiere a se refiere a todos los animales clasificados como mamlferos e incluye pero no se limita a animales de granja y domesticos, primates y humanos, por ejemplo seres humanos, primates no humanos, vacas, caballos, cerdos, ovejas, cabras, perros, gatos o roedores. Preferiblemente, el sujeto es un ser humano hombre o mujer de cualquier edad o raza. A lo largo de la description y las reivindicaciones la palabra "comprende" y sus variantes no pretenden excluir otras caracterlsticas tecnicas, aditivos, componentes o pasos. Para los expertos en la materia, otros objetos, ventajas y caracterlsticas de la invencion se desprenderan en parte de la descripcion y en parte de la practica de la invencion. Los siguientes ejemplos y figuras se proporcionan a modo de ilustracion, y no se pretende que sean limitativos de la presente invencion.For the purposes of the present invention the term "subject" refers to refers to all animals classified as mammals and includes but is not limited to farm and domestic animals, primates and humans, for example humans, nonhuman primates, cows, horses , pigs, sheep, goats, dogs, cats or rodents. Preferably, the subject is a human being male or female of any age or race. Throughout the description and the claims the word "comprises" and its variants are not intended to exclude other technical characteristics, additives, components or steps. For those skilled in the art, other objects, advantages and characteristics of the invention will be derived partly from the description and partly from the practice of the invention. The following examples and figures are provided by way of illustration, and are not intended to be limiting of the present invention.
BREVE DESCRIPCION DE LAS FIGURASBRIEF DESCRIPTION OF THE FIGURES
La Figura 1 (A) ilustra el efecto de la concentration de cobre sobre los niveles de hidrolisis del O-hexil,O-2,5 diclorofenilfosforamidato (HDCP) en el suero de pollo y su comparacion en presencia de (B) calcio, EDTA y Tris.Figure 1 (A) illustrates the effect of copper concentration on the hydrolysis levels of O-hexyl, O-2.5 dichlorophenylphosphoramidate (HDCP) in chicken serum and its comparison in the presence of (B) calcium, EDTA and Tris.
La Figura 2 muestra los niveles de hidrolisis de cada uno de los dos isomeros de HDCP por efecto de su incubation con suero (S) de pollo (10 pL) y su respectiva concentracion de albumina (A) (216 pg) en presencia de cobre o EDTA durante 60 y 120 minutos en condiciones fisiologicas de pH y temperatura.Figure 2 shows the hydrolysis levels of each of the two HDCP isomers due to their incubation with chicken serum (S) (10 pL) and their respective concentration of albumin (A) (216 pg) in the presence of copper or EDTA for 60 and 120 minutes under physiological conditions of pH and temperature.
La Figura 3 muestra el efecto activador del cobre (Cu2+) sobre la hidrolisis del isomero R-HDCP por la albumina del suero de pollo y la hidrolisis de los dos isomeros de la albumina de suero de pavo.Figure 3 shows the activating effect of copper (Cu2 +) on the hydrolysis of the R-HDCP isomer by the albumine of chicken serum and the hydrolysis of the two isomers of turkey serum albumine.
La Figura 4 muestra la capacidad de hidrolisis de diferentes especies de albuminas de vertebrados (excluyendo aves) sobre el compuesto HDCP y efecto de diferentes concentraciones de cobre (Cu2+). Cada punto representa el promedio ± SD de tres experimentos realizados con 216 pg de albumina de oveja (OSA), de perro (DSA), de cerdo (PSA) o de lamprea (LSA) incubada con HDCP racemico 400 pM (200 pM de cada isomero) y diferentes concentraciones de cobre durante 60 min a 37°C y pH 7.4. La Figura 5 muestra el efecto de diferentes cationes sobre la hidrolisis de ambos isomeros de HDCP de la albumina de suero de pavo.Figure 4 shows the hydrolysis capacity of different vertebrate albumine species (excluding birds) on the HDCP compound and the effect of different concentrations of copper (Cu2 +). Each point represents the mean ± SD of three experiments performed with 216 pg of sheep albumine (OSA), dog (DSA), pig (PSA) or lamprey (LSA) incubated with 400 pM racemic HDCP (200 pM of each isomer) and different concentrations of copper for 60 min at 37 ° C and pH 7.4. Figure 5 shows the effect of different cations on the hydrolysis of both HDCP isomers of turkey serum albumin.
55
1010
15fifteen
20twenty
2525
3030
3535
La Figura 6 muestra el efecto de cobre sobre la hidrolisis de ambos isomeros de tricloronato por la albumina de suero de pavo.Figure 6 shows the effect of copper on the hydrolysis of both trichloronate isomers by turkey serum albumin.
La Figura 7 ilustra el efecto del pH sobre la hidrolisis de ambos isomeros de HDCP en presencia de EDTA (A) y Cu2+ (B) por la albumina de suero de pollo.Figure 7 illustrates the effect of pH on the hydrolysis of both HDCP isomers in the presence of EDTA (A) and Cu2 + (B) by chicken serum albumin.
La Figura 8 muestra el efecto del tiempo de pre-incubacion con Zn2+ y Cu2+ sobre la hidrolisis de los isomeros de HDCP de las albuminas del suero de pollo y de pavo.Figure 8 shows the effect of pre-incubation time with Zn2 + and Cu2 + on the hydrolysis of HDCP isomers of chicken and turkey serum albumines.
La Figura 9 ilustra el efecto de la pre-incubacion de Ni2+ sobre la hidrolisis de isomeros de HDCP de las albuminas de pollo y pavo en presencia de cobre (100 pM) e incubados a 37°C, pH 7.4 durante 60 minutos.Figure 9 illustrates the effect of Ni2 + pre-incubation on the hydrolysis of HDCP isomers of chicken and turkey albumines in the presence of copper (100 pM) and incubated at 37 ° C, pH 7.4 for 60 minutes.
EJEMPLOSEXAMPLES
A continuation, se ilustrara la invention mediante unos ensayos realizados por los inventores, que ponen de manifiesto la efectividad y utilidad del producto y metodos de la invencion. Estos ejemplos se incluyen solamente con fines ilustrativos y no han de ser interpretados como limitaciones a la invencion que aqul se reivindica. Por tanto, los ejemplos descritos mas adelante ilustran la invencion sin limitar el campo de aplicacion de la misma.Next, the invention will be illustrated by tests carried out by the inventors, which show the effectiveness and usefulness of the product and methods of the invention. These examples are included for illustrative purposes only and are not to be construed as limitations to the invention claimed herein. Therefore, the examples described below illustrate the invention without limiting its scope of application.
Materiales y metodos.Materials and methods.
Los compuestos organofosforados utilizados en los ejemplos descritos a continuacion son el HDCP y el tricloronato, en forma racemica, utilizando los isomeros S y R de ambos compuestos. El rango de concentraciones utilizadas para los mismos han sido de 100 pM a 400 pM, siendo preferidas concentraciones de 400 pM, equivalente a 200 pM para cada isomero.The organophosphorus compounds used in the examples described below are HDCP and trichloronate, in racemic form, using the S and R isomers of both compounds. The range of concentrations used for them has been from 100 pM to 400 pM, with concentrations of 400 pM being preferred, equivalent to 200 pM for each isomer.
Las enzimas utilizadas han sido la albumina de pollo o pavo, presentes en el suero de pollo (CSA) (10 pL) o pavo (TSA) (10 pL) respectivamente, asl como las albuminas comerciales (Sigma Aldrich) procedentes de diferentes especies, tales como peces, preferentemente lamprea (LSA), mamlferos, tales como oveja (OSA), perro (DSA) y cerdo (PSA), y aves tales como pollo o pavo, a una concentration de 216 pg disueltos en 100 pL de tampon Tris 10 mM, pH 7.4. Por otro lado, el volumen de tampon Tris 10 mM empleado en la reaction fue el necesario para completar 1 mL de reaction enzimatica para todos los casos.The enzymes used have been chicken or turkey albumine, present in chicken serum (CSA) (10 pL) or turkey (TSA) (10 pL) respectively, as well as commercial albumines (Sigma Aldrich) from different species, such as fish, preferably lamprey (LSA), mammals, such as sheep (OSA), dog (DSA) and pig (PSA), and birds such as chicken or turkey, at a concentration of 216 pg dissolved in 100 pL of Tris buffer 10 mM, pH 7.4. On the other hand, the volume of 10 mM Tris buffer used in the reaction was that necessary to complete 1 mL of enzymatic reaction for all cases.
55
1010
15fifteen
20twenty
2525
3030
3535
Los cofactores metalicos divalentes utilizados han sido, Cu2+, Zn2+ o Ca2+, entre otros, en forma de sales metalicas tales como por ejemplo, sulfato de cobre (1-500 qM), sulfato de calcio (2.5 mM) o sulfato de zinc (1-500 qM). Adicionalmente se ha utilizado como quelante EDTA 5 mM. Con el proposito de obtener en el volumen de reaccion final de 1 mL a un rango de concentraciones que varle de 1 nM hasta 2.5 mM, se emplearon volumenes desde 0.2 qL hasta 250 qL de soluciones 10 mM de las sales metalicas mencionadas anteriormente, y 250 qL de EDTA 20 mM, para obtener concentraciones de 5 mM en cada caso.The divalent metal cofactors used have been, Cu2 +, Zn2 + or Ca2 +, among others, in the form of metal salts such as, for example, copper sulfate (1-500 qM), calcium sulfate (2.5 mM) or zinc sulfate (1 -500 qM). Additionally, 5 mM EDTA chelator has been used. With the purpose of obtaining in the final reaction volume of 1 mL at a range of concentrations ranging from 1 nM to 2.5 mM, volumes from 0.2 qL to 250 qL of 10 mM solutions of the metal salts mentioned above were used, and 250 qL of 20 mM EDTA, to obtain concentrations of 5 mM in each case.
La reaccion de hidrolisis de los compuestos organofosforados HDCP y tricloronato analizados se paro con una solucion especlfica en funcion del analisis posterior que se lleva a cabo para la determination de la concentration de los compuestos liberados en dicha reaccion de hidrolisis, 1,2 diclorofenol (DCP) o triclorofenol (TCP) respectivamente.The hydrolysis reaction of the organophosphorus compounds HDCP and trichloronate analyzed was stopped with a specific solution based on the subsequent analysis that is carried out for the determination of the concentration of the compounds released in said hydrolysis reaction, 1,2 dichlorophenol (DCP ) or trichlorophenol (TCP) respectively.
Para el analisis de la concentracion de los compuestos DCP o TCP liberados mediante metodos colorimetricos, se para la reaccion con la adicion de 750 qL de una solucion que comprende 2% de SDS/0.25 mg de aminoantipirina/mL en tampon Tris 50 mM/EDTA 1 mM pH 8. Posteriormente se anadieron 375 qL de ferricianuro potasico al 0.4% utilizado como quelante y para la formation de color. Dicha formation de color fue analizado mediante un espectrofotometro UV/VIS midiendo la absorbancia a una longitud de onda de 510 nm. Los valores de absorbancia de cada compuesto organofosforado analizado se corrigio utilizando los valores de las absorbancias medidos para los controles de hidrolisis espontanea (en ausencia de suero o protelna) y para el blanco colorimetrico del suero. La cantidad de DCP o TCP respectivamente liberada, se determino por comparacion con su respectiva curva de calibrado. Los resultados se expresan en qmoles de DCP/minuto/mL de suero o qg de albumina, o TCP/minuto/mL de suero o qg de albumina.For the analysis of the concentration of the DCP or TCP compounds released by colorimetric methods, the reaction is stopped with the addition of 750 qL of a solution comprising 2% SDS / 0.25 mg of aminoantipyrine / mL in 50 mM Tris buffer / EDTA 1 mM pH 8. Subsequently, 375 qL of 0.4% potassium ferricyanide used as a chelator and for color formation were added. Said color formation was analyzed by a UV / VIS spectrophotometer measuring the absorbance at a wavelength of 510 nm. The absorbance values of each organophosphorus compound analyzed were corrected using the absorbance values measured for spontaneous hydrolysis controls (in the absence of serum or protein) and for the serum colorimetric blank. The amount of DCP or TCP respectively released, was determined by comparison with their respective calibration curve. The results are expressed in qmoles of DCP / minute / mL of serum or qg of albumin, or TCP / minute / mL of serum or qg of albumin.
Para el analisis cromatografico de los isomeros S y/o R de cada compuesto organosfosforado, y de los compuestos DCP o TCP obtenidos tras la reaccion de hidrolisis de los mismos, la reaccion se para la reaccion con la adicion de 40 qL de una solucion 0.2 M de HCl, que ademas de parar la reaccion propicia un medio acido optimo para la extraction de los isomeros R y S de los compuestos organofosforados HDCP y tricloronato. Posteriormente, se anaden 2 mL de 1,2-dicloroetano o heptano para cuantificar la cantidad residual de cada isomero de cada compuestoFor the chromatographic analysis of the S and / or R isomers of each organosphosphorus compound, and of the DCP or TCP compounds obtained after their hydrolysis reaction, the reaction is stopped with the addition of 40 qL of a 0.2 solution M of HCl, which in addition to stopping the reaction, provides an optimal acidic medium for the extraction of the R and S isomers of the organophosphorus compounds HDCP and trichloronate. Subsequently, 2 mL of 1,2-dichloroethane or heptane are added to quantify the residual amount of each isomer of each compound
55
1010
15fifteen
20twenty
2525
3030
3535
organofosforado testado, HDCP o tricloronato, respectivamente. Dicha mezcla se mantiene en agitation durante 45 minutos y se centrifugo en frlo a 1000 x g durante 15 minutos. De la capa inferior (fase organica - 1,2-dicloroetano) se retiro con una microjeringa 1 mL y se depositaron 25 pL de cada muestra en los viales del automuestreador del sistema de cromatografla de llquidos de alta resolution con detector Ev/VIS y columnas quirales, OA-4100, (HPLC Technology Ltd) y CHIRALCEL-OD (Daicel Chem. Ind., LTD).ico HPLC. Las condiciones cromatograficas utilizadas han sido:Tested organophosphate, HDCP or trichloronate, respectively. Said mixture is kept under stirring for 45 minutes and centrifuged in the cold at 1000 x g for 15 minutes. From the lower layer (organic phase - 1,2-dichloroethane), it was removed with a 1 mL micro-syringe and 25 pL of each sample was deposited in the autosampler vials of the high resolution liquid chromatography system with Ev / VIS detector and columns chiral, OA-4100, (HPLC Technology Ltd) and CHIRALCEL-OD (Daicel Chem. Ind., LTD) .ico HPLC. The chromatographic conditions used have been:
a) Fase movil: hexano/1,2-dicloroetano/etanol 92:5:3 (v/v/v) a un flujo de 1.5 mL/min para el caso de HDCP y heptano 1 mL/min para el caso de tricloronato.a) Mobile phase: hexane / 1,2-dichloroethane / ethanol 92: 5: 3 (v / v / v) at a flow of 1.5 mL / min in the case of HDCP and heptane 1 mL / min in the case of trichloronate .
b) Detection: detector UV/VIS a X 230 nm.b) Detection: UV / VIS detector at X 230 nm.
c) Columna: quiral Techocel OA-4100, 25 cm x 4.6 mm para el caso de HDCP y Daicel OD 25 cm x 4.6 mm para el caso de tricloronato.c) Column: Techocel OA-4100 chiral, 25 cm x 4.6 mm for the case of HDCP and Daicel OD 25 cm x 4.6 mm for the case of trichloronate.
Con estas condiciones, los volumenes de eluciones fueron de: 1=9-10 min y 2=10.5- 11.5 minutos para los isomeros R-HDCP y S-HDCP y 7-8.2 y de 8.3-9 min para los isomeros R-tricloronato y S-tricloronato. La cuantificacion de los picos cromatograficos se realizo con el valor de area correspondiente de cada estereoisomero. Los resultados se expresan en concentration pM de isomeros R o S residuales para cada tiempo establecido en los diferentes ensayos.Under these conditions, the elution volumes were: 1 = 9-10 min and 2 = 10.5-11.5 minutes for the R-HDCP and S-HDCP isomers and 7-8.2 and 8.3-9 min for the R-trichloronate isomers and S-trichloronate. The quantification of the chromatographic peaks was performed with the corresponding area value of each stereoisomer. The results are expressed in pM concentration of residual R or S isomers for each time established in the different tests.
Todos los ensayos se realizaron a una temperatura de 37°C durante diferentes tiempos dependiendo del ensayo.All tests were performed at a temperature of 37 ° C for different times depending on the test.
Ejemplo 1. Hidrolisis de compuestos organofosforados mediante el tratamiento con albuminas presentes en suero de pollo (CSA) o de pavo (TSA) en presencia de cationes divalentes (Cu2+ y Zn2+).Example 1. Hydrolysis of organophosphorus compounds by treatment with albumines present in chicken serum (CSA) or turkey (TSA) in the presence of divalent cations (Cu2 + and Zn2 +).
Para demostrar la capacidad hidrolltica sobre compuestos organofosforados (HDCP o tricloronato) de las albuminas de aves, preferentemente de las albumina de pollo y/o de pavo, se contactaron mezclas racemicas de dichos compuestos organofosforados, HDCP o tricloronato, con suero de pollo (CSA) o de pavo (TSA), que comprendlan sus correspondientes albuminas, en presencia o no, de cationes metalicos divalentes.To demonstrate the hydrolytic capacity on organophosphorus compounds (HDCP or trichloronate) of bird albines, preferably of chicken and / or turkey albumin, racemic mixtures of said organophosphorus compounds, HDCP or trichloronate were contacted with chicken serum (CSA ) or turkey (TSA), comprising their corresponding albumines, in the presence or not, of divalent metal cations.
Brevemente, en un tubo de ensayo se deposita una disolucion que contiene 216 pg de albumina de suero de pavo (TSA) o de pollo (CSA) disueltos en 100 pL de Tris 10 mM,Briefly, a solution containing 216 pg of turkey serum albumin (TSA) or chicken (CSA) dissolved in 100 pL of 10 mM Tris is deposited in a test tube,
55
1010
15fifteen
20twenty
2525
3030
3535
a los cuales se les anaden 100 pL de una solucion estandar 4 mM del compuesto organofosforado HDCP o tricloronato, y 250 pL de una sal metalica, en este caso particular se utiliza sulfato de cobre de una solucion estandar 10 mM. A continuation, se anaden 550 pL de Tris 10 mM, pH 7.4, para ajustar el volumen de la reaction a 1 mL en el tubo de ensayo. La reaccion se incuba a 37 °C durante un tiempo que varla de 60 a 120 minutos. Transcurrido dicho tiempo, se para la reaccion y los productos obtenidos de la reaccion de hidrolisis, asl como los isomeros R y S residuales se analizan mediante metodos colorimetricos y/o cromatograficos, segun se ha descrito previamente en el apartado de materiales y metodos.to which 100 pL of a standard 4 mM solution of the organophosphorus compound HDCP or trichloronate are added, and 250 pL of a metal salt, in this particular case copper sulphate of a 10 mM standard solution is used. Next, 550 pL of 10 mM Tris, pH 7.4, are added to adjust the volume of the reaction to 1 mL in the test tube. The reaction is incubated at 37 ° C for a time ranging from 60 to 120 minutes. After this time, the reaction is stopped and the products obtained from the hydrolysis reaction, as well as the residual R and S isomers are analyzed by colorimetric and / or chromatographic methods, as previously described in the materials and methods section.
Para el analisis del producto de hidrolisis formado (DCP o TCP) mediante tecnicas colorimetricas tal y como se ha descrito previamente, la reaccion se para con la adicion de 750 pL de 2% de SDS/0.25 mg de aminoantipirina/mL de Tris 50 mM/EDTA 1 mM pH 8 y 375 pL de ferricianuro potasico al 0.4%. Se deja reposar la mezcla durante aproximadamente 15 minutos y posteriormente se cuantifica la intensidad de color (absorbancia) mediante espectrofotometrla a 510 nm en el espectrofotometro UV/VIS. Los valores de absorbancia de los grupos experimentales se corrigieron como se ha mencionado anteriormente. La cantidad de residual de isomeros de ambos compuestos organofosforados se determino con una curva de calibrado de concentraciones 0, 100, 200 y 300 pM para cada isomero del compuesto organofosforado testado.For the analysis of the hydrolysis product formed (DCP or TCP) using colorimetric techniques as previously described, the reaction is stopped with the addition of 750 pL of 2% SDS / 0.25 mg aminoantipyrine / mL of 50 mM Tris / 1 mM EDTA pH 8 and 375 pL of 0.4% potassium ferricyanide. The mixture is allowed to stand for approximately 15 minutes and subsequently the color intensity (absorbance) is quantified by 510 nm spectrophotometer in the UV / VIS spectrophotometer. The absorbance values of the experimental groups were corrected as mentioned above. The amount of isomeric residuals of both organophosphorus compounds was determined with a calibration curve of concentrations 0, 100, 200 and 300 pM for each isomer of the organophosphorus compound tested.
Como se pone de manifiesto en la Figura 1A, para el caso particular del HDCP, el suero de pollo (CSA) es capaz de hidrolizar el compuesto organofosforado HDCP dando lugar a compuesto DCP, en presencia de concentraciones de 10 hasta 300 pM de Cu2+, alrededor de 20 veces mas con respecto a la hidrolisis de este mismo compuesto cuando se pone en contacto con suero de pollo (CSA) en presencia de calcio (2.5 mM), EDTA (5 mM) o Tris en condiciones fisiologicas de pH y temperatura durante 60 o 120 minutos de incubation (Figura 1B).As shown in Figure 1A, for the particular case of HDCP, chicken serum (CSA) is capable of hydrolyzing the organophosphorus HDCP compound giving rise to DCP compound, in the presence of concentrations of 10 to 300 pM Cu2 +, about 20 times more with respect to the hydrolysis of this same compound when it comes into contact with chicken serum (CSA) in the presence of calcium (2.5 mM), EDTA (5 mM) or Tris under physiological conditions of pH and temperature during 60 or 120 minutes of incubation (Figure 1B).
Para el analisis por metodos cromatograficos de los isomeros y del producto de hidrolisis obtenido tras la reaccion de hidrolisis del HDCP, se sigue el protocolo descrito anteriormente en el apartado de Materiales y Metodos. Brevemente, la reaccion se para con la adicion de 40 pL de una solucion 0.2 M de HCl (propicia un medio acido optimo para la extraction de los isomeros de los compuestos organofosforados) y se anaden 2 mL de 1,2-diclorometano para el caso de HDCP oFor the analysis by chromatographic methods of the isomers and of the hydrolysis product obtained after the hydrolysis reaction of the HDCP, the protocol described above in the Materials and Methods section is followed. Briefly, the reaction is stopped with the addition of 40 pL of a 0.2 M solution of HCl (provides an optimal acidic medium for the extraction of the isomers of the organophosphorus compounds) and 2 mL of 1,2-dichloromethane are added for that matter. of HDCP or
55
1010
15fifteen
20twenty
2525
3030
3535
heptano para el caso de tricloronato. Posteriormente la mezcla se agita durante 45 minutos y se centrifugo a 1000 x g durante 15 minutos en una centrifuga refrigerada a 4 °C. De la fase organica (1,2-dicloroetano) se retira 1 mL y se depositan 20 pL en los viales del automuestreador del HPLC que presenta las condiciones descritas anteriormente y se procede al analisis de la concentration de los isomeros R o S, as! como del producto resultante de la hidrolisis, DCP, en el caso concreto del compuesto HDCP.heptane in the case of trichloronate. The mixture is then stirred for 45 minutes and centrifuged at 1000 x g for 15 minutes in a refrigerated centrifuge at 4 ° C. From the organic phase (1,2-dichloroethane) 1 mL is removed and 20 pL are deposited in the HPLC autosampler vials that have the conditions described above and the concentration of the R or S isomers is analyzed, as! as of the product resulting from the hydrolysis, DCP, in the specific case of the HDCP compound.
Tal y como se observa en las Figuras 2 y 3, la hidrolisis de cada uno de los isomeros R y S del compuesto HDCP en presencia de CSA (10 pL) o albumina de pollo (210 pg), es dependiente de Cu2+ (100 pM de sulfato de cobre), ya que en presencia de EDTA 5 mM se inhibe la hidrolisis de HDCP en los tiempos analizados, 60 y 120 minutos (Figura 2). Por otro lado, la Figura 2 muestra que la albumina de pollo en presencia de cobre es capaz de hidrolizar el isomero R-HDCP en mayor medida que el S-HDCP, demostrando su estereoselectividad para el isomero R, respecto al S.As seen in Figures 2 and 3, the hydrolysis of each of the R and S isomers of the HDCP compound in the presence of CSA (10 pL) or chicken albumin (210 pg), is dependent on Cu2 + (100 pM of copper sulphate), since in the presence of 5 mM EDTA the hydrolysis of HDCP is inhibited in the analyzed times, 60 and 120 minutes (Figure 2). On the other hand, Figure 2 shows that chicken albumin in the presence of copper is capable of hydrolyzing the R-HDCP isomer to a greater extent than the S-HDCP, demonstrating its stereoselectivity for the R isomer, relative to S.
Para demostrar si el suero de pavo o la albumina de pavo es a su vez estereoselectivo(a) para el isomero R respecto al S del compuesto HDCP, al igual que sucede con el suero y con la albumina de pollo, se comparo la capacidad hidrolltica del suero de pollo (CSA) frente al suero de pavo (TSA) en una reaction de hidrolisis para HDCP en presencia de cobre. Como se muestra en la Figura 3, la capacidad hidrolltica del suero de pavo (TSA) fue mayor, alrededor del doble, que la capacidad hidrolltica de la albumina presente en el suero de pollo (CSA), ya que la albumina de suero de pavo (TSA) hidrolizo los dos isomeros de HDCP a la misma velocidad, es decir, no es estereoselectiva (Figura 3), mientras que la de pollo, como hemos comentado anteriormente, si es estereoselectiva para el isomero R-HDCP (Figura 3).To demonstrate whether turkey serum or turkey albumin is in turn stereoselective (a) for the R isomer with respect to the S of the HDCP compound, as with serum and chicken albumin, the hydrolytic capacity was compared of chicken serum (CSA) versus turkey serum (TSA) in a hydrolysis reaction for HDCP in the presence of copper. As shown in Figure 3, the hydrolytic capacity of turkey serum (TSA) was greater, about double, than the hydrolytic capacity of albumin present in chicken serum (CSA), since turkey serum albumin (TSA) hydrolyzed the two isomers of HDCP at the same rate, that is, it is not stereoselective (Figure 3), while chicken, as we have said before, if it is stereoselective for the R-HDCP isomer (Figure 3).
Para demostrar que la capacidad hidrolltica de compuestos organofosforados por parte de las albuminas de pollo y pavo, en presencia de cationes metalicos, reside en la region N-terminal, especlficamente en aquellas albuminas que comprenden en dicha region la SEQ ID NO: 1, y mas especlficamente la SEQ ID NO: 2, se testaron diferentes albuminas de diferentes especies en presencia de cobre como cation metalico, para poner de manifiesto que aquellas albuminas que no presentan en su region N-terminal las secuencias SEQ ID NO: 1, o mas especlficamente la SEQ ID NO: 2, no muestran actividad hidrolltica de dichos compuestos organofosforados. Las albuminas testadas fueron las albuminas de mamlfero presentes en el suero de ovejaTo demonstrate that the hydrolytic capacity of organophosphorus compounds by chicken and turkey albumines, in the presence of metal cations, resides in the N-terminal region, specifically in those albumines that comprise SEQ ID NO: 1, and more specifically, SEQ ID NO: 2, different albumins of different species were tested in the presence of copper as a metal cation, to show that those albumines that do not have the SEQ ID NO: 1 sequences in their N-terminal region, or more specifically SEQ ID NO: 2, do not show hydrolytic activity of said organophosphorus compounds. The albumins tested were the mammalian albumines present in the sheep serum
55
1010
15fifteen
20twenty
2525
3030
3535
(OSA), perro (DSA) y cerdo (PSA), o albuminas de peces tales como la lamprea (LSA). Estas albuminas fueron obtenidas comercialmente de Sigma Aldrich (Espana).(OSA), dog (DSA) and pig (PSA), or fish albumines such as lamprey (LSA). These albumines were obtained commercially from Sigma Aldrich (Spain).
Tal y como se muestra en la Figura 4, las albuminas presentes en los sueros OSA, DSA, PSA o LSA presentan una escasa capacidad de hidrolisis del compuesto HDCP. En cambio, tal y como se ha demostrado en la Figura 3 la capacidad de hidrolisis de HDCP por parte de las albuminas presentes tanto en el suero de pavo (TSA) como en el de pollo (CSA) es muy alta, especlficamente para el caso de la albumina de pavo que presenta una alta actividad hidrolltica para ambos isomeros del compuesto HDCP, mientras que la albumina presente en el suero de pollo (CSA), muestra una alta capacidad hidrolltica estereoselectiva para el isomero R-HDCP.As shown in Figure 4, the albumines present in the OSA, DSA, PSA or LSA sera have a low capacity for hydrolysis of the HDCP compound. On the other hand, as shown in Figure 3, the capacity of HDCP hydrolysis by albumin present in both turkey serum (TSA) and chicken serum (CSA) is very high, specifically for the case of turkey albumin that has a high hydrolytic activity for both isomers of the HDCP compound, while the albumin present in chicken serum (CSA), shows a high stereoselective hydrolytic capacity for the R-HDCP isomer.
Adicionalmente, tambien se llevo a cabo un experimento para demostrar cuales eran los cationes divalentes que activaban en mayor medida la capacidad hidrolltica frente a compuestos organofosforados de las albuminas testadas. Para ello se incubo la albumina de pavo junto con HDCP y en presencia de diferentes cationes divalentes (zinc, hierro, calcio, manganeso, magnesio, nlquel, cobalto y cobre), a la concentration de 100 pM para cada uno de ellos y se analizo la concentration de cada isomero del HDCP. Como se muestra en la Figura 5, el cobre y el zinc fueron los dos unicos cationes metalicos que activaron la hidrolisis de HDCP por la albumina de pavo. Especlficamente, la mayor capacidad hidrolltica de la albumina frente al HDCP se llevo a cabo en presencia de cobre.Additionally, an experiment was also carried out to demonstrate which were the divalent cations that most activated the hydrolytic capacity against organophosphorus compounds of the albumin tested. For this, turkey albumine was incubated together with HDCP and in the presence of different divalent cations (zinc, iron, calcium, manganese, magnesium, nickel, cobalt and copper), at the concentration of 100 pM for each of them and analyzed the concentration of each isomer of the HDCP. As shown in Figure 5, copper and zinc were the only two metal cations that activated the hydrolysis of HDCP by turkey albumin. Specifically, the greater hydrolytic capacity of albumin compared to HDCP was carried out in the presence of copper.
De la misma manera que se analizo la capacidad hidrolltica de las albuminas de pavo y pollo para el compuesto organofosforado HDCP, se testo dicha capacidad para el insecticida comercial organofosforado tricloronato. Los resultados ponen de manifiesto que la albumina de pavo presenta actividad catalltica para tricloronato que es ligeramente estereoselectiva a favor del isomero S-tricloronato (en su forma "tio”) (Figura 6), a diferencia de la capacidad hidrolltica para el HDCP que no presento dicha estereoselectividad (Figura 3).In the same way that the hydrolytic capacity of turkey and chicken albumines for the organophosphorus compound HDCP was analyzed, this capacity was tested for the commercial organophosphorus trichloronate insecticide. The results show that turkey albumin has catallotic activity for trichloronate that is slightly stereoselective in favor of the S-trichloronate isomer (in its "uncle" form) (Figure 6), unlike the hydrolytic capacity for HDCP that does not I present this stereoselectivity (Figure 3).
Posteriormente se analizo si el pH podrla influir en capacidad hidrolltica de compuestos organofosforados por parte de las albuminas de ave, especlficamente de las albuminas de pollo y/o pavo, en presencia de cationes metalicos. Para ello, se incubo la albumina presente en el suero de pollo en presencia de 100 pM de Zn2+ o Cu2+ a diferentes pHs dentro del rango de pH 4 a pH 10. Como se observa en laSubsequently, it was analyzed if the pH could influence the hydrolytic capacity of organophosphorus compounds by poultry albines, specifically chicken and / or turkey albumin, in the presence of metal cations. For this, the albumin present in the chicken serum was incubated in the presence of 100 pM of Zn2 + or Cu2 + at different pHs within the range of pH 4 to pH 10. As observed in the
55
1010
15fifteen
20twenty
2525
3030
Figura 7, la capacidad catalltica del compuesto HDCP por parte de dicha albumina se redujo cuando el pH del medio era mayor de 7 y quedo completamente inhibida a pH mayor de 9. Por otro lado, tambien se analizo si la actividad catalltica de la albumina de pollo o pavo, en presencia de cationes divalentes se vela afectada cuando se preincubaban dichas protelnas a diferentes tiempos (0, 15 y 30 minutos) en presencia de cationes metalicos (100 pM de Zn2+ o Cu2+). Los resultados mostrados en la Figura 8 demuestran que la preincubacion de las albuminas de ave en presencia de Zn2+ o Cu2+ y posterior incubacion con Cu2+, hacen que particularmente para el caso de la preincubacion con Zn2+, la albumina de pollo pierda su capacidad estereoselectiva de hidrolisis sobre el isomero R-HDCP, mientras que la albumina de pavo disminuye su capacidad hidrolltica para ambos isomeros del compuesto HDCP. En cambio, la preincubacion con Ni2+, en las mismas condiciones de concentraciones y tiempos de incubacion que para el Zn2+, no fue capaz de inhibir o afectar la hidrolisis de HDCP caracterlstica de las dos albuminas en presencia de cobre (Figura 9).Figure 7, the catalytic capacity of the HDCP compound by said albumine was reduced when the pH of the medium was greater than 7 and was completely inhibited at pH greater than 9. On the other hand, it was also analyzed whether the catalytic activity of the albumine of chicken or turkey, in the presence of divalent cations is affected when these proteins were pre-incubated at different times (0, 15 and 30 minutes) in the presence of metal cations (100 pM of Zn2 + or Cu2 +). The results shown in Figure 8 demonstrate that the pre-incubation of the bird albumin in the presence of Zn2 + or Cu2 + and subsequent incubation with Cu2 +, makes that particularly for the case of preincubation with Zn2 +, the chicken albumin loses its stereoselective hydrolysis capacity on the R-HDCP isomer, while turkey albumin decreases its hydrolytic capacity for both isomers of the HDCP compound. In contrast, preincubation with Ni2 +, under the same conditions of concentrations and incubation times as for Zn2 +, was not able to inhibit or affect the HDCP hydrolysis characteristic of the two albumin in the presence of copper (Figure 9).
En estudios posteriores se incubaron las albuminas de pavo o de pollo en presencia de cobre y HDCP y compuestos que reaccionan con aminoacidos especlficos. Dichos compuestos han sido, N,N'-diciclohexilcarbodiimida que reacciona con los aminoacidos aspartico y glutamico, diisopropilffuorofosfato y paraoxon que reaccionan con serina y tirosina, N-etilmaleimida (N-NEM), p-nitrofenol y 5,5'-dithiobis-2- nitrobenzoic acid (DTNB) que reaccionan con los grupos -SH de cistelna, y otros. La presencia de estos compuestos no altero la propiedad de dichas protelnas para hidrolizar HDCP en presencia de cobre, lo que confirma que en el sitio donde ocurre esta catalisis no estan implicados estos aminoacidos. Mediante este ensayo se demuestra que la propiedad catalltica de compuestos organofosforados por parte de las albuminas de pollo o pavo, involucra a la region N-terminal de las mismas.In subsequent studies, turkey or chicken albumines were incubated in the presence of copper and HDCP and compounds that react with specific amino acids. Such compounds have been, N, N'-dicyclohexylcarbodiimide that reacts with the aspartic and glutamic amino acids, diisopropyl phosphorus phosphate and paraoxon that react with serine and tyrosine, N-ethylmaleimide (N-NEM), p-nitrophenol and 5,5'-dithiobis- 2- nitrobenzoic acid (DTNB) that react with the -SH groups of cystel, and others. The presence of these compounds does not alter the property of said proteins to hydrolyze HDCP in the presence of copper, confirming that these amino acids are not involved at the site where this catalysis occurs. This test demonstrates that the catalytic property of organophosphorus compounds by chicken or turkey albumines involves their N-terminal region.
En conclusion, la actividad catalltica particular de romper compuestos esteres organofosforados (actividad fosfotriesterasa) de las albuminas de pollo y pavo es debido a la alta afinidad que presentan frente a los cationes cobre y zinc en su secuencia N-terminal DAEHK (SEQ ID NO: 2).In conclusion, the particular catalytic activity of breaking organophosphorus ester compounds (phosphotriesterase activity) of chicken and turkey albumines is due to the high affinity that copper and zinc cations have in their N-terminal DAEHK sequence (SEQ ID NO: 2).
Claims (25)
Priority Applications (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
ES201630997A ES2651192B2 (en) | 2016-07-21 | 2016-07-21 | ALBUMS AND PEPTIDES ABLE TO HYDROLYZE ORGANOPHOSPHORATED COMPOUNDS AND CARBAMATES, AND USES OF THE SAME |
PCT/ES2017/070522 WO2018015602A1 (en) | 2016-07-21 | 2017-07-19 | Albumins and peptides capable of hydrolysing organophosphorus compounds and carbamates and uses thereof |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
ES201630997A ES2651192B2 (en) | 2016-07-21 | 2016-07-21 | ALBUMS AND PEPTIDES ABLE TO HYDROLYZE ORGANOPHOSPHORATED COMPOUNDS AND CARBAMATES, AND USES OF THE SAME |
Publications (2)
Publication Number | Publication Date |
---|---|
ES2651192A1 ES2651192A1 (en) | 2018-01-24 |
ES2651192B2 true ES2651192B2 (en) | 2018-08-02 |
Family
ID=59416705
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
ES201630997A Active ES2651192B2 (en) | 2016-07-21 | 2016-07-21 | ALBUMS AND PEPTIDES ABLE TO HYDROLYZE ORGANOPHOSPHORATED COMPOUNDS AND CARBAMATES, AND USES OF THE SAME |
Country Status (2)
Country | Link |
---|---|
ES (1) | ES2651192B2 (en) |
WO (1) | WO2018015602A1 (en) |
-
2016
- 2016-07-21 ES ES201630997A patent/ES2651192B2/en active Active
-
2017
- 2017-07-19 WO PCT/ES2017/070522 patent/WO2018015602A1/en active Application Filing
Also Published As
Publication number | Publication date |
---|---|
ES2651192A1 (en) | 2018-01-24 |
WO2018015602A1 (en) | 2018-01-25 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
Schulze et al. | Design of acetylcholinesterases for biosensor applications | |
US7132259B1 (en) | Activatable recombinant neurotoxins | |
US9273296B2 (en) | Meganuclease variants cleaving a DNA target sequence from a glutamine synthetase gene and uses thereof | |
JP2612874B2 (en) | Methods of regulating protein metabolic stability | |
ES2595500T3 (en) | New proteases that can hydrolyze gluten peptides and proteins at an acidic pH, from Actinomycete Actinoallomurus | |
CN106986922B (en) | Self-assembled amphiphilic short peptide and application thereof | |
BRPI0616054B1 (en) | PROCESS FOR THE PREPARATION OF INSULIN, AN INSULIN ANALOG OR AN INSULIN DERIVATIVE, PORCINE TRIPSIN, METHOD FOR THEIR PRODUCTION, DNA AND VECTOR | |
CN101583374B (en) | Anti-cocaine compositions and treatment | |
CN104053772A (en) | Mutants of hydantoinase | |
ZA200308913B (en) | Phosphotriesterase from agrobacterium radiobacter p230 | |
Chen et al. | Effective remediation and decontamination of organophosphorus compounds using enzymes: From rational design to potential applications | |
CN103421757B (en) | A kind of Acetylcholine esterase mutant and application thereof | |
ES2651192B2 (en) | ALBUMS AND PEPTIDES ABLE TO HYDROLYZE ORGANOPHOSPHORATED COMPOUNDS AND CARBAMATES, AND USES OF THE SAME | |
Lamego et al. | Carboxylesterase 2 production and characterization in human cells: new insights into enzyme oligomerization and activity | |
CN101412994B (en) | Cleavage of fusion proteins using granzyme b protease | |
Rashamuse et al. | A feruloyl esterase derived from a leachate metagenome library | |
CN109182242A (en) | A kind of recombined bacillus subtilis of heterogenous expression phosphoric triesterase | |
US10982205B2 (en) | Beta-lactamase variants | |
CN102965356B (en) | Preparation method and application of recombinant carboxylesterase D-1CarE5 | |
CN112662643A (en) | Organophosphorus anhydrase, coding gene thereof and application of organophosphorus anhydrase in degradation of organophosphorus pesticides | |
RU2732795C1 (en) | Recombinant fused protein | |
Peña-Montes et al. | Differences in biocatalytic behavior between two variants of StcI esterase from Aspergillus nidulans and its potential use in biocatalysis | |
PL240561B1 (en) | Method for obtaining recombinant, biologically active horse butyrylocholinoesterase and its derivatives and method for obtaining biologically active cholinoesterases and their derivatives in the microorganism Leishmania tarentolae | |
US20190048331A1 (en) | Beta-lactamase variants | |
RU2645458C2 (en) | Method for production of chemically polysialylated recombinant human butyrylcholin esterase |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
FG2A | Definitive protection |
Ref document number: 2651192 Country of ref document: ES Kind code of ref document: B2 Effective date: 20180802 |