ES2319477B1 - PSAP ISOFORMS, ANTIGENIC DETERMINANTS, METHOD OF OBTAINING ANTIBODIES AND USES OF THE SAME. - Google Patents
PSAP ISOFORMS, ANTIGENIC DETERMINANTS, METHOD OF OBTAINING ANTIBODIES AND USES OF THE SAME. Download PDFInfo
- Publication number
- ES2319477B1 ES2319477B1 ES200502840A ES200502840A ES2319477B1 ES 2319477 B1 ES2319477 B1 ES 2319477B1 ES 200502840 A ES200502840 A ES 200502840A ES 200502840 A ES200502840 A ES 200502840A ES 2319477 B1 ES2319477 B1 ES 2319477B1
- Authority
- ES
- Spain
- Prior art keywords
- protein
- baselineskip
- psap
- polypeptide
- seq
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Active
Links
- 102000001708 Protein Isoforms Human genes 0.000 title claims abstract description 17
- 108010029485 Protein Isoforms Proteins 0.000 title claims abstract description 17
- 108010007100 Pulmonary Surfactant-Associated Protein A Proteins 0.000 title claims abstract 8
- 102100027773 Pulmonary surfactant-associated protein A2 Human genes 0.000 title claims abstract 8
- 238000000034 method Methods 0.000 title abstract description 55
- 230000000890 antigenic effect Effects 0.000 title abstract description 9
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 47
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 46
- 229920001184 polypeptide Polymers 0.000 claims description 45
- 239000012634 fragment Substances 0.000 claims description 44
- 108091033319 polynucleotide Proteins 0.000 claims description 33
- 239000002157 polynucleotide Substances 0.000 claims description 33
- 102000040430 polynucleotide Human genes 0.000 claims description 33
- 239000013598 vector Substances 0.000 claims description 20
- 102000037865 fusion proteins Human genes 0.000 claims description 15
- 108020001507 fusion proteins Proteins 0.000 claims description 15
- 230000002163 immunogen Effects 0.000 claims 2
- 108090000623 proteins and genes Proteins 0.000 abstract description 66
- 102000004169 proteins and genes Human genes 0.000 abstract description 65
- 230000000694 effects Effects 0.000 abstract description 32
- 238000001514 detection method Methods 0.000 abstract description 16
- 239000012528 membrane Substances 0.000 abstract description 7
- 239000013543 active substance Substances 0.000 abstract description 2
- 150000001875 compounds Chemical class 0.000 description 28
- 230000014509 gene expression Effects 0.000 description 24
- 210000004027 cell Anatomy 0.000 description 17
- 239000002609 medium Substances 0.000 description 12
- 238000003752 polymerase chain reaction Methods 0.000 description 12
- 241000894006 Bacteria Species 0.000 description 11
- 108020004414 DNA Proteins 0.000 description 11
- 102000005720 Glutathione transferase Human genes 0.000 description 11
- 108010070675 Glutathione transferase Proteins 0.000 description 11
- 238000012360 testing method Methods 0.000 description 11
- 239000011159 matrix material Substances 0.000 description 9
- 239000000243 solution Substances 0.000 description 8
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 7
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 7
- XSQUKJJJFZCRTK-UHFFFAOYSA-N Urea Chemical compound NC(N)=O XSQUKJJJFZCRTK-UHFFFAOYSA-N 0.000 description 7
- 239000004202 carbamide Substances 0.000 description 7
- 238000005119 centrifugation Methods 0.000 description 7
- 230000003993 interaction Effects 0.000 description 7
- 241000283973 Oryctolagus cuniculus Species 0.000 description 6
- 102000012412 Presenilin-1 Human genes 0.000 description 6
- 108010036933 Presenilin-1 Proteins 0.000 description 6
- 150000001413 amino acids Chemical class 0.000 description 6
- 238000003556 assay Methods 0.000 description 6
- 230000004927 fusion Effects 0.000 description 6
- RWSXRVCMGQZWBV-WDSKDSINSA-N glutathione Chemical compound OC(=O)[C@@H](N)CCC(=O)N[C@@H](CS)C(=O)NCC(O)=O RWSXRVCMGQZWBV-WDSKDSINSA-N 0.000 description 6
- 239000006228 supernatant Substances 0.000 description 6
- 108020004635 Complementary DNA Proteins 0.000 description 5
- 238000010804 cDNA synthesis Methods 0.000 description 5
- 238000006243 chemical reaction Methods 0.000 description 5
- 239000002299 complementary DNA Substances 0.000 description 5
- 238000003745 diagnosis Methods 0.000 description 5
- 239000000523 sample Substances 0.000 description 5
- 238000001262 western blot Methods 0.000 description 5
- HRPVXLWXLXDGHG-UHFFFAOYSA-N Acrylamide Chemical compound NC(=O)C=C HRPVXLWXLXDGHG-UHFFFAOYSA-N 0.000 description 4
- 208000024827 Alzheimer disease Diseases 0.000 description 4
- 108010024636 Glutathione Proteins 0.000 description 4
- 241000282414 Homo sapiens Species 0.000 description 4
- 108091028043 Nucleic acid sequence Proteins 0.000 description 4
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 4
- 229960000723 ampicillin Drugs 0.000 description 4
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 4
- 210000004369 blood Anatomy 0.000 description 4
- 239000008280 blood Substances 0.000 description 4
- 239000000872 buffer Substances 0.000 description 4
- 230000002860 competitive effect Effects 0.000 description 4
- 238000011161 development Methods 0.000 description 4
- 230000018109 developmental process Effects 0.000 description 4
- 238000010790 dilution Methods 0.000 description 4
- 239000012895 dilution Substances 0.000 description 4
- 201000010099 disease Diseases 0.000 description 4
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 4
- 238000001378 electrochemiluminescence detection Methods 0.000 description 4
- 238000001962 electrophoresis Methods 0.000 description 4
- 239000000499 gel Substances 0.000 description 4
- 238000009396 hybridization Methods 0.000 description 4
- 238000000338 in vitro Methods 0.000 description 4
- 238000001727 in vivo Methods 0.000 description 4
- 230000001939 inductive effect Effects 0.000 description 4
- 239000006166 lysate Substances 0.000 description 4
- 239000002773 nucleotide Substances 0.000 description 4
- 125000003729 nucleotide group Chemical group 0.000 description 4
- 238000000746 purification Methods 0.000 description 4
- 238000003756 stirring Methods 0.000 description 4
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 3
- 108010058682 Mitochondrial Proteins Proteins 0.000 description 3
- 102000006404 Mitochondrial Proteins Human genes 0.000 description 3
- 206010028980 Neoplasm Diseases 0.000 description 3
- 239000007983 Tris buffer Substances 0.000 description 3
- 239000002253 acid Substances 0.000 description 3
- 239000002671 adjuvant Substances 0.000 description 3
- 230000006907 apoptotic process Effects 0.000 description 3
- 230000001580 bacterial effect Effects 0.000 description 3
- 230000000903 blocking effect Effects 0.000 description 3
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 3
- 238000009510 drug design Methods 0.000 description 3
- 239000000839 emulsion Substances 0.000 description 3
- 238000002474 experimental method Methods 0.000 description 3
- 239000005090 green fluorescent protein Substances 0.000 description 3
- 238000013537 high throughput screening Methods 0.000 description 3
- 230000003053 immunization Effects 0.000 description 3
- 238000002649 immunization Methods 0.000 description 3
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 3
- 238000000670 ligand binding assay Methods 0.000 description 3
- 238000004519 manufacturing process Methods 0.000 description 3
- 239000000463 material Substances 0.000 description 3
- 208000015122 neurodegenerative disease Diseases 0.000 description 3
- 239000000047 product Substances 0.000 description 3
- 239000011347 resin Substances 0.000 description 3
- 229920005989 resin Polymers 0.000 description 3
- 238000010561 standard procedure Methods 0.000 description 3
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 3
- 108010077805 Bacterial Proteins Proteins 0.000 description 2
- 108010035563 Chloramphenicol O-acetyltransferase Proteins 0.000 description 2
- 108020004705 Codon Proteins 0.000 description 2
- 108010014303 DNA-directed DNA polymerase Proteins 0.000 description 2
- 102000016928 DNA-directed DNA polymerase Human genes 0.000 description 2
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 2
- 238000002965 ELISA Methods 0.000 description 2
- 102000004190 Enzymes Human genes 0.000 description 2
- 108090000790 Enzymes Proteins 0.000 description 2
- 241000620209 Escherichia coli DH5[alpha] Species 0.000 description 2
- 108010043121 Green Fluorescent Proteins Proteins 0.000 description 2
- 102000004144 Green Fluorescent Proteins Human genes 0.000 description 2
- 101710154606 Hemagglutinin Proteins 0.000 description 2
- 108060001084 Luciferase Proteins 0.000 description 2
- 239000005089 Luciferase Substances 0.000 description 2
- TWRXJAOTZQYOKJ-UHFFFAOYSA-L Magnesium chloride Chemical compound [Mg+2].[Cl-].[Cl-] TWRXJAOTZQYOKJ-UHFFFAOYSA-L 0.000 description 2
- 102100023198 Mitochondrial carrier homolog 1 Human genes 0.000 description 2
- 101710093908 Outer capsid protein VP4 Proteins 0.000 description 2
- 101710135467 Outer capsid protein sigma-1 Proteins 0.000 description 2
- 102000003992 Peroxidases Human genes 0.000 description 2
- 108010050254 Presenilins Proteins 0.000 description 2
- 102000015499 Presenilins Human genes 0.000 description 2
- 101710176177 Protein A56 Proteins 0.000 description 2
- 229920002684 Sepharose Polymers 0.000 description 2
- 102100036407 Thioredoxin Human genes 0.000 description 2
- 239000000556 agonist Substances 0.000 description 2
- DZHSAHHDTRWUTF-SIQRNXPUSA-N amyloid-beta polypeptide 42 Chemical compound C([C@@H](C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@H](C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(O)=O)[C@@H](C)CC)C(C)C)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)CNC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC(O)=O)C(C)C)C(C)C)C1=CC=CC=C1 DZHSAHHDTRWUTF-SIQRNXPUSA-N 0.000 description 2
- 238000004458 analytical method Methods 0.000 description 2
- 239000005557 antagonist Substances 0.000 description 2
- 230000015572 biosynthetic process Effects 0.000 description 2
- 108091005948 blue fluorescent proteins Proteins 0.000 description 2
- 201000011510 cancer Diseases 0.000 description 2
- 210000004671 cell-free system Anatomy 0.000 description 2
- 239000003795 chemical substances by application Substances 0.000 description 2
- 238000004925 denaturation Methods 0.000 description 2
- 230000036425 denaturation Effects 0.000 description 2
- 238000013461 design Methods 0.000 description 2
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 2
- 230000002068 genetic effect Effects 0.000 description 2
- 229960003180 glutathione Drugs 0.000 description 2
- 239000000185 hemagglutinin Substances 0.000 description 2
- 210000003000 inclusion body Anatomy 0.000 description 2
- 238000011534 incubation Methods 0.000 description 2
- 239000003112 inhibitor Substances 0.000 description 2
- 238000002347 injection Methods 0.000 description 2
- 239000007924 injection Substances 0.000 description 2
- 230000003834 intracellular effect Effects 0.000 description 2
- 238000002955 isolation Methods 0.000 description 2
- 238000011068 loading method Methods 0.000 description 2
- 238000005259 measurement Methods 0.000 description 2
- 108020004999 messenger RNA Proteins 0.000 description 2
- 235000013336 milk Nutrition 0.000 description 2
- 239000008267 milk Substances 0.000 description 2
- 210000004080 milk Anatomy 0.000 description 2
- 210000003470 mitochondria Anatomy 0.000 description 2
- 230000004770 neurodegeneration Effects 0.000 description 2
- 230000007170 pathology Effects 0.000 description 2
- 108040007629 peroxidase activity proteins Proteins 0.000 description 2
- 239000008194 pharmaceutical composition Substances 0.000 description 2
- 230000004481 post-translational protein modification Effects 0.000 description 2
- 239000002244 precipitate Substances 0.000 description 2
- 238000002360 preparation method Methods 0.000 description 2
- 230000000861 pro-apoptotic effect Effects 0.000 description 2
- 230000004850 protein–protein interaction Effects 0.000 description 2
- 210000002966 serum Anatomy 0.000 description 2
- 239000011780 sodium chloride Substances 0.000 description 2
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 2
- 239000000725 suspension Substances 0.000 description 2
- 108060008226 thioredoxin Proteins 0.000 description 2
- 231100000331 toxic Toxicity 0.000 description 2
- 230000002588 toxic effect Effects 0.000 description 2
- 238000012546 transfer Methods 0.000 description 2
- OSBLTNPMIGYQGY-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;2-[2-[bis(carboxymethyl)amino]ethyl-(carboxymethyl)amino]acetic acid;boric acid Chemical compound OB(O)O.OCC(N)(CO)CO.OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O OSBLTNPMIGYQGY-UHFFFAOYSA-N 0.000 description 1
- QFVHZQCOUORWEI-UHFFFAOYSA-N 4-[(4-anilino-5-sulfonaphthalen-1-yl)diazenyl]-5-hydroxynaphthalene-2,7-disulfonic acid Chemical compound C=12C(O)=CC(S(O)(=O)=O)=CC2=CC(S(O)(=O)=O)=CC=1N=NC(C1=CC=CC(=C11)S(O)(=O)=O)=CC=C1NC1=CC=CC=C1 QFVHZQCOUORWEI-UHFFFAOYSA-N 0.000 description 1
- 229920001817 Agar Polymers 0.000 description 1
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 1
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- 102000012410 DNA Ligases Human genes 0.000 description 1
- 108010061982 DNA Ligases Proteins 0.000 description 1
- 108700019745 Disks Large Homolog 4 Proteins 0.000 description 1
- 102000047174 Disks Large Homolog 4 Human genes 0.000 description 1
- 241000196324 Embryophyta Species 0.000 description 1
- 241000588724 Escherichia coli Species 0.000 description 1
- 241000701959 Escherichia virus Lambda Species 0.000 description 1
- KRHYYFGTRYWZRS-UHFFFAOYSA-M Fluoride anion Chemical compound [F-] KRHYYFGTRYWZRS-UHFFFAOYSA-M 0.000 description 1
- 241000238631 Hexapoda Species 0.000 description 1
- 101000623667 Homo sapiens Mitochondrial carrier homolog 1 Proteins 0.000 description 1
- -1 Isopropylthio- Chemical class 0.000 description 1
- 239000006142 Luria-Bertani Agar Substances 0.000 description 1
- 102000018697 Membrane Proteins Human genes 0.000 description 1
- 108010052285 Membrane Proteins Proteins 0.000 description 1
- 101710108799 Mitochondrial carrier homolog 1 Proteins 0.000 description 1
- HRNLUBSXIHFDHP-UHFFFAOYSA-N N-(2-aminophenyl)-4-[[[4-(3-pyridinyl)-2-pyrimidinyl]amino]methyl]benzamide Chemical compound NC1=CC=CC=C1NC(=O)C(C=C1)=CC=C1CNC1=NC=CC(C=2C=NC=CC=2)=N1 HRNLUBSXIHFDHP-UHFFFAOYSA-N 0.000 description 1
- 239000002033 PVDF binder Substances 0.000 description 1
- 108010002747 Pfu DNA polymerase Proteins 0.000 description 1
- 229920001213 Polysorbate 20 Polymers 0.000 description 1
- 241000205156 Pyrococcus furiosus Species 0.000 description 1
- 101900232935 Pyrococcus furiosus DNA polymerase Proteins 0.000 description 1
- 244000088415 Raphanus sativus Species 0.000 description 1
- 235000006140 Raphanus sativus var sativus Nutrition 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 1
- 239000008051 TBE buffer Substances 0.000 description 1
- 108020005038 Terminator Codon Proteins 0.000 description 1
- 239000013504 Triton X-100 Substances 0.000 description 1
- 229920004890 Triton X-100 Polymers 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- 238000009825 accumulation Methods 0.000 description 1
- 230000021736 acetylation Effects 0.000 description 1
- 238000006640 acetylation reaction Methods 0.000 description 1
- 230000010933 acylation Effects 0.000 description 1
- 238000005917 acylation reaction Methods 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 239000008272 agar Substances 0.000 description 1
- 239000011543 agarose gel Substances 0.000 description 1
- 238000013019 agitation Methods 0.000 description 1
- 230000003321 amplification Effects 0.000 description 1
- 239000000427 antigen Substances 0.000 description 1
- 102000036639 antigens Human genes 0.000 description 1
- 108091007433 antigens Proteins 0.000 description 1
- 230000001640 apoptogenic effect Effects 0.000 description 1
- 230000000740 bleeding effect Effects 0.000 description 1
- KGBXLFKZBHKPEV-UHFFFAOYSA-N boric acid Chemical compound OB(O)O KGBXLFKZBHKPEV-UHFFFAOYSA-N 0.000 description 1
- 239000004327 boric acid Substances 0.000 description 1
- 210000004556 brain Anatomy 0.000 description 1
- UDSAIICHUKSCKT-UHFFFAOYSA-N bromophenol blue Chemical compound C1=C(Br)C(O)=C(Br)C=C1C1(C=2C=C(Br)C(O)=C(Br)C=2)C2=CC=CC=C2S(=O)(=O)O1 UDSAIICHUKSCKT-UHFFFAOYSA-N 0.000 description 1
- 229940041514 candida albicans extract Drugs 0.000 description 1
- 230000021523 carboxylation Effects 0.000 description 1
- 238000006473 carboxylation reaction Methods 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 235000019506 cigar Nutrition 0.000 description 1
- 238000010367 cloning Methods 0.000 description 1
- 210000001072 colon Anatomy 0.000 description 1
- 238000004590 computer program Methods 0.000 description 1
- 238000005094 computer simulation Methods 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- SUYVUBYJARFZHO-RRKCRQDMSA-N dATP Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@H]1C[C@H](O)[C@@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)O1 SUYVUBYJARFZHO-RRKCRQDMSA-N 0.000 description 1
- SUYVUBYJARFZHO-UHFFFAOYSA-N dATP Natural products C1=NC=2C(N)=NC=NC=2N1C1CC(O)C(COP(O)(=O)OP(O)(=O)OP(O)(O)=O)O1 SUYVUBYJARFZHO-UHFFFAOYSA-N 0.000 description 1
- RGWHQCVHVJXOKC-SHYZEUOFSA-J dCTP(4-) Chemical compound O=C1N=C(N)C=CN1[C@@H]1O[C@H](COP([O-])(=O)OP([O-])(=O)OP([O-])([O-])=O)[C@@H](O)C1 RGWHQCVHVJXOKC-SHYZEUOFSA-J 0.000 description 1
- HAAZLUGHYHWQIW-KVQBGUIXSA-N dGTP Chemical compound C1=NC=2C(=O)NC(N)=NC=2N1[C@H]1C[C@H](O)[C@@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)O1 HAAZLUGHYHWQIW-KVQBGUIXSA-N 0.000 description 1
- 230000034994 death Effects 0.000 description 1
- 230000007850 degeneration Effects 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- 239000003398 denaturant Substances 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- 239000003814 drug Substances 0.000 description 1
- 238000010828 elution Methods 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 239000003623 enhancer Substances 0.000 description 1
- ZMMJGEGLRURXTF-UHFFFAOYSA-N ethidium bromide Chemical compound [Br-].C12=CC(N)=CC=C2C2=CC=C(N)C=C2[N+](CC)=C1C1=CC=CC=C1 ZMMJGEGLRURXTF-UHFFFAOYSA-N 0.000 description 1
- 229960005542 ethidium bromide Drugs 0.000 description 1
- 238000002825 functional assay Methods 0.000 description 1
- 230000013595 glycosylation Effects 0.000 description 1
- 238000006206 glycosylation reaction Methods 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- 210000002216 heart Anatomy 0.000 description 1
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 1
- 238000003165 hybrid screening Methods 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 206010022000 influenza Diseases 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 238000012482 interaction analysis Methods 0.000 description 1
- 210000000936 intestine Anatomy 0.000 description 1
- 210000003734 kidney Anatomy 0.000 description 1
- 210000000265 leukocyte Anatomy 0.000 description 1
- 239000003446 ligand Substances 0.000 description 1
- 230000029226 lipidation Effects 0.000 description 1
- 210000004185 liver Anatomy 0.000 description 1
- 210000004072 lung Anatomy 0.000 description 1
- 238000003754 machining Methods 0.000 description 1
- 229910001629 magnesium chloride Inorganic materials 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 230000003278 mimic effect Effects 0.000 description 1
- 230000000877 morphologic effect Effects 0.000 description 1
- ZIUHHBKFKCYYJD-UHFFFAOYSA-N n,n'-methylenebisacrylamide Chemical compound C=CC(=O)NCNC(=O)C=C ZIUHHBKFKCYYJD-UHFFFAOYSA-N 0.000 description 1
- 239000013642 negative control Substances 0.000 description 1
- 230000000626 neurodegenerative effect Effects 0.000 description 1
- 238000003199 nucleic acid amplification method Methods 0.000 description 1
- 210000001672 ovary Anatomy 0.000 description 1
- 230000002018 overexpression Effects 0.000 description 1
- 210000000496 pancreas Anatomy 0.000 description 1
- YBYRMVIVWMBXKQ-UHFFFAOYSA-N phenylmethanesulfonyl fluoride Chemical compound FS(=O)(=O)CC1=CC=CC=C1 YBYRMVIVWMBXKQ-UHFFFAOYSA-N 0.000 description 1
- 230000026731 phosphorylation Effects 0.000 description 1
- 238000006366 phosphorylation reaction Methods 0.000 description 1
- 210000002826 placenta Anatomy 0.000 description 1
- 239000013612 plasmid Substances 0.000 description 1
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 1
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 1
- 229920000131 polyvinylidene Polymers 0.000 description 1
- 229920002981 polyvinylidene fluoride Polymers 0.000 description 1
- 239000000843 powder Substances 0.000 description 1
- 239000002243 precursor Substances 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 210000002307 prostate Anatomy 0.000 description 1
- 238000000159 protein binding assay Methods 0.000 description 1
- 108020001580 protein domains Proteins 0.000 description 1
- 238000002005 protein protein interaction detection Methods 0.000 description 1
- 238000001742 protein purification Methods 0.000 description 1
- 239000012460 protein solution Substances 0.000 description 1
- 238000002762 protein-protein interaction assay Methods 0.000 description 1
- 239000011535 reaction buffer Substances 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 238000012216 screening Methods 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 235000020183 skimmed milk Nutrition 0.000 description 1
- 150000003384 small molecules Chemical class 0.000 description 1
- 239000002195 soluble material Substances 0.000 description 1
- 238000000527 sonication Methods 0.000 description 1
- 210000000952 spleen Anatomy 0.000 description 1
- 238000010186 staining Methods 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 238000010254 subcutaneous injection Methods 0.000 description 1
- 239000007929 subcutaneous injection Substances 0.000 description 1
- 102000013498 tau Proteins Human genes 0.000 description 1
- 108010026424 tau Proteins Proteins 0.000 description 1
- 210000001550 testis Anatomy 0.000 description 1
- 229940094937 thioredoxin Drugs 0.000 description 1
- 210000001541 thymus gland Anatomy 0.000 description 1
- 210000001519 tissue Anatomy 0.000 description 1
- 238000013518 transcription Methods 0.000 description 1
- 230000035897 transcription Effects 0.000 description 1
- 230000002103 transcriptional effect Effects 0.000 description 1
- 238000013519 translation Methods 0.000 description 1
- 239000012137 tryptone Substances 0.000 description 1
- 229960005486 vaccine Drugs 0.000 description 1
- 210000003462 vein Anatomy 0.000 description 1
- 231100000925 very toxic Toxicity 0.000 description 1
- 238000012800 visualization Methods 0.000 description 1
- 239000011534 wash buffer Substances 0.000 description 1
- 238000002424 x-ray crystallography Methods 0.000 description 1
- 239000012138 yeast extract Substances 0.000 description 1
- 238000001086 yeast two-hybrid system Methods 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4702—Regulators; Modulating activity
- C07K14/4703—Inhibitors; Suppressors
Landscapes
- Chemical & Material Sciences (AREA)
- Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- General Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Gastroenterology & Hepatology (AREA)
- Zoology (AREA)
- Toxicology (AREA)
- Immunology (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Abstract
Isoformas de PSAP, determinantes antigénicos, método de obtención de anticuerpos y usos de los mismos.PSAP isoforms, antigenic determinants, method of obtaining antibodies and uses thereof.
La presente invención se refiere a la proteína de membrana PSAPL y a una nueva isoforma de PSAP (PSAPS) generada por splicing alternativo, así como métodos para la obtención de anticuerpos contra estas proteínas. También forman parte de la invención los métodos de detección, así como de obtención de moduladores de la actividad de dichas proteínas y su uso como agentes terapéuticamente activos.The present invention relates to protein of PSAPL membrane and a new PSAP isoform (PSAPS) generated by alternative splicing, as well as methods for obtaining antibodies against these proteins. They are also part of the invention detection methods as well as obtaining modulators of the activity of said proteins and their use as therapeutically active agents.
Description
Isoformas de PSAP, determinantes antigénicos, método de obtención de anticuerpos y uso de los mismos.PSAP isoforms, antigenic determinants, method of obtaining antibodies and using them.
La presente invención se refiere a la proteína de membrana PSAP y a una nueva isoforma de PSAP (PSAPS) generada por splicing alternativo, así como métodos para la obtención de anticuerpos. También forman parte de la invención los métodos para la obtención de moduladores de la actividad de dichas proteínas y su uso como agentes terapéuticamente activos.The present invention relates to protein of PSAP membrane and a new PSAP isoform (PSAPS) generated by alternative splicing, as well as methods for obtaining antibodies Also part of the invention are methods for obtaining modulators of the activity of said proteins and its use as therapeutically active agents.
La enfermedad de Alzheimer es una patología neurodegenerativa que se caracteriza a nivel celular por la acumulación extracelular de agregados de proteína constituidos principalmente por el péptido amiloide beta y ovillos intracelulares formados por proteína tau hiperfosforilada. Todavía no está claro qué evento es el responsable del comienzo de la enfermedad, pero se han encontrado varios factores posibles aparte de la formación de acúmulos de proteínas.Alzheimer's disease is a pathology neurodegenerative that is characterized at the cellular level by the extracellular accumulation of constituted protein aggregates mainly by beta amyloid peptide and clews intracellular formed by hyperphosphorylated tau protein. Still it is not clear which event is responsible for the beginning of the disease, but several possible factors have been found apart of the formation of protein clusters.
Algunos trabajos han relacionado la mitocondria con la enfermedad de Alzheimer, observándose que algunas de las proteínas implicadas en la enfermedad de Alzheimer, como las presenilinas, que son proteínas que participan en la producción del péptido amiloide beta a partir de su proteína precursora, betaAPP, interaccionan con proteínas implicadas en el proceso de muerte celular apoptótica que ejercen su función en la mitocondria.Some works have related mitochondria with Alzheimer's disease, observing that some of the proteins involved in Alzheimer's disease, such as Presenilins, which are proteins that participate in the production of beta amyloid peptide from its precursor protein, betaAPP, interact with proteins involved in the death process Apoptotic cell that exert their function in the mitochondria.
Se ha observado que PSAP (presenilin 1- associated protein) o mtch1 (mitochondrial carrier homolog 1) una proteína mitocondrial que interacciona con la presenilina 1, induce el proceso de muerte celular apoptótica cuando sus niveles intracelulares son aumentados por sobreexpresión de la misma en células en cultivo. Esto sugiere que PSAP está relacionada con la muerte celular apoptótica en la enfermedad de Alzheimer y podría jugar un papel importante en diversas enfermedades degenerativas, así como en diversos tipos de cánceres.It has been observed that PSAP (presenilin 1- associated protein) or mtch1 (mitochondrial carrier homolog 1) a mitochondrial protein that interacts with presenilin 1, induces the apoptotic cell death process when its levels intracellular are increased by overexpression of it in cells in culture. This suggests that PSAP is related to the apoptotic cell death in Alzheimer's disease and could play an important role in various degenerative diseases, as well as in various types of cancers.
PSAP no es la única proteína que interacciona con la Presenilina 1 y que está relacionada con las patologías anteriormente mencionadas. Una de estas proteínas distintas de PSAP, es la HPAP (Human Presenilin-asociated Protein), descrita en la solicitud de patente Norteamericana nº 09/116,640. En este documento se desarrolla un método para la obtención de anticuerpos contra dicha proteína para su uso tanto en el diagnóstico in vivo como in vitro.PSAP is not the only protein that interacts with Presenilin 1 and is related to the aforementioned pathologies. One of these proteins other than PSAP, is the HPAP (Human Presenilin-associated Protein), described in US Patent Application No. 09 / 116,640. This document develops a method for obtaining antibodies against said protein for use both in vivo and in vitro diagnosis.
En relación a PSAP, la primera referencia conocida a esta proteína y en la que se describe su relación con la Presenilina 1 fue realizada en 1999 (Xuemin Xu, Yong-chang Shi et al.,J Biol Chem, Vol. 274, Issue 46, 32543-32546, November 12, 1999, Identification of a Novel PSD-95/Dlg/ZO-1 (PDZ)-like Protein Interacting with the C Terminus of Presenilin-1). En este artículo se describen experimentos en los que la detección de la proteína PSAP se realiza mediante la adición en su extremo Carboxilo terminal de un marcador ("Myc tag") sobre el cual actúan anticuerpos denominados como "anti-myc".In relation to PSAP, the first known reference to this protein and in which its relationship with Presenilin 1 is described was made in 1999 (Xuemin Xu, Yong-chang Shi et al ., J Biol Chem, Vol. 274, Issue 46 , 32543-32546, November 12, 1999, Identification of a Novel PSD-95 / Dlg / ZO-1 (PDZ) -like Protein Interacting with the C Terminus of Presenilin-1). This article describes experiments in which the detection of the PSAP protein is carried out by adding at its Carboxyl end of a marker ("Myc tag") on which antibodies called "anti-myc" act.
En 2002, Xuemin Xu et al. (J Biol Chem. 2002 Dec 13;277(50):48913-22. Epub 2002 Oct 10. The novel presenilin-1-associated protein is a proapoptotic mitochondrial protein) describen la relación de PSAP con la apoptosis. En los experimentos la visualización de PSAP se realiza a través de la creación de una proteína quimérica de fusión entre PSAP y GFP (Green Fluorescence Protein). La detección de PSAP también se realiza con anticuerpos, tal y como fueron descritos en el articulo mencionado anteriormente de Xuemin Xu et al. 1999.In 2002, Xuemin Xu et al . (J Biol Chem. 2002 Dec 13; 277 (50): 48913-22. Epub 2002 Oct 10. The novel presenilin-1-associated protein is a proapoptotic mitochondrial protein) describes the relationship of PSAP with apoptosis. In the experiments the visualization of PSAP is carried out through the creation of a chimeric fusion protein between PSAP and GFP (Green Fluorescence Protein). PSAP detection is also performed with antibodies, as described in the above-mentioned article by Xuemin Xu et al . 1999.
Hasta el momento son pocos los anticuerpos desarrollados que reaccionen directamente contra PSAP debido a la dificultad que entraña localizar epítopos o fragmentos antigénicos de esta proteína que funcionen correctamente por diferentes motivos:So far there are few antibodies developed that react directly against PSAP due to the difficulty in locating epitopes or antigenic fragments of this protein that work correctly for different reasons:
- i)i)
- PSAP es una proteína que resulta muy tóxica cuando fragmentos de ésta o la proteína completa se intenta expresar en sistemas vector-célula huésped. Esta circunstancia hace muy complejo el procedimiento de obtención de anticuerpos contra PSAP, puesto que los fragmentos antigénicos de ésta que se elijan, no sólo deben ser buenos determinantes antigénicos, sino que además no deben de ser tóxicos.PSAP is a protein that is very toxic when fragments of this or the complete protein are attempted to express in vector-host cell systems. This circumstance the procedure for obtaining antibodies is very complex against PSAP, since the antigenic fragments of this one that choose, not only must be good antigenic determinants, but which also should not be toxic.
- ii)ii)
- No todos los posibles epítopos de la proteína se encuentran expuestos una vez la proteína se encuentra plegada, por lo que es necesario seleccionar aquellos que si lo estén, para los casos en los que los métodos de detección utilicen muestras con proteínas nativas.Not all possible protein epitopes are they are exposed once the protein is folded, by what is necessary to select those that are, for cases in which detection methods use samples with native proteins
- iii)iii)
- Aunque con los programas informáticos existentes es posible llegar a saber cual es la configuración terciaria de una proteína, y con ello conocer qué epítopos deberían encontrarse expuestos partiendo de una secuencia de aminoácidos inicial, las modificaciones postraduccionales hacen que muchos de los epítopos candidatos, que a priori son adecuados, en la práctica no sean eficaces para la obtención de anticuerpos.Although existing software is possible to know what the tertiary configuration of a protein, and thus know which epitopes should be set based on a sequence of initial amino acid, posttranslational modifications make many of the candidate epitopes, which Priori are adequate, in practice they are not effective for obtaining antibodies.
Estos inconvenientes son solucionados con el método y elementos proporcionados para la obtención de anticuerpos contra PSAP en la presente invención.These inconveniences are solved with the method and elements provided for obtaining antibodies against PSAP in the present invention.
Otro de los problemas solucionados por la presente invención radica en la necesidad de encontrar nuevas dianas hasta ahora desconocidas, que mejoren y permitan el estudio, prevención, diagnóstico y tratamiento de enfermedades entre las que se incluyen, pero no se limitan a, el Alzheimer o diferentes tipos de cáncer.Another problem solved by the present invention lies in the need to find new hitherto unknown targets, that improve and allow study, prevention, diagnosis and treatment of diseases among which are included, but not limited to, Alzheimer's or different types Of cancer.
En este sentido, la invención proporciona una nueva isoforma de PSAP (PSAPS) generada por splicing alternativo, métodos para la obtención de agentes que modulen su actividad, además de un método para la generación de anticuerpos contra ésta, junto con los elementos para llevarlo a cabo. Dicha isoforma difiere de la isoforma actualmente incluida en el estado de la técnica, PSAPL, en la longitud de un brazo hidrofílico situado entre los dos dominios transmenbrana de la proteína.In this sense, the invention provides a new PSAP isoform (PSAPS) generated by alternative splicing, methods for obtaining agents that modulate their activity, in addition to a method for generating antibodies against it, along with the elements to carry it out. This isoform differs of the isoform currently included in the state of the art, PSAPL, in the length of a hydrophilic arm located between the two Transmenbran protein domains.
Un primer aspecto de la presente invención se refiere a un polinucleótido aislado seleccionado de cualquiera de los siguientes grupos: i) polinucleótido que codifica para la secuencia SEQ ID 2; ii) polinucleótido cuya secuencia comprende la SEQ ID 1 o fragmentos de la misma; iii) polinucleótido cuya secuencia consiste en la SEQ ID 1; iv) polinucleótido que comprenda una secuencia que difiera de la secuencia del polinucleótido (iii) o fragmentos de (ii) debido a la degeneración del código genético; v) polinucleótido que codifique para un polipéptido que al menos muestre un 90% de homología con cualquiera de los polipéptidos codificados por los polinucleótidos (i), (ii), (iii) o (iv); vi) polinucleótido que comprenda la SEQ ID 3 o un fragmento de la misma. En adelante nos referiremos a los polinucleótidos anteriormente mencionados como polinucleótidos de la invención.A first aspect of the present invention is refers to an isolated polynucleotide selected from any of the following groups: i) polynucleotide encoding the sequence SEQ ID 2; ii) polynucleotide whose sequence comprises the SEQ ID 1 or fragments thereof; iii) polynucleotide whose sequence consists of SEQ ID 1; iv) polynucleotide that comprises a sequence that differs from the polynucleotide sequence (iii) or fragments of (ii) due to the degeneracy of the genetic code; v) polynucleotide encoding a polypeptide that at least show 90% homology with any of the polypeptides encoded by polynucleotides (i), (ii), (iii) or (iv); saw) polynucleotide comprising SEQ ID 3 or a fragment of the same. Hereinafter we will refer to polynucleotides previously mentioned as polynucleotides of the invention.
En un aspecto de la presente invención el término fragmento se refiere a todas aquellos secuencias nucleotídicas comprendidas en los polinucleotidos de la invención que codifiquen polipéptidos capaces de ser utilizados como determinantes antigénicos para la generación de anticuerpos o como posibles dianas para la generación u obtención de moduladores de la actividad de PSAPS o PSAPL.In one aspect of the present invention the term fragment refers to all those sequences nucleotides comprised in the polynucleotides of the invention encoding polypeptides capable of being used as antigenic determinants for antibody generation or as possible targets for the generation or obtaining of modulators of the PSAPS or PSAPL activity.
Un segundo aspecto de la invención se relaciona con un polipéptido aislado seleccionado de cualquiera de los siguientes grupos: i) polipéptido que consiste en la SEQ ID 2; ii) polipéptido que comprende la secuencia SEQ ID 2; iii) polipéptido codificado por cualquiera de las secuencias de los polinucleotidos de la invención; iv) polipéptido que al menos muestre un 90% de homología con cualquiera de los péptidos (i), (ii), (iii) o (v); v) polipéptido que comprende la SEQ ID 4 o un fragmento de la misma. En adelante nos referiremos a los polipéptidos anteriormente mencionados como polipéptidos de la invención.A second aspect of the invention relates to with an isolated polypeptide selected from any of the following groups: i) polypeptide consisting of SEQ ID 2; ii) polypeptide comprising the sequence SEQ ID 2; iii) polypeptide encoded by any of the polynucleotide sequences of the invention; iv) polypeptide that shows at least 90% of homology with any of the peptides (i), (ii), (iii) or (v); v) polypeptide comprising SEQ ID 4 or a fragment thereof. In later we will refer to the polypeptides above mentioned as polypeptides of the invention.
En otro aspecto de la presente invención el término fragmento se refiere a todas aquellos secuencias polipeptídicas comprendidas en cualquiera de los polipéptidos de la invención capaces de ser utilizadas como determinantes antigénicos para la generación de anticuerpos o como posibles dianas para la generación u obtención de moduladores de la actividad de PSAPS o PSAPL.In another aspect of the present invention the term fragment refers to all those sequences polypeptides comprised in any of the polypeptides of the invention capable of being used as antigenic determinants for the generation of antibodies or as possible targets for generation or obtaining of modulators of PSAPS activity or PSAPL
Un tercer aspecto de la invención los constituye una proteína de fusión que comprende al menos un polipéptido de la invención. Preferentemente dicho polipéptido comprende la SEQ ID 6. En adelante nos referiremos a las proteínas de fusión anteriormente mencionadas como proteínas de fusión de la invención.A third aspect of the invention constitutes them a fusion protein comprising at least one polypeptide of the invention. Preferably said polypeptide comprises SEQ ID 6. Hereinafter we will refer to fusion proteins above mentioned as fusion proteins of the invention.
Otro aspecto de la invención los constituye un vector que comprenda cualquiera de los polinucleótidos de la invención. Preferentemente dicho vector comprende al polinucleótido cuya secuencia es la SEQ ID 3. En adelante nos referiremos a los vectores anteriormente mencionados como vectores de la invención.Another aspect of the invention constitutes them a vector comprising any of the polynucleotides of the invention. Preferably said vector comprises the polynucleotide whose sequence is SEQ ID 3. Hereinafter we will refer to the vectors mentioned above as vectors of the invention.
Otro aspecto de la invención lo constituye una célula huésped transformada que comprende cualquiera de los vectores de la invención.Another aspect of the invention is constituted by a transformed host cell comprising any of the vectors of the invention.
Otro aspecto de la invención lo constituyen cebadores para la amplificación del polinucleótido SEQ ID 3, preferentemente dichos cebadores tienen cualquiera de las secuencias SEQ ID 7 o 8.Another aspect of the invention is constituted primers for amplification of the polynucleotide SEQ ID 3, preferably said primers have any of the SEQ ID 7 or 8 sequences.
Otro aspecto de la invención lo constituye un método para la producción de PSAP o fragmentos de la misma que comprende: i) cultivo de células según la reivindicación 5, ii) recuperación de la proteína PSAP o fragmentos de la misma de un medio de cultivo.Another aspect of the invention is constituted by a method for the production of PSAP or fragments thereof that comprising: i) cell culture according to claim 5, ii) recovery of the PSAP protein or fragments thereof from a culture medium.
Otro aspecto de la invención lo constituye un método para la detección de un polinucleótido que codifica para PSAPL o PSAPS que comprende: i) hibridación de al menos un polinucleótido de la invención a una muestra problema de ácido nucleico, ii) identificación del complejo de hibridación formado.Another aspect of the invention is constituted by a method for the detection of a polynucleotide encoding for PSAPL or PSAPS comprising: i) hybridization of at least one polynucleotide of the invention to an acid problem sample nucleic, ii) identification of the hybridization complex formed.
Método para la generación de anticuerpos específicos frente a PSAPL y/o PSAPS que comprende la utilización de al menos un polipéptido de la invención como determinante antigénico. Preferentemente dicho polipéptido comprende la SEQ ID 4. Más preferentemente el polipéptido es una proteína de fusión perteneciente a las proteínas de fusión de la invención. En adelante los métodos para la obtención de anticuerpos serán denominados como métodos para la obtención de anticuerpos de la invención.Method for the generation of antibodies specific to PSAPL and / or PSAPS that includes the use of at least one polypeptide of the invention as a determinant antigenic Preferably said polypeptide comprises SEQ ID 4. More preferably the polypeptide is a fusion protein belonging to the fusion proteins of the invention. In further the methods for obtaining antibodies will be denominated as methods for obtaining antibodies from the invention.
Otro aspecto de la invención lo constituyen aquellos anticuerpos obtenidos según los métodos para la obtención de anticuerpos de la invención, que en adelante serán denominados como anticuerpos de la invención.Another aspect of the invention is constituted those antibodies obtained according to the methods for obtaining of antibodies of the invention, hereinafter referred to as as antibodies of the invention.
Otro aspecto de la invención está constituido por el uso de los anticuerpos de la invención para el diagnóstico in vitro o in vivo de enfermedades neurodegenerativas asociadas a cualquiera de las isoforma de la proteína PSAP. En un aspecto preferido de la invención se refiere a un anticuerpo aislado capaz de unirse específicamente a la proteína PSAPS o PSAPL. En un aspecto más preferido de la invención dicho anticuerpo se une específicamente a un epítopo cuya secuencia comprende la SEQ ID Nº 4 o fragmentos de la misma.Another aspect of the invention is constituted by the use of the antibodies of the invention for the in vitro or in vivo diagnosis of neurodegenerative diseases associated with any of the PSAP protein isoforms. In a preferred aspect of the invention it refers to an isolated antibody capable of specifically binding to the PSAPS or PSAPL protein. In a more preferred aspect of the invention said antibody specifically binds to an epitope whose sequence comprises SEQ ID No. 4 or fragments thereof.
Otro aspecto de la invención comprende un método para la detección de compuestos moduladores de la actividad de PSAPS o PSAPL que comprende: i) poner en contacto un compuesto a testar con un polipéptido de la invención, ii) detectar la interacción del compuesto testado con el polipéptido de la invención, en donde el compuesto testado es identificado como potencial modulador de la actividad de PSAP. En una realización preferente de la invención el compuesto a testar está marcado. En una realización más preferente de la invención el polipéptido de la invención está marcado.Another aspect of the invention comprises a method. for the detection of compounds modulating the activity of PSAPS or PSAPL comprising: i) contacting a compound a test with a polypeptide of the invention, ii) detect the interaction of the compound tested with the polypeptide of the invention, wherein the tested compound is identified as potential modulator of PSAP activity. In one embodiment Preferred of the invention is the compound to be tested. In a more preferred embodiment of the invention the polypeptide of the Invention is marked.
Otro aspecto de la invención comprende un método para la detección de compuestos moduladores de la actividad de PSAPS o PSAPL que comprende: i) medir la actividad de un polipéptido de la invención a una determinada concentración del compuesto a testar, ii) medir la actividad del mencionado polipéptido a diferentes concentraciones o en ausencia del compuesto a testar, en donde la actividad de PSAP medida en (i) y (ii) es significativamente distinta. En una realización preferente de la invención la actividad es medida en una o en un grupo de células. En una realización preferente de la invención la actividad es medida en un sistema libre de células. En otra realización de la invención el compuesto a testar está marcado. En aún otra realización de la invención el polipéptido está marcado. En adelante los compuestos testados capaces de modular la actividad de PSAP serán denominados como compuestos moduladores de la invención.Another aspect of the invention comprises a method. for the detection of compounds modulating the activity of PSAPS or PSAPL comprising: i) measuring the activity of a polypeptide of the invention at a certain concentration of compound to be tested, ii) measure the activity of the aforementioned polypeptide at different concentrations or in the absence of compound to be tested, where the PSAP activity measured in (i) and (ii) is significantly different. In a preferred embodiment of the invention the activity is measured in one or a group of cells. In a preferred embodiment of the invention the activity It is measured in a cell-free system. In another embodiment of the Invention the compound to be tested is marked. In yet another embodiment of the invention the polypeptide is labeled. In forward the tested compounds capable of modulating the activity of PSAP will be referred to as modulatory compounds of the invention.
Otro aspecto de la invención lo constituye una composición farmacéutica que comprenda al menos uno de los compuestos moduladores de la invención.Another aspect of the invention is constituted by a pharmaceutical composition comprising at least one of the modulating compounds of the invention.
Otro aspecto de la invención lo constituye una composición farmacéutica que comprenda al menos uno de los anticuerpos de la invención.Another aspect of the invention is constituted by a pharmaceutical composition comprising at least one of the antibodies of the invention.
Otro aspecto de la invención lo constituye el uso de al menos uno de los polipéptidos de la invención para la elaboración de una vacuna. En un aspecto preferente de la presente invención dicho polipéptido es la SEQ ID nº 4.Another aspect of the invention is the use of at least one of the polypeptides of the invention for the Preparation of a vaccine. In a preferred aspect of the present The invention said polypeptide is SEQ ID No. 4.
En aún otro aspecto adicional de la presente invención lo constituye un Kit para el diagnóstico de una enfermedad neurodegenerativa in vitro o in vivo asociada a la actividad de PSAP, que comprenda al menos uno de los anticuerpos de la invención.In yet another additional aspect of the present invention is a Kit for the diagnosis of a neurodegenerative disease in vitro or in vivo associated with the activity of PSAP, comprising at least one of the antibodies of the invention.
Fig 1. En el panel A de la figura 1 se muestra el test de expresión realizado con bacterias que expresan GST (codificada en el vector pGEX-3X) y GST-PSAP (región 1 de PSAP fusionada a GST, codificada en el vector pJAC244), sin inducir (-) o induciendo (+) la expresión de estas proteínas con IPTG. Los tamaños de las proteínas esperadas son de 26,9 kDa para GST y 32 kDa para GST-PSAP. La cantidad de material cargada en cada carril equivale a 80 \mul de un cultivo de 2 ml.Fig 1. Panel A of Figure 1 shows the expression test performed with bacteria that express GST (encoded in the vector pGEX-3X) and GST-PSAP (PSAP region 1 merged to GST, encoded in vector pJAC244), without inducing (-) or inducing (+) the expression of these proteins with IPTG. The sizes of the Expected proteins are 26.9 kDa for GST and 32 kDa for GST-PSAP. The amount of material loaded in each lane equals 80 µl of a 2 ml culture.
En el panel B de la figura 1 se muestran los pasos de purificación de GST-PSAP. Las muestras cargadas en cada carril se indican a continuación:Panel B in Figure 1 shows the Purification steps of GST-PSAP. The samples Loaded in each lane are indicated below:
-
1
\;
-one\;
- - 10 \mul de 5 ml de lisado bacteriano, proveniente de un cultivo de 50 ml. 10 µl of 5 ml of Bacterial lysate, from a 50 ml culture.
-
2
\;
-2\;
- - 10 \mul de 5 ml de sobrenadante tras centrifugar el lisado 20 minutos a 16000 g. 10 µl of 5 ml of supernatant after centrifuging the lysate 20 minutes at 16000 g.
-
3
\;
-3\;
- - 10 \mu de 800 \mul de precipitado del paso anterior resuspendido en buffer con urea. 10 µ of 800 µl of precipitate from the previous step resuspended in buffer with urea.
-
4
\;
-4\;
- - 10 \mul de 800 \mul de sobrenadante de urea tras centrifugar 20 minutos a 16000 g. 10 \ mul of 800 \ mul of urea supernatant after centrifuging 20 minutes at 16000 g.
-
5
\;
-5\;
- - 10 \mul de 12,8 ml de sobrenadante del paso anterior diluido 12 ml de buffer sin urea. 10 µl of 12.8 ml of supernatant from the previous step diluted 12 ml of buffer without urea.
-
6
\;
-6\;
- - 10 \mul de sobrenadante tras centrifugar la dilución anterior 20 minutos a 16000 g. 10 µl of supernatant after centrifuging the previous dilution 20 minutes at 16000 g.
-
7
\;
-7\;
- - 10 \mul de material (6.4 ml) del paso anterior no unido (excluido) a 400 \mul de matriz de glutation-sefarosa (suspensión al 50%). 10 \ mul of material (6.4 ml) from the previous step not bound (excluded) to 400 µl of glutathione-sepharose matrix (suspension at fifty%).
-
8
\;
-8\;
- - 10 \mul de 1 ml de buffer de lavado (primer lavado de la matriz). 10 µl of 1 ml of wash buffer (first wash of the matrix).
-
9
\;
-9\;
- - 10 \mul de 200 \mul de eluido de la matriz (tras dos lavados adicionales que no se muestran). 10 \ mul of 200 \ mul of eluted from the matrix (after two additional washes that are not show).
Fig 2. En el panel A de la figura 2 se muestran los resultados de un western blot en el que se usó el anticuerpo anti-PSAP para detectar dos mutantes de deleción de PSAP, fusionados a GFP (proteína fluorescente verde) en un lisado de células HEK293 que expresan estos mutantes. El tamaño del mutante en el carril 1 es 52 kDa. El del carril 2 es 63.5 kDa.Fig 2. Panel A of Figure 2 shows the results of a western blot in which the antibody was used anti-PSAP to detect two deletion mutants of PSAP, fused to GFP (green fluorescent protein) in a lysate of HEK293 cells expressing these mutants. The size of the mutant in lane 1 is 52 kDa. The lane 2 is 63.5 kDa.
En el panel B de la figura 2 se muestra un western blot realizado con las mismas muestras usadas en el panel A, pero usando un anticuerpo anti-GFP comercial (dos monoclonales mezclados, de Roche, cat # 11814460001), como control.A panel B in Figure 2 shows a western blot made with the same samples used in the panel A, but using a commercial anti-GFP antibody (two mixed monoclonal, from Roche, cat # 11814460001), as control.
Diversos estudios realizados en laboratorio con la proteína PSAP indican que ésta, y algunos fragmentos de la misma, resultan tóxicos para, al menos, algunas cepas bacterianas. Esto ha determinado, en parte, la elección de las regiones de la proteína para ser usadas como epítopos para producción de anticuerpos, al no poder obtener algunos fragmentos recombinantes de PSAP mediante expresión en bacterias. Otro factor que se ha tenido en cuenta es la topología de membrana predicha para PSAP, utilizando diversos programas de computador. PSAP parece ser una proteína de membrana con dos dominios transmembrana, con lo cual posee tres regiones potencialmente hidrofílicas: la región aminoterminal, por delante del primer dominio transmembrana; la región situada entre ambos dominios transmembrana; y la región carboxilo terminal, por detrás del segundo dominio transmembrana.Various laboratory studies with the PSAP protein indicate that this, and some fragments of the same, they are toxic to at least some bacterial strains. This has determined, in part, the choice of regions of the protein to be used as epitopes for production of antibodies, unable to obtain some recombinant fragments of PSAP by expression in bacteria. Another factor that has been taken into account is the predicted membrane topology for PSAP, using various computer programs. PSAP seems to be a membrane protein with two transmembrane domains, thereby It has three potentially hydrophilic regions: the region aminoterminal, ahead of the first transmembrane domain; the region located between both transmembrane domains; and the region carboxyl terminal, behind the second domain transmembrane
Inicialmente se pretendió la expresión en bacterias de PSAP completa y de fragmentos de la misma, sin demasiado éxito. Posteriormente se prepararon vectores para expresar las tres regiones potencialmente hidrofílicas de PSAP como fusiones con glutation S-transferasa (GST), aunque sólo la región situada entre ambos dominios transmembrana (SEQ ID 4), y la región carboxilo terminal pudieron ser expresadas de esta forma. SEQ ID 4 incluye 45 aminoácidos de PSAPL, entre las posiciones 271 y 315 (nllahfinaylvddsvsdtpgglgndqnpgsqfsqalairsytkf). Dentro de esta región hay 17 aminoácidos sólo presentes en PSAPL (vsdtpgglgndgnpgsq); los 51 nucleótidos que los codifican se eliminan por splicing alternativo para generar PSAPS.Initially the expression in bacteria of complete PSAP and fragments thereof was sought, without much success. Subsequently, vectors were prepared to express the three potentially hydrophilic regions of PSAP as fusions with glutathione S-transferase (GST), although only the region between both transmembrane domains (SEQ ID 4), and the terminal carboxyl region could be expressed in this way . SEQ ID 4 includes 45 PSAPL amino acids, between positions 271 and 315 (nllahfinaylvdds vsdtpgglgndqnpgsq fsqalairsytkf). Within this region there are 17 amino acids only present in PSAPL (vsdtpgglgndgnpgsq); The 51 nucleotides that encode them are removed by alternative splicing to generate PSAPS.
Estos estudios han llevado a la detección de una nueva isoforma de PSAP (PSAPS) que interacciona con una proteína muy ligada a enfermedades y procesos neurodegerativos, como la presenilina 1.These studies have led to the detection of a new PSAP isoform (PSAPS) that interacts with a protein closely linked to diseases and neurodegerative processes, such as Preseniline 1.
Un primer aspecto de la invención comprende esta nueva isoforma de PSAP o a la SEQ ID 2 que muestra la actividad de PSAPS o fragmentos de ésta. PSAPS, generada por splicing alternativo, es codificada por la SEQ ID 1, molécula de cDNA que también forma parte de la presente invención. Otro objeto de la invención lo constituyen los polipéptidos que son obtenidos por modificaciones postraduccionales de PSAPS o fragmentos de ésta, que incluyen, pero no se limitan a, la acetilación, carboxilación, glicosilación, fosforilación, lipidación y acilación.A first aspect of the invention comprises this new isoform of PSAP or to SEQ ID 2 that shows the activity of PSAPS or fragments thereof. PSAPS, generated by splicing alternatively, it is encoded by SEQ ID 1, cDNA molecule that It is also part of the present invention. Another object of the invention is constituted by the polypeptides that are obtained by PSAPS post-translational modifications or fragments thereof, which include, but are not limited to, acetylation, carboxylation, glycosylation, phosphorylation, lipidation and acylation.
El código genético está compuesto de cuatro
bases nucleotídicas que se organizan en combinaciones de tres bases
denominadas tripletes (codones). Estos codones son un total de 64
de los cuales 61 codifican para un total de 20 aminoácidos y 3 son
codones de terminación. Este fenómeno llamado degeneración del
código, sobradamente conocido en el estado de la técnica, hace
posible que diferentes secuencias nucleotídicas puedan dar lugar a
una única secuencia polipeptídica. En este sentido, la invención
también comprende todas aquellas secuencias degeneradas de SEQ ID
1, que codifican para SEQ ID 2 o fragmentos degenerados de SEQ ID
1, que codifican para fragmentos de SEQ
ID 2.The genetic code is composed of four nucleotide bases that are organized in combinations of three bases called triplets (codons). These codons are a total of 64 of which 61 code for a total of 20 amino acids and 3 are termination codons. This phenomenon called code degeneration, well known in the state of the art, makes it possible for different nucleotide sequences to give rise to a single polypeptide sequence. In this sense, the invention also comprises all those degenerate sequences of SEQ ID 1, which code for SEQ ID 2 or degenerate fragments of SEQ ID 1, which code for SEQ fragments
ID 2.
Las diferentes secuencias nucleotídicas o fragmentos de éstas, que pueden codificar para esta nueva isoforma de PSAP o fragmentos de ésta, pueden ser unidas a otras secuencias nucleotídicas mediante técnicas de ADN recombinante. Algunas de estas secuencias pueden ser vectores tales como plásmidos, cósmidos, derivados del fago lambda, fagémidos, entre otros. El conjunto formado por secuencias nucleotídicas o fragmentos de éstas, que pueden codificar para PSAPS o fragmentos de ésta, junto con las secuencias mencionadas conforman otro de los aspectos de la presente invención.The different nucleotide sequences or fragments of these, which can code for this new isoform PSAP or fragments thereof, can be linked to other sequences nucleotides by recombinant DNA techniques. Some of these sequences can be vectors such as plasmids, cosmids, phage lambda derivatives, phagemids, among others. He set consisting of nucleotide sequences or fragments of these, which can code for PSAPS or fragments thereof, together with the aforementioned sequences make up another aspect of the present invention
También presentes en el estado de la técnica están los sistemas de expresión en los que un vector y una célula huésped son empleados para la expresión de una proteína o fragmentos de ésta, los cuales también podrían ser empleados para la expresión de PSAPS. Las células huésped que generalmente son utilizadas son, aunque no se limitan a, bacterias, levaduras, células de insectos o células de mamíferos. Otro aspecto de esta invención también incluye a estos sistemas de expresión vector-célula huésped en los que el vector expresa a PSAPS o fragmentos de ésta.Also present in the state of the art are the expression systems in which a vector and a cell host are employed for the expression of a protein or fragments of it, which could also be used to PSAPS expression. The host cells that are generally used are, although not limited to, bacteria, yeasts, insect cells or mammalian cells. Another aspect of this invention also includes these expression systems vector-host cell in which the vector expresses to PSAPS or fragments thereof.
Dependiendo del tipo de sistema de expresión empleado, existen una serie de elementos de transcripción y traducción que pueden ser incluidos en éstos, como pueden ser promotores constitutivos o inducibles, reguladores de expresión (enhancers), entre otros, que pueden provenir de virus, bacterias, plantas, etc. Estas herramientas son empleadas generalmente cuando son necesarias células o líneas celulares que expresen una proteína en gran cantidad o en un momento concreto.Depending on the type of expression system employed, there are a number of transcription elements and translation that can be included in these, such as constitutive or inducible promoters, expression regulators (enhancers), among others, that may come from viruses, bacteria, plants, etc. These tools are generally used when cells or cell lines that express a protein are necessary in large quantity or at a specific time.
Los sistemas de expresión de proteínas, con o sin los elementos transcripcionales o traduccionales mencionados, son ampliamente empleados por ejemplo para la creación de proteínas de fusión que pueden ser utilizadas para el desarrollo de métodos para la generación de anticuerpos y llevar a cabo diferentes tipos de ensayos. De este modo, las proteínas de fusión pueden ser utilizadas tanto para la creación de anticuerpos contra PSAPS, como para la detección de proteínas que interaccionen con regiones concretas de ésta, mediante ensayos conocidos en el estado de la técnica, tales como yeast two-hybrid o phage dysplay system, entre otros. Son por tanto objeto de la presente invención tanto las proteínas de fusión generadas con PSAPS como con fragmentos de ésta, así como los métodos de obtención de anticuerpos y los ensayos en los que ésta sea empleada.Protein expression systems, with or without the aforementioned transcriptional or translational elements, they are widely used for example for the creation of proteins of fusion that can be used for the development of methods for the generation of antibodies and to carry out different types of trials. In this way, fusion proteins can be used for both the creation of antibodies against PSAPS, and for the detection of proteins that interact with regions concrete of this one, by means of tests known in the state of technique, such as yeast two-hybrid or phage dysplay system, among others. They are therefore the subject of this invention both fusion proteins generated with PSAPS and with fragments of it, as well as the methods of obtaining antibodies and assays in which it is used.
Una proteína de fusión de PSAPS comprende al menos dos polipéptidos fusionados. El primero de ellos puede comprender al menos 45, 75,100, 150, 200, 250, 300, 350 o 372 aminoácidos continuos de la SEQ ID 2 o fragmentos de éstos. El primer polipéptido puede comprender también a la secuencia completa de PSAPS. Preferentemente este primer polipéptido comprende a la SEQ ID 4 o fragmentos de ésta. Más preferentemente la proteína recombinante de fusión comprende la secuencia SEQ ID 6, que es codificada por la SEQ ID 5.A PSAPS fusion protein comprises the minus two fused polypeptides. The first of them can comprise at least 45, 75,100, 150, 200, 250, 300, 350 or 372 continuous amino acids of SEQ ID 2 or fragments thereof. He first polypeptide can also comprise the complete sequence of PSAPS. Preferably this first polypeptide comprises the SEQ ID 4 or fragments thereof. More preferably the protein recombinant fusion comprises the sequence SEQ ID 6, which is encoded by SEQ ID 5.
El segundo polipéptido puede comprender a una proteína completa o fragmentos de la misma. Generalmente las proteínas más comúnmente empleadas para la generación de proteínas de fusión son, pero no se limitan a, green fluorescent protein (GFP), autofluorescent proteins, including blue fluorescent protein (BFP), glutathione-S-transferase (GST), luciferase, horseradish peroxidase (HRP), y chloramphenicol acetyltransferase (CAT). Adicionalmente, epitope tags tales como histidine (His) tags, FLAG tags, influenza hemagglutinin (HA) tags, Myc tags, VSV-G tags, and thioredoxin (Trx) tags se emplean en la elaboración de proteínas de fusión, contra estos epítopos se desarrollan anticuerpos que permiten la detección y medición de la expresión de la proteína diana, en este caso PSAPS.The second polypeptide may comprise a complete protein or fragments thereof. Generally the proteins most commonly used for protein generation of fusion are, but are not limited to, green fluorescent protein (GFP), autofluorescent proteins, including blue fluorescent protein (BFP), glutathione-S-transferase (GST), luciferase, horseradish peroxidase (HRP), and chloramphenicol acetyltransferase (CAT). Additionally, epitope tags such as histidine (His) tags, FLAG tags, influenza hemagglutinin (HA) tags, Myc tags, VSV-G tags, and thioredoxin (Trx) tags se used in the elaboration of fusion proteins, against these epitopes develop antibodies that allow detection and measurement of target protein expression, in this case PSAPS
Existen un gran número de protocolos que pueden ser utilizados para detectar y medir la expresión de PSAPS, empleando anticuerpos mono o policlonales. Ejemplos de estos ensayos son enzyme-linked inmunosorbent assay (ELISA), radioimunoassay (RIA) y fluorescence activated cell sorting (FACS). Tanto los anticuerpos empleados, como los métodos en los que pueden ser empleados para el diagnóstico in vivo e in vitro, y más concretamente para detectar y medir la expresión de PSAPS son objeto de la presente invención.There are a large number of protocols that can be used to detect and measure PSAPS expression, using mono or polyclonal antibodies. Examples of these assays are enzyme-linked immunosorbent assay (ELISA), radioimunoassay (RIA) and fluorescence activated cell sorting (FACS). Both the antibodies used, and the methods in which they can be used for in vivo and in vitro diagnosis, and more specifically to detect and measure PSAPS expression are the subject of the present invention.
Métodos para el aislamiento de polinucleótidos son bien conocidos en el estado de la técnica. Técnicas en la que se emplean enzimas de restricción o sondas para el aislamiento de polinucleótidos, que codifiquen para PSAPS son actualmente rutinarias en los laboratorios de biología molecular. Con este tipo de procedimientos es posible conseguir polinucleótidos con un 70, 80 o 90% libres de otras moléculas o incluso prácticamente puros.Methods for polynucleotide isolation They are well known in the state of the art. Techniques in which restriction enzymes or probes are used for the isolation of polynucleotides, which code for PSAPS are currently Routine in molecular biology laboratories. With this guy of procedures it is possible to get polynucleotides with a 70, 80 or 90% free of other molecules or even practically cigars
Otro de los métodos empleados para la obtención
de secuencias polinucleotídicas, que codifiquen para una proteína
concreta consiste en la secuenciación directa del ADN
complementario (cDNA) o su obtención a partir de ARN mensajero
(mRNA). Moléculas de cDNA de PSAPS pueden ser obtenidas y
replicadas por técnicas convencionales pertenecientes al estado de
la técnica, tales como la reacción en cadena de la polimerasa (PCR)
para su aplicación en sistemas de expresión
vector-huésped tal y como han sido descritos
anteriormente. Son objeto de la presente invención todas aquellas
secuencias polinucleotídicas que son obtenidas a través de las
metodologías mencionadas y que codifican para PSAPS o fragmentos de
ésta, así como los métodos que se emplean para su obtención
y/o
detección.Another of the methods used to obtain polynucleotide sequences, which code for a specific protein consists in the direct sequencing of complementary DNA (cDNA) or its obtaining from messenger RNA (mRNA). PSAPS cDNA molecules can be obtained and replicated by conventional techniques pertaining to the prior art, such as polymerase chain reaction (PCR) for application in vector-host expression systems as described above. The object of the present invention are all those polynucleotide sequences that are obtained through the aforementioned methodologies and that code for PSAPS or fragments thereof, as well as the methods used to obtain and / or
detection.
Los ensayos para la detección de polinucleótidos que codifiquen para PSAPS o fragmentos de éstos en una muestra pueden ser llevados a cabo con métodos que comprendan: i) poner en contacto un polinucleótido que comprenda a la SEQ ID 1 o fragmentos de ésta, polinucleótido que codifique para SEQ ID 2 o fragmentos de ésta, polinucleótido degenerado que codifique para un polipéptido que tiene la actividad de PSAPS, con una muestra que contiene ácido nucleico para la formación de un complejo de hibridación, ii) detección del mencionado complejo de hibridación. En una realización preferida de este aspecto de la invención, el ácido nucleico es amplificado.Assays for the detection of polynucleotides that code for PSAPS or fragments of these in a sample they can be carried out with methods that include: i) put in contact a polynucleotide comprising SEQ ID 1 or fragments of this, polynucleotide encoding SEQ ID 2 or fragments of this, degenerate polynucleotide encoding a polypeptide that has the activity of PSAPS, with a sample containing acid nucleic for the formation of a hybridization complex, ii) detection of said hybridization complex. In a preferred embodiment of this aspect of the invention, the acid Nucleic is amplified.
El diseño de cebadores para su empleo en la técnica anteriormente mencionada como reacción en cadena de la polimerasa (PCR) y sus variantes, es un procedimiento ampliamente conocido en el estado de la técnica, existiendo reglas claramente definidas para su desarrollo (PCR Protocols, Devlin et al.). Otro aspecto de la invención comprende a cebadores capaces de amplificar las secuencias nucleotídicas o fragmentos de éstas, que son capaces de codificar a la nueva isoforma de PSAP, la SEQ ID 1, o fragmentos de ésta. Preferentemente estos cebadores amplifican la SEQ ID 3. Más preferentemente estos cebadores tienen secuencias que comprenden a cualquiera de las SEQ ID 7 y SEQ ID 8.The design of primers for use in the aforementioned technique as polymerase chain reaction (PCR) and its variants, is a widely known procedure in the state of the art, there are clearly defined rules for its development (PCR Protocols, Devlin et al .). Another aspect of the invention comprises primers capable of amplifying nucleotide sequences or fragments thereof, which are capable of encoding the new PSAP isoform, SEQ ID 1, or fragments thereof. Preferably these primers amplify SEQ ID 3. More preferably these primers have sequences comprising any of SEQ ID 7 and SEQ ID 8.
Otro de los aspectos de la presente invención consiste en proveer de moléculas terapéuticamente activas que modulen la actividad de PSAPS y que puedan ser empleadas para el tratamiento de enfermedades, que incluyen, pero no se limitan a, Alzheimer y diferentes tipos de cáncer.Another aspect of the present invention it consists of providing therapeutically active molecules that modulate the activity of PSAPS and that can be used for treatment of diseases, which include, but are not limited to, Alzheimer's and different types of cancer.
Este tipo de ensayos pueden emplear tanto a proteínas completas de PSAPS, un fragmento biológicamente activo de ésta o a proteínas de fusión, que incluyan a PSAPS o fragmentos de ésta. Los compuestos testados pueden ser obtenidos por ejemplo de librerías de compuestos convencionales. La determinación de la interacción puede ser determinada mediante el marcaje del compuesto a testar con un radioisótopo (35S, 14C, 3H...) o una enzima (fosfatasa alcalina, peroxidasa, luciferasa) que posteriormente son detectados con diferentes tipos de técnicas ampliamente conocidas en el estado de la técnica.These types of tests can use both complete proteins of PSAPS, a biologically active fragment of this or fusion proteins, which include PSAPS or fragments of is. The tested compounds can be obtained for example from libraries of conventional compounds. The determination of the interaction can be determined by compound marking to be tested with a radioisotope (35S, 14C, 3H ...) or an enzyme (alkaline phosphatase, peroxidase, luciferase) which are subsequently detected with different types of widely known techniques in the state of the art.
Ensayos de unión competitiva a ligando pueden ser también utilizados para la detección de interacciones proteína-proteína. Este tipo de estudios consisten en poner en contacto a un compuesto cuya interacción con PSAPS es conocida y una molécula cuya interacción con PSAPS no lo sea con una célula que exprese PSAPS o un sistema libre de células en el que se exprese PSAPS. La facilidad o habilidad del compuesto testado para unirse con PSAPS es determinada mediante la comparación con el compuesto cuya interacción es conocida.Competitive ligand binding assays can be also used for the detection of interactions protein-protein These types of studies consist of in contacting a compound whose interaction with PSAPS is known and a molecule whose interaction with PSAPS is not with a cell that expresses PSAPS or a cell-free system in which PSAPS is expressed. The ease or ability of the tested compound to join with PSAPS is determined by comparing with the compound whose interaction is known.
Métodos para la determinación de compuestos que modulen la actividad de PSAPS pueden ser realizados poniendo en contacto a un conjunto de células que expresen a PSAPS (la proteína completa, fragmentos de ésta biológicamente activos, proteínas de fusión que incluyan a la isoforma completa de PSAPS o fragmentos de ésta) con compuestos potencialmente moduladores de la actividad de PSAPS, en donde la medición de la actividad del compuesto testado puede ser llevada a cabo mediante métodos incluidos en el estado de la técnica.Methods for the determination of compounds that modulate the activity of PSAPS can be performed by putting in contact to a set of cells that express PSAPS (the protein complete, biologically active fragments thereof, proteins from fusion that include the complete PSAPS isoform or fragments of this one) with potentially modulating compounds of the activity of PSAPS, where the measurement of the activity of the tested compound it can be carried out by methods included in the state of The technique.
La determinación de la habilidad de un compuesto para modular la actividad de PSAP puede ser llevado a cabo mediante estudios, que incluyen, pero no se limitan a, análisis morfológicos y bioquímicos (J Biol Chem. 2002 Dec 13;277(50):48913-22. Epub 2002 Oct 10. The novel presenilin-1-associated protein is a proapoptotic mitochondrial protein) de células que expresan o sobreexpresan PSAPS en presencia o ausencia de un compuesto cuya actividad se desea testar.The determination of the ability of a compound to modulate the activity of PSAP can be carried out by studies, which include, but are not limited to, morphological analyzes and biochemists (J Biol Chem. 2002 Dec 13; 277 (50): 48913-22. Epub 2002 Oct 10. The novel presenilin-1-associated protein is a proapoptotic mitochondrial protein) of cells that express or overexpress PSAPS in the presence or absence of a compound whose activity you want to test.
Los siguientes ejemplos de realización no pretenden limitar la invención, sino ilustrarla para su mejor comprensión.The following embodiments do not they intend to limit the invention, but to illustrate it for its best understanding.
Se ha utilizado la técnica de PCR preparativa de alta fidelidad, empleando la ADN polimerasa de Pyrococcus furiosus (Pfu polimerasa, Stratagene) para obtener fragmentos de PSAP que codifican para SEQ ID 4, que han sido expresados en bacterias como fusiones a GST. Se han purificado las proteínas recombinantes y han sido empleadas como antígenos para la inmunización de conejos y generar así anticuerpos policlonales contra PSAP.The high fidelity preparative PCR technique has been used, using Pyrococcus furiosus DNA polymerase (Pfu polymerase, Stratagene) to obtain PSAP fragments encoding SEQ ID 4, which have been expressed in bacteria as GST fusions. Recombinant proteins have been purified and used as antigens for the immunization of rabbits and thus generate polyclonal antibodies against PSAP.
Como ADN molde se empleó un clon obtenido de Invitrogen (clon CS0DE007YK11), aunque se puede utilizar también como ADN molde cDNA de diversos tejidos humanos (corazón, cerebro, placenta, pulmón, hígado, riñón, páncreas, bazo, timo, próstata, testículo, ovario, intestino, colon y leucocito). Los cebadores utilizados tienen las secuencias SEQ ID 7 y SEQ ID 8.As a template DNA, a clone obtained from Invitrogen (clone CS0DE007YK11), although it can also be used as cDNA template DNA of various human tissues (heart, brain, placenta, lung, liver, kidney, pancreas, spleen, thymus, prostate, testis, ovary, intestine, colon and leukocyte). The primers used have the sequences SEQ ID 7 and SEQ ID 8.
Las reacciones de PCR se llevaron a cabo usando un termociclador MJ Research Minicycler con una ADN polimerasa de alta fidelidad, la polimerasa de Pyrococcus furiosus (PfuTurbo DNA polymerase de Stratagene, cat # 600250). Cada reacción se realizó en un volumen de 50 \mul conteniendo 100 pg de ADN molde, 5 \mul de buffer de reacción de la polimerasa, 20 pmol de cada cebador, 0,25 mM dATP, 0,25 mM dGTP, 0,25 mM dCTP, 0,25 mM TTP y 2.5 unidades de polimerasa. Se realizó un primer paso de desnaturalización a 94ºC durante 2 minutos, seguido de 30 ciclos consistentes en un paso de desnaturalización a 94ºC durante 30 segundos, uno de anillamiento a 60ºC durante 30 segundos y uno de extensión a 72ºC durante 15 segundos, terminando con una incubación a 72ºC durante 10 minutos. Los productos obtenidos se analizaron mediante electroforesis en geles de agarosa 2% en buffer TBE (0,5 M Tris base, 0,5 mM ácido bórico, 10 mM EDTA) y se visualizaron mediante tinción con bromuro de etidio (0,5 \mug/ml durante 15 minutos a temperatura ambiente) usando un transiluminador de luz ultravioleta.PCR reactions were carried out using an MJ Research Minicycler thermocycler with a high fidelity DNA polymerase, Pyrococcus furiosus polymerase (Stratagene PfuTurbo DNA polymerase, cat # 600250). Each reaction was performed in a volume of 50 µl containing 100 pg of template DNA, 5 µl of polymerase reaction buffer, 20 pmol of each primer, 0.25 mM dATP, 0.25 mM dGTP, 0.25 mM dCTP, 0.25 mM TTP and 2.5 polymerase units. A first denaturation step was carried out at 94 for 2 minutes, followed by 30 cycles consisting of a denaturation step at 94 for 30 seconds, one for banding at 60 for 30 seconds and one for extension at 72 for 15 seconds, ending with a incubation at 72 ° C for 10 minutes. The products obtained were analyzed by electrophoresis in 2% agarose gels in TBE buffer (0.5 M Tris base, 0.5 mM boric acid, 10 mM EDTA) and visualized by staining with ethidium bromide (0.5 µg / ml for 15 minutes at room temperature) using an ultraviolet light transilluminator.
El producto de PCR correspondiente a la SEQ ID 3 de PSAP se clonó en el vector pGEX-3X (Amersham), previamente linearizado con la enzima Sma I (Roche), mediante ligación de extremos romos. La reacción de ligación, en un volumen de 20 \mul, contenía 5 ng de producto de PCR, 50 ng de vector, 66 mM Tris-HCI, pH 7,6, 6,6 mM MgCl_{2}, 10 mM DTT, 66 \muM ATP y 1 unidad de ADN ligasa de T4 (USB). La reacción se incubó a temperatura ambiente (22ºC) durante 16 horas. Se usaron 5 \mul de la reacción de ligación para transformar células competentes E. coli DH5\alpha (Invitrogen), usando procedimientos estándar. Las bacterias transformadas se sembraron en placas de medio LB-agar (Luria-Bertani: 10 g bacto-triptona, 5 g extracto de levadura, 10 g NaCl, pH 7,5, y 15 g de agar, por litro) conteniendo 100 \mug/ml de ampicilina, y se incubaron a 37ºC durante al menos 16 horas. Las colonias se analizaron mediante PCR analítica utilizando la polimerasa termoestable de Biotools (cat# 10.012) usando los cebadores PGEXFP (5'-TATAGCATGGCCTTTGCAGG-3) y PSAPTH2, y las mismas condiciones de PCR descritas anteriormente. Las colonias que contenían el inserto de ADN en la orientación correcta se utilizaron para hacer preparaciones de ADN a pequeña escala (Eppendorf Plasmidprep Perfect Mini). Este ADN se secuenció para confirmar que correspondía a la construcción deseada, con el fragmento de PSAP en el mismo marco de lectura que la glutation S-transferasa (GST) codificada en el vector. El clon correcto se denominó pJAC244.The PCR product corresponding to PSQ SEQ ID 3 was cloned into the vector pGEX-3X (Amersham), previously linearized with the enzyme Sma I (Roche), by blunt-end ligation. The ligation reaction, in a volume of 20 µl, contained 5 ng of PCR product, 50 ng of vector, 66 mM Tris-HCI, pH 7.6, 6.6 mM MgCl2, 10 mM DTT, 66 µM ATP and 1 unit of T4 DNA ligase (USB). The reaction was incubated at room temperature (22 ° C) for 16 hours. 5 µl of the ligation reaction was used to transform competent E. coli DH5α cells (Invitrogen), using standard procedures. The transformed bacteria were plated on LB-agar medium plates (Luria-Bertani: 10 g bacto-tryptone, 5 g yeast extract, 10 g NaCl, pH 7.5, and 15 g agar, per liter) containing 100 mug / ml ampicillin, and incubated at 37 ° C for at least 16 hours. Colonies were analyzed by analytical PCR using Biotools thermostable polymerase (cat # 10.012) using primers PGEXFP (5'-TATAGCATGGCCTTTGCAGG-3) and PSAPTH2, and the same PCR conditions described above. Colonies containing the DNA insert in the correct orientation were used to make small-scale DNA preparations (Eppendorf Plasmidprep Perfect Mini). This DNA was sequenced to confirm that it corresponded to the desired construct, with the PSAP fragment in the same reading frame as the glutathione S-transferase (GST) encoded in the vector. The correct clone was named pJAC244.
Los vectores preparados en bacterias E. coli DH5\alpha se utilizaron para transformar E. coli BL21Gold (DE3) de Stratagene, usando métodos estándar. Cuatro colonias de cada clon se analizaron directamente mediante inducción de expresión a pequeña escala. Para ello, se picaron cuatro colonias de cada placa y se crecieron en 4 ml de medio LB conteniendo 100 \mug/ml de ampicilina, a 37ºC, con agitación (250 rpm) hasta una OD de 0,5 a 600 nm. Cada cultivo se dividió en dos, induciendo la expresión en uno de ellos y dejando el otro como control negativo. La expresión se indujo mediante adición de IPTG (Isopropiltio-\beta-D-galactósido, Invitrogen) 100 mM a una concentración final de 1 mM, continuando la expresión durante dos horas en las mismas condiciones. Como control de la expresión se usaron bacterias transformadas con pGEX-3X, que expresan GST sola.Vectors prepared in E. coli DH5α bacteria were used to transform E. coli BL21Gold (DE3) from Stratagene, using standard methods. Four colonies of each clone were analyzed directly by induction of small-scale expression. To do this, four colonies of each plate were chopped and grown in 4 ml of LB medium containing 100 µg / ml of ampicillin, at 37 ° C, with stirring (250 rpm) to an OD of 0.5 to 600 nm. Each crop was divided into two, inducing expression in one of them and leaving the other as a negative control. Expression was induced by the addition of 100 mM IPTG (Isopropylthio-? -D-galactoside, Invitrogen) at a final concentration of 1 mM, the expression continuing for two hours under the same conditions. Bacteria transformed with pGEX-3X, expressing GST alone, were used as expression control.
\newpage\ newpage
La expresión se determinó analizando las proteínas bacterianas mediante electroforesis en geles desnaturalizantes de acrilamida (SDS-PAGE de Laemli; 37,5:1 acrilamida:bisacrilamida) usando un aparato Mini Protean II de BioRad. La concentración de acrilamida utilizada fue del 10% para el gel inferior y del 4% para el superior. 200 \mul de bacterias se centrifugaron a 14000 g durante 1 minuto, se eliminó el sobrenadante y se resuspendieron en 50 \mul de buffer de carga con SDS (20 mM DTT, 62,5 mM Tris, pH 6,8, 10% glicerol, 2% SDS, 0,03% azul de bromofenol, 0,2 M Tris base), incubando las muestras durante 5 minutos a 100ºC para lisar las bacterias. Se cargaron 20 \mul en cada pocillo del gel de acrilamida. Tras la electroforesis, los geles se tiñeron con azul de coomassie usando métodos estándar. Las proteínas de fusión recombinantes, codificadas en el vector pJAC244 produjeron bandas de proteína más intensas que las proteínas bacterianas endógenas, con tamaños que concordaban con los esperados; 32,8 kDa (280 aminoácidos) para la proteína codificada por pJAC244. Los clones que producían niveles más altos de proteínas recombinantes se utilizaron para hacer cultivos a mayor escala.Expression was determined by analyzing the bacterial proteins by electrophoresis in gels Acrylamide denaturants (SDS-PAGE of Laemli; 37.5: 1 acrylamide: bisacrylamide) using a Mini device Protean II from BioRad. The acrylamide concentration used was 10% for the lower gel and 4% for the upper one. 200 \ mul of bacteria were centrifuged at 14000 g for 1 minute, removed supernatant and resuspended in 50 µl of buffer SDS loading (20 mM DTT, 62.5 mM Tris, pH 6.8, 10% glycerol, 2% SDS, 0.03% bromophenol blue, 0.2 M Tris base), incubating the samples for 5 minutes at 100 ° C to lyse the bacteria. Be loaded 20 µl into each well of the acrylamide gel. Behind the electrophoresis, the gels were stained with coomassie blue using standard methods Recombinant fusion proteins, encoded in the vector pJAC244 produced more protein bands intense than endogenous bacterial proteins, with sizes that they agreed with those expected; 32.8 kDa (280 amino acids) for protein encoded by pJAC244. The clones that produced levels higher recombinant proteins were used to make larger scale crops
Para la expresión a una escala mayor, para purificación de proteínas, se creció primero un cultivo de 5 ml durante 16 horas a 37ºC en medio LB con ampicilina. Este cultivo se utilizó para inocular 250 ml de medio LB con ampicilina, incubando con agitación a 37ºC hasta alcanzar una OD a 600 nm de 0,5. El cultivo se enfrió a temperatura ambiente (22ºC), se añadió IPTG a una concentración final de 1 mM y se incubó durante 3 horas a 22ºC con agitación (250 rpm).For expression on a larger scale, to protein purification, a 5 ml culture was first grown for 16 hours at 37 ° C in LB medium with ampicillin. This crop is used to inoculate 250 ml of LB medium with ampicillin, incubating with stirring at 37 ° C until reaching an OD at 600 nm of 0.5. He culture was cooled to room temperature (22 ° C), IPTG was added at a final concentration of 1 mM and incubated for 3 hours at 22 ° C with stirring (250 rpm).
Las proteínas recombinantes se recogieron mediante centrifugación, se lavaron con varios volúmenes de medio STE (10 mM Tris-HCI, 150 mM NaCl, 1 mM EDTA, 1% Triton X-100, 5 mM DTT, 200 \muM phenyl-metyl-sulphonyl fluoride) y se resuspendieron en 5 ml de medio STE. A continuación se lisaron mediante sonicación y el lisado se sometió a centrifugación durante 15 minutos a 16000 g a 4ºC, para separar el material soluble del insoluble. La proteína recombinante era insoluble y estaba presente en el precipitado, formando cuerpos de inclusión. Estos cuerpos de inclusión se lavaron mediante resuspensión en medio STE y centrifugación varias veces, dando lugar a la proteína recombinante deseada con una pureza superior al 90%. Para obtener proteína más pura los cuerpos de inclusión se solubilizaron mediante resuspensión en 1 ml de medio STE conteniendo 8 M urea y se incubaron en el mismo, rotando, durante 30 minutos a 22ºC. El material no solubilizado se eliminó mediante centrifugación a 16000 g durante 15 minutos. La proteína desnaturalizada en urea se renaturalizó mediante dilución rápida, gota a gota, de la solución de urea en 25 ml de medio STE sin urea, agitando tras la adición de cada gota. La solución final se centrifugó 15 minutos a 16000 g a 4ºC para eliminar proteína insoluble. La proteína soluble se purificó mediante cromatografía de afinidad en columnas de glutation reducido unido a sefarosa (BD). El método utilizado es el conocido como método "batch", en el que no se utilizan columnas de cromatografía, sino que se realiza la unión proteína-matriz en solución, recogiendo a continuación la matriz con la proteína unida mediante centrifugación a 300 g durante 30 segundos. La matriz utilizada fue la Glutathione uniflow resin, de BD (cat # 635610). Usando 500 \mul de suspensión de resina (50% resina) por cada 50 ml de cultivo bacteriano de partida. Los lavados se realizaron mediante resuspensión de la matriz en medio STE, agitación suave mediante vórtex y posterior centrifugación en las mismas condiciones, eliminado el sobrenadante tras cada lavado. Se realizaron un mínimo de tres lavados en al menos 1 ml de medio STE para eliminar proteínas unidas de forma no específica. La elución se llevó a cabo mediante resuspensión de la matriz en medio STE conteniendo 20 mM glutation reducido. El método también es fácilmente adaptable a la purificación en columna, lo que facilita la purificación de la proteína a mayor escala.Recombinant proteins were collected by centrifugation, they were washed with several volumes of medium STE (10 mM Tris-HCI, 150 mM NaCl, 1 mM EDTA, 1% Triton X-100, 5 mM DTT, 200 µM phenyl-metyl-sulphonyl fluoride) and they were resuspended in 5 ml of STE medium. They were then lysed by sonication and the lysate was subjected to centrifugation during 15 minutes at 16000 g at 4 ° C, to separate the soluble material from the insoluble. The recombinant protein was insoluble and was present. in the precipitate, forming inclusion bodies. These bodies of inclusion were washed by resuspension in STE medium and centrifugation several times, resulting in recombinant protein desired with a purity greater than 90%. To get more protein pure inclusion bodies were solubilized by resuspension in 1 ml of STE medium containing 8 M urea and incubated therein, rotating, for 30 minutes at 22 ° C. He Unsolubilized material was removed by centrifugation at 16000 g for 15 minutes. Denatured urea protein is renaturated by rapid dilution, drop by drop, of the solution of urea in 25 ml of STE medium without urea, stirring after the addition of every drop The final solution was centrifuged 15 minutes at 16000 g at 4 ° C to eliminate insoluble protein. The soluble protein is purified by affinity chromatography on columns of reduced glutathione bound to sepharose (BD). The method used is the known as the "batch" method, in which they are not used chromatography columns, but the junction is performed protein-matrix in solution, collecting then the matrix with the protein bound by centrifugation at 300 g for 30 seconds. The matrix used was BD Glutathione uniflow resin (cat # 635610). Using 500 µl of resin suspension (50% resin) per 50 ml of starting bacterial culture. The washes were performed by resuspension of the matrix in STE medium, gentle agitation by vortex and subsequent centrifugation under the same conditions, removed the supernatant after each wash. They made a minimum of three washes in at least 1 ml of STE medium to remove non-specific bound proteins. The elution was carried out by resuspension of the matrix in STE medium containing 20 mM reduced glutathione The method is also easily adaptable to the column purification, which facilitates the purification of the protein on a larger scale.
La proteína purificada fue posteriormente dializada en buffer PBS para eliminar el glutation y se empleó para formar una emulsión con adyuvante de Freund.The purified protein was subsequently dialyzed in PBS buffer to eliminate glutathione and was used to form an emulsion with Freund's adjuvant.
Las inmunizaciones de conejos New Zeland White se llevaron a cabo mediante la administración de una primera dosis mediante inyección subcutánea, en el dorso del conejo, de una emulsión que contenía 500 microlitros de adyuvante de Freund completo (Sigma F-5881) y 500 microlitros de solución de proteína (2 mg) en PBS. Las dosis de refuerzo se realizaron con una emulsión similar pero que contenía adyuvante de Freund incompleto (Sigma F-5506) en lugar del completo. Cada dosis se repartió en dos inyecciones en dos zonas distintas del dorso del conejo. Se realizaron cuatro inyecciones, separadas 21 días entre sí.Immunizations of New Zeland White rabbits were carried out by administering a first dose by subcutaneous injection, on the back of the rabbit, of a emulsion containing 500 microliters of Freund's adjuvant complete (Sigma F-5881) and 500 microliters of protein solution (2 mg) in PBS. Booster doses are performed with a similar emulsion but containing adjuvant of Incomplete Freund (Sigma F-5506) instead of full. Each dose was divided into two injections in two zones other than the back of the rabbit. Four injections were made, 21 days apart from each other.
Se obtuvo sangre de los conejos, entre 5 y 10 ml en cada sangrado, a través de la vena de la oreja usando agujas de venoclisis (Venofix, Braun) y jeringuillas de volúmenes adecuados, recogiendo la sangre en tubos de extracción de sangre al vacío (Vacutainer, BD). La sangre se dejó coagular a 4ºC durante varias horas. El suero se recogió con pipetas Pasteur, evitando el coágulo, y se limpió mediante centrifugación a 14000 g durante 1 minuto. Para su almacenamiento, se distribuyó en alícuotas en microtubos de 1.5 ml (Eppendorf) y se congeló a -20ºC.Blood was obtained from rabbits, between 5 and 10 ml at each bleeding, through the ear vein using needles venoclysis (Venofix, Braun) and syringes of suitable volumes, collecting blood in vacuum blood collection tubes (Vacutainer, BD). The blood was allowed to clot at 4 ° C for several hours. The serum was collected with Pasteur pipettes, avoiding clot, and cleaned by centrifugation at 14000 g for 1 minute. For storage, it was distributed in aliquots in 1.5 ml microtubes (Eppendorf) and frozen at -20 ° C.
Para los ensayos de inmunoadsorción, usando la técnica de western blot, se procedió a la electroforesis (SDS-PAGE) de muestras de diverso origen que contenían PSAP y posterior transferencia a membranas de fluoruro de polivinilideno (PVDF, BioTrace) usando un Mini Trans-Blot Cell de Bio-Rad. Tras la transferencia, las membranas se bloquearon en solución de bloqueo (PBS conteniendo 5% Tween-20 (Q-Biogene) y 0,5% leche desnatada en polvo (Central Lechera Asturiana)) durante 30 minutos a temperatura ambiente. A continuación se añadió el antisuero anti-PSAP a distintas concentraciones. Para la mayoría de los ensayos, una dilución 1:5000 dio buenos resultados. La incubación con el antisuero se realizó durante al menos tres horas en la misma solución de bloqueo. Tras este tiempo, las membranas se lavaron varias veces con la misma solución, pero sin leche, y se incubaron posteriormente con anticuerpo secundario en solución de bloqueo durante al menos una hora a temperatura ambiente. El anticuerpo secundario utilizado fue un anti-conejo, preparado en cabra, y conjugado a la peroxidasa del rabanito (horse-radish peroxidase, hrp), de Sigma (A-0545), usado a una dilución 1:5000. Las membranas se lavaron varias veces en solución de bloqueo sin leche y se procedió al revelado usando la técnica de ECL (enhanced chemiluminescence). Para ello se utilizó el ECL Plus Western Blotting Detection System de Amersham, siguiendo las instrucciones recomendadas por el fabricante. Las imágenes se obtuvieron empleando película Hyperfilm ECL de Amersham.For immunoadsorption assays, using the Western blot technique, electrophoresis was performed (SDS-PAGE) of samples of diverse origin that contained PSAP and subsequent transfer to fluoride membranes of Polyvinylidene (PVDF, BioTrace) using a Mini Trans-Blot Cell from Bio-Rad. Behind the transfer, the membranes were blocked in blocking solution (PBS containing 5% Tween-20 (Q-Biogene) and 0.5% skim milk powder (Central Lechera Asturiana)) for 30 minutes at temperature ambient. Then the antiserum was added anti-PSAP at different concentrations. For the Most trials, a 1: 5000 dilution gave good results. Incubation with the antiserum was performed for at least three hours in the same blocking solution. After this time, the membranes were washed several times with the same solution, but without milk, and subsequently incubated with secondary antibody in blocking solution for at least one hour at temperature ambient. The secondary antibody used was a anti-rabbit, prepared in goat, and conjugated to the radish peroxidase (horse-radish peroxidase, hrp), from Sigma (A-0545), used at a dilution 1: 5000 The membranes were washed several times in solution of blockade without milk and was developed using the technique of ECL (enhanced chemiluminescence). For this, the ECL Plus was used Western Blotting Detection System by Amersham, following the instructions recommended by the manufacturer. The images are obtained using Amersham Hyperfilm ECL film.
Gran cantidad de moléculas que afecten a la actividad de PSAPS o a la expresión del gen que la codifica pueden ser primeramente creadas aleatoriamente por química combinatoria, o diseñadas específicamente para posteriormente ser analizadas mediante high throughput screening (HTS). El empleo de HTS permite que muchos compuestos puedan ser analizados simultáneamente en paralelo, de modo que el análisis puede realizarse muy rápidamente (Houston J.G., Manks M., The chemical-biological interface: Developments in automated and miniaturised screening technology. Current Opinion in Biotechnology, Vol. 8, 1997). Generalmente este tipo de técnicas suelen emplear las conocidas placas de 96 pocillos, del inglés 96-well microtiter plates que generalmente requieren de unos volúmenes de muestra de entre 50 y 500 microlitros por pocillo para llevar a cabo los experimentos. Adicionalmente el resto de instrumentos, aparatos para mecanizar el procedimiento de cargado y lectura de platos, etc. están ampliamente difundidos y están disponibles comercialmente.Large number of molecules that affect the PSAPS activity or the expression of the gene that encodes it can be first created randomly by combinatorial chemistry, or specifically designed for later analysis by high throughput screening (HTS). The use of HTS allows that many compounds can be analyzed simultaneously in parallel, so that the analysis can be done very quickly (Houston J.G., Manks M., The chemical-biological interface: Developments in automated and miniaturized screening technology. Current Opinion in Biotechnology, Vol. 8, 1997). Generally these types of techniques usually use the known 96-well plates, from 96-well English microtiter plates that generally require volumes of sample between 50 and 500 microliters per well to carry Out experiments. Additionally the rest of the instruments, apparatus for machining the loading and reading procedure of dishes, etc. They are widely disseminated and available commercially
En el estado de la técnica podemos encontrar gran cantidad de ensayos para la detección de interacciones proteína-proteína, que nos permitan en definitiva la detección de compuestos que interaccionen con PSAPS y que puedan afectar a su actividad. Algunos ejemplos de estos estudios pueden ser encontrados en Beutel et al. U.S. Patent 5,976,813, en donde las muestras problema son cargadas en una matriz porosa, Jayawickreme et al., Proc. Natl. Acad. Sci. U. S. A.19, 1614-18 (1994), entre otros. Algunos de los ensayos más comúnmente empleados son mencionados a continuación:In the state of the art we can find a large number of assays for the detection of protein-protein interactions, which ultimately allow us to detect compounds that interact with PSAPS and that may affect their activity. Some examples of these studies can be found in Beutel et al . US Patent 5,976,813, where the problem samples are loaded into a porous matrix, Jayawickreme et al ., Proc. Natl Acad. Sci. USA19, 1614-18 (1994), among others. Some of the most commonly used trials are mentioned below:
- \ding{226}\ ding {226}
- Ensayos de interacción proteína-proteína (binding assay). En este tipo de ensayos, generalmente un péptido de pequeño tamaño es testado para comprobar la inhibición de la actividad de una proteína concreta. Este tipo de ensayos también pueden ser llevados a cabo mediante metodologías, tales como real-time Bimolecular Interaction Analysis (BIA) (Sjolander & Urbaniczky, Anal. Chem. 63,2338-2345, 1991, and Szabo et al., Curr. Opin. Struct. Biol.5, 699-705,1995).Protein-protein interaction assays (binding assay). In this type of assay, a small peptide is generally tested to check the inhibition of the activity of a specific protein. Such tests can also be carried out using methodologies, such as real-time Bimolecular Interaction Analysis (BIA) (Sjolander & Urbaniczky, Anal. Chem. 63,2338-2345, 1991, and Szabo et al ., Curr. Opin Struct. Biol. 5, 699-705, 1995).
- \ding{226}\ ding {226}
- Ensayo de doble-híbrido (Two-hybrid screening). Este tipo de técnicas también son empleadas para la identificación de interacciones proteína-proteína (Szabo et al., (1995); Zervos et al. (1993); Madura et al.1993).Double-hybrid screening. These types of techniques are also used for the identification of protein-protein interactions (Szabo et al ., (1995); Zervos et al . (1993); Madura et al. 1993).
- \ding{226}\ ding {226}
- Ensayo de unión competitiva a ligando (competitive ligand binding assay) (Timothy Zacharewski, Dept. of Biochemistry, Michigan State University, Lansing, MI, USA. October 2002. Protocol for the competitive Ligand Binding Assay).Competitive union test a ligand (competitive ligand binding assay) (Timothy Zacharewski, Dept. of Biochemistry, Michigan State University, Lansing, MI, USA. October 2002. Protocol for the competitive Ligand Binding Assay)
Uno de los mayores éxitos del diseño racional de drogas consiste en el hecho de poder conseguir análogos estructurales biológicamente activos, tales como polipéptidos o pequeñas moléculas que mimetizan a éstos, que pueden actuar como agonistas, antagonistas o inhibidores. Un ejemplo de estas técnicas la podemos encontrar en Zhaowen Lao et al. J. Chem. Inf. Comput. Sci.1996. 36, 1187-1194, A new method for structure-based drug design).One of the greatest successes of the rational design of drugs consists in being able to achieve biologically active structural analogues, such as polypeptides or small molecules that mimic these, which can act as agonists, antagonists or inhibitors. An example of these techniques can be found in Zhaowen Lao et al . J. Chem. Inf. Comput. Sci. 1996. 36, 1187-1194, A new method for structure-based drug design).
En una primera aproximación, la estructura tridimensional de proteínas de interés es determinada mediante cristalografía de rayos X, mediante modelado por ordenador y más comúnmente por combinación de ambas técnicas. La información estructural que se obtiene de estos estudios proporciona información que va a permitir el desarrollo de inhibidores, agonistas o antagonistas que actúen contra la proteína diana. Una vez producidos estos nuevos agentes son estudiados por diferentes técnicas que van a determinar la actividad de los mismos.In a first approximation, the structure three-dimensional protein of interest is determined by X-ray crystallography, by computer modeling and more commonly by combination of both techniques. Information structural that is obtained from these studies provides information that will allow the development of inhibitors, agonists or antagonists that act against the target protein. A once produced these new agents are studied by different techniques that will determine their activity.
Este tipo de ensayos (functional assays) en combinación con ensayos de diseño y los ensayos de interacción, que se han descrito previamente pueden llegar a la determinación de compuestos con actividad moduladora de la proteína diana, en este caso PSAPS. Si el compuesto detectado es capaz de modular, incrementar o disminuir, la actividad, al menos un 10%, preferiblemente un 50% y más preferiblemente un 75, 90 o 100% este podrá ser entendido como un buen modulador de la actividad de PSAPS.This type of tests (functional assays) in combination with design tests and interaction tests, which previously described may reach the determination of compounds with modulating activity of the target protein, in this PSAPS case. If the detected compound is capable of modulating, increase or decrease the activity, at least 10%, preferably 50% and more preferably 75, 90 or 100% this It can be understood as a good modulator of the activity of PSAPS
<110> UNIVERSIDAD DE ZARAGOZA<110> UNIVERSITY OF ZARAGOZA
\vskip1.000000\baselineskip\ vskip1.000000 \ baselineskip
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<120> NUEVA ISOFORAMA DE PSAP, MÉTODO DE OBTENCIÓN DE ANTICUERPOS Y USO DE LOS MISMOS<120> NEW PSAP ISOFORM, METHOD OF OBTAINING ANTIBODIES AND USE OF THE SAME
\vskip1.000000\baselineskip\ vskip1.000000 \ baselineskip
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<130> ES.1513.3<130> ES.1513.3
\vskip1.000000\baselineskip\ vskip1.000000 \ baselineskip
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<160> 8<160> 8
\vskip1.000000\baselineskip\ vskip1.000000 \ baselineskip
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<170> PatentIn version 3.3<170> PatentIn version 3.3
\vskip1.000000\baselineskip\ vskip1.000000 \ baselineskip
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<210> 1<210> 1
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<211> 1119<211> 1119
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<212> DNA<212> DNA
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<213> Homo sapiens <213> Homo sapiens
\vskip1.000000\baselineskip\ vskip1.000000 \ baselineskip
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<400> 1<400> 1
\vskip1.000000\baselineskip\ vskip1.000000 \ baselineskip
\hskip0,7cm\ hskip0,7cm
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<210> 2<210> 2
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<211> 372<211> 372
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<212> PRT<212> PRT
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<213> Homo sapiens <213> Homo sapiens
\vskip1.000000\baselineskip\ vskip1.000000 \ baselineskip
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<400> 2<400> 2
\vskip1.000000\baselineskip\ vskip1.000000 \ baselineskip
\hskip0,7cm\ hskip0,7cm
\hskip0,7cm\ hskip0,7cm
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<210> 3<210> 3
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<211> 156<211> 156
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<212> DNA<212> DNA
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<213> secuencia artificial<213> artificial sequence
\vskip1.000000\baselineskip\ vskip1.000000 \ baselineskip
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<220><220>
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<221> misc_feature<221> misc_feature
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<223> Secuencia que codifica para el epítopo empleado para la obtención de anticuerpos contra PSAPL y PSAPS<223> Sequence coding for the epitope used to obtain antibodies against PSAPL and PSAPS
\vskip1.000000\baselineskip\ vskip1.000000 \ baselineskip
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<400> 3<400> 3
\vskip1.000000\baselineskip\ vskip1.000000 \ baselineskip
\hskip0,7cm\ hskip0,7cm
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<210> 4<210> 4
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<211> 44<211> 44
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<212> PRT<212> PRT
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<213> secuencia artificial<213> artificial sequence
\vskip1.000000\baselineskip\ vskip1.000000 \ baselineskip
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<220><220>
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<221> MISCFEATURE<221> MISCFEATURE
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<223> Epítopo codificado por la SEQ ID 3 y que es empleado para obtención de anticuerpos contra PSAPS y PSAPL.<223> Epitope encoded by SEQ ID 3 and which is used to obtain antibodies against PSAPS and PSAPL
\vskip1.000000\baselineskip\ vskip1.000000 \ baselineskip
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<400> 4<400> 4
\vskip1.000000\baselineskip\ vskip1.000000 \ baselineskip
\hskip0,7cm\ hskip0,7cm
\vskip1.000000\baselineskip\ vskip1.000000 \ baselineskip
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<210> 5<210> 5
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<211> 840<211> 840
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<212> DNA<212> DNA
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<213> secuencia artificial<213> artificial sequence
\vskip1.000000\baselineskip\ vskip1.000000 \ baselineskip
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<220><220>
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<221> misc_feature<221> misc_feature
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<223> Secuencia que codifica para la proteína de fusión que comprende la SEQ ID 3 y es empleada para la obtención de anticuerpos contra PSAPS y PSAPL.<223> Sequence coding for the fusion protein comprising SEQ ID 3 and is used for the obtaining antibodies against PSAPS and PSAPL.
\vskip1.000000\baselineskip\ vskip1.000000 \ baselineskip
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<400> 5<400> 5
\vskip1.000000\baselineskip\ vskip1.000000 \ baselineskip
\hskip0,7cm\ hskip0,7cm
\hskip0,7cm\ hskip0,7cm
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<210> 6<210> 6
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<211> 280<211> 280
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<212> PRT<212> PRT
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<213> secuencia artificial<213> artificial sequence
\vskip1.000000\baselineskip\ vskip1.000000 \ baselineskip
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<220><220>
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<221> MISC_FEATURE<221> MISC_FEATURE
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<223> Secuencia codificada por SEQ ID 5 y que es empleada para la generación de anticuerpos contra PSAPS y PSAPL.<223> Sequence encoded by SEQ ID 5 and which is used for the generation of antibodies against PSAPS and PSAPL
\vskip1.000000\baselineskip\ vskip1.000000 \ baselineskip
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<400> 6<400> 6
\hskip0,7cm\ hskip0,7cm
\hskip0,7cm\ hskip0,7cm
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<210> 7<210> 7
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<211> 30<211> 30
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<212> DNA<212> DNA
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<213> secuencia artificial<213> artificial sequence
\vskip1.000000\baselineskip\ vskip1.000000 \ baselineskip
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<220><220>
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<221> misc_feature<221> misc_feature
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<223> cebador directo<223> direct primer
\vskip1.000000\baselineskip\ vskip1.000000 \ baselineskip
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<400> 7<400> 7
\hskip0,8cm\ hskip0,8cm
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<210> 8<210> 8
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<211> 28<211> 28
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<212> DNA<212> DNA
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<213> secuencia artificial<213> artificial sequence
\vskip1.000000\baselineskip\ vskip1.000000 \ baselineskip
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<220><220>
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<221> misc_feature<221> misc_feature
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<223> cebador indirecto<223> indirect primer
\vskip1.000000\baselineskip\ vskip1.000000 \ baselineskip
\vskip0.400000\baselineskip\ vskip0.400000 \ baselineskip
<400> 8<400> 8
\hskip0,9cm\ hskip0,9cm
Claims (10)
- a.to.
- Polinucleótido que consista en la SEQ ID 3 o un fragmento de la misma, óPolynucleotide consisting of SEQ ID 3 or a fragment thereof, or
- b.b.
- Polinucleótido que codifique para un polipéptido que al menos presente un 90% de homología el polipéptido codificado por la SEQ ID 3.Polynucleotide encoding for a polypeptide that has at least 90% homology the polypeptide encoded by SEQ ID 3.
- a.to.
- Polipéptido que consista en la SEQ ID 4 o un fragmento de la misma, óPolypeptide consisting of SEQ ID 4 or a fragment thereof, or
- b.b.
- Polipéptido que al menos muestre un 90% de homología con el polipéptido del apartados (a).Polypeptide that shows at least 90% of homology with the polypeptide of sections (a).
Priority Applications (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| ES200502840A ES2319477B1 (en) | 2005-11-18 | 2005-11-18 | PSAP ISOFORMS, ANTIGENIC DETERMINANTS, METHOD OF OBTAINING ANTIBODIES AND USES OF THE SAME. |
| PCT/ES2006/000636 WO2007057490A2 (en) | 2005-11-18 | 2006-11-16 | Immunogenic polypeptides of presenilin-1-associated protein (psap), methods of obtaining antibodies and use of same |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| ES200502840A ES2319477B1 (en) | 2005-11-18 | 2005-11-18 | PSAP ISOFORMS, ANTIGENIC DETERMINANTS, METHOD OF OBTAINING ANTIBODIES AND USES OF THE SAME. |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| ES2319477A1 ES2319477A1 (en) | 2009-05-07 |
| ES2319477B1 true ES2319477B1 (en) | 2010-02-16 |
Family
ID=38049004
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| ES200502840A Active ES2319477B1 (en) | 2005-11-18 | 2005-11-18 | PSAP ISOFORMS, ANTIGENIC DETERMINANTS, METHOD OF OBTAINING ANTIBODIES AND USES OF THE SAME. |
Country Status (2)
| Country | Link |
|---|---|
| ES (1) | ES2319477B1 (en) |
| WO (1) | WO2007057490A2 (en) |
Families Citing this family (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| ES2319602B1 (en) * | 2007-07-13 | 2010-02-16 | Univ Zaragoza | POLYPETIDES DERIVED FROM THE PSAP PROTEIN (PSESENILIN 1-ASSOCIATED PROTEIN) ABLE TO INDUCE APOPTOSIS AND USES THEMSELVES. |
Family Cites Families (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2000004150A1 (en) * | 1998-07-16 | 2000-01-27 | Incyte Pharmaceuticals, Inc. | Human presenilin-associated protein |
| WO2004078112A2 (en) * | 2003-03-07 | 2004-09-16 | Asahi Kasei Pharma Corporation | Apoptosis inducing gene |
-
2005
- 2005-11-18 ES ES200502840A patent/ES2319477B1/en active Active
-
2006
- 2006-11-16 WO PCT/ES2006/000636 patent/WO2007057490A2/en active Application Filing
Non-Patent Citations (2)
| Title |
|---|
| XU, X. et al. "{} The novel presenilin-1 associated protein is a proapoptopic mitochondrial protein"{}. THE JOURNAL OF BIOLOGICAL CHEMISTRY. 13.12.2002. Vol. 277, N$^{o}$. 50, páginas 48913-48922; todo el documento. * |
| XU, X. et al. "{}Identification of a novel PSD-95/Dlg/ZO-1 (PDZ)- like protein interacting with the C terminus of presenilin-1"{}. THE JOURNAL OF BIOLOGICAL CHEMISTRY. 12.11.1999. Vol. 274, N$^{o}$. 46, páginas 32543-32546; todo el documento, especialmente Fig. 1A. * |
Also Published As
| Publication number | Publication date |
|---|---|
| ES2319477A1 (en) | 2009-05-07 |
| WO2007057490A3 (en) | 2007-07-05 |
| WO2007057490A2 (en) | 2007-05-24 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| Grinberg et al. | Mitochondrial carrier homolog 2 is a target of tBID in cells signaled to die by tumor necrosis factor alpha | |
| ES2668207T3 (en) | Innovative discovery of therapeutic, diagnostic and antibody compositions related to fragments of methionyl-tRNA synthetases proteins | |
| Raharjo et al. | Nuclear envelope defects associated with LMNA mutations cause dilated cardiomyopathy and Emery-Dreifuss muscular dystrophy | |
| Schmitt et al. | Dbp5, a DEAD‐box protein required for mRNA export, is recruited to the cytoplasmic fibrils of nuclear pore complex via a conserved interaction with CAN/Nup159p | |
| Byrd et al. | Tpr, a large coiled coil protein whose amino terminus is involved in activation of oncogenic kinases, is localized to the cytoplasmic surface of the nuclear pore complex. | |
| Terjung et al. | p-ANCAs in autoimmune liver disorders recognise human β-tubulin isotype 5 and cross-react with microbial protein FtsZ | |
| ES2625316T3 (en) | Neukinase, a protein downstream of neuregulin | |
| ES2201064T3 (en) | TRANSPOSITION OF THE CYCLINE COMPLEX AND RELATED USES OF THE SAME. | |
| Liu et al. | Proteomic profiling and functional characterization of multiple post-translational modifications of tubulin | |
| US20070264681A1 (en) | Cell Cycle Phase Markers | |
| Moorefield et al. | Sp2 DNA binding activity and trans-activation are negatively regulated in mammalian cells | |
| ES2319477B1 (en) | PSAP ISOFORMS, ANTIGENIC DETERMINANTS, METHOD OF OBTAINING ANTIBODIES AND USES OF THE SAME. | |
| Lukashina et al. | Tritium planigraphy study of structural alterations in the coat protein of Potato virus X induced by binding of its triple gene block 1 protein to virions | |
| Symington et al. | Biosynthesis of adenovirus type 2 i-leader protein | |
| Green et al. | Studies on early proteins and transformation proteins of human adenoviruses | |
| ES2242400T3 (en) | PROTEIN THAT JOINS ANGIOSTATINE. | |
| US7033771B2 (en) | Use of insulin response modulators in the treatment of diabetes and insulin resistance | |
| Landais et al. | Immunochemical analysis of UMP kinase from Escherichia coli | |
| EP0761687A1 (en) | Process for preparing antibody | |
| Matragkou et al. | On the intracellular trafficking of mouse S5 ribosomal protein from cytoplasm to nucleoli | |
| JP2003531635A (en) | Human wingless-like gene | |
| JP2003506017A (en) | Seripanklin | |
| ES2274220T3 (en) | CARCINOMA DIAGNOSIS USING RAIG1 POLYPEPTIDES. | |
| JPH11164692A (en) | Human rce1 | |
| Green et al. | Immunological and chemical identification of intracellular forms of adenovirus type 2 terminal protein |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| EC2A | Search report published |
Date of ref document: 20090507 Kind code of ref document: A1 |
|
| FG2A | Definitive protection |
Ref document number: 2319477B1 Country of ref document: ES |