EP4320159A1 - Anticorps contre l'anticorps ilt4, anti-ilt4/pd-l1 bispécifique et ses utilisations - Google Patents
Anticorps contre l'anticorps ilt4, anti-ilt4/pd-l1 bispécifique et ses utilisationsInfo
- Publication number
- EP4320159A1 EP4320159A1 EP22720158.9A EP22720158A EP4320159A1 EP 4320159 A1 EP4320159 A1 EP 4320159A1 EP 22720158 A EP22720158 A EP 22720158A EP 4320159 A1 EP4320159 A1 EP 4320159A1
- Authority
- EP
- European Patent Office
- Prior art keywords
- seq
- variable region
- chain variable
- amino acid
- set forth
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 230000027455 binding Effects 0.000 claims abstract description 418
- 239000000427 antigen Substances 0.000 claims abstract description 411
- 108091007433 antigens Proteins 0.000 claims abstract description 411
- 102000036639 antigens Human genes 0.000 claims abstract description 411
- 239000012634 fragment Substances 0.000 claims abstract description 329
- 101000984189 Homo sapiens Leukocyte immunoglobulin-like receptor subfamily B member 2 Proteins 0.000 claims abstract description 244
- 102100025583 Leukocyte immunoglobulin-like receptor subfamily B member 2 Human genes 0.000 claims abstract description 202
- 102000008096 B7-H1 Antigen Human genes 0.000 claims abstract description 166
- 108010074708 B7-H1 Antigen Proteins 0.000 claims abstract description 166
- 238000000034 method Methods 0.000 claims abstract description 73
- 239000000203 mixture Substances 0.000 claims abstract description 65
- 206010028980 Neoplasm Diseases 0.000 claims abstract description 59
- 230000028993 immune response Effects 0.000 claims abstract description 27
- 239000011230 binding agent Substances 0.000 claims abstract description 25
- 201000011510 cancer Diseases 0.000 claims abstract description 21
- 230000002708 enhancing effect Effects 0.000 claims abstract description 14
- 230000001939 inductive effect Effects 0.000 claims abstract description 10
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 201
- 210000004027 cell Anatomy 0.000 claims description 102
- 241000282414 Homo sapiens Species 0.000 claims description 81
- 102100040678 Programmed cell death protein 1 Human genes 0.000 claims description 64
- 230000004048 modification Effects 0.000 claims description 55
- 238000012986 modification Methods 0.000 claims description 55
- 101710089372 Programmed cell death protein 1 Proteins 0.000 claims description 49
- 150000007523 nucleic acids Chemical class 0.000 claims description 46
- 102000039446 nucleic acids Human genes 0.000 claims description 45
- 108020004707 nucleic acids Proteins 0.000 claims description 45
- 102000047462 human LILRB2 Human genes 0.000 claims description 42
- 150000001413 amino acids Chemical class 0.000 claims description 34
- 210000002540 macrophage Anatomy 0.000 claims description 26
- -1 ErB3 Proteins 0.000 claims description 24
- 239000003446 ligand Substances 0.000 claims description 23
- 102100028967 HLA class I histocompatibility antigen, alpha chain G Human genes 0.000 claims description 20
- 108010024164 HLA-G Antigens Proteins 0.000 claims description 20
- 239000002773 nucleotide Substances 0.000 claims description 20
- 125000003729 nucleotide group Chemical group 0.000 claims description 20
- 238000010494 dissociation reaction Methods 0.000 claims description 18
- 230000005593 dissociations Effects 0.000 claims description 18
- 108091035707 Consensus sequence Proteins 0.000 claims description 15
- 230000009260 cross reactivity Effects 0.000 claims description 15
- 239000013598 vector Substances 0.000 claims description 15
- 238000006467 substitution reaction Methods 0.000 claims description 14
- 102000004127 Cytokines Human genes 0.000 claims description 12
- 108090000695 Cytokines Proteins 0.000 claims description 12
- 230000000903 blocking effect Effects 0.000 claims description 12
- 230000002401 inhibitory effect Effects 0.000 claims description 12
- 101001117317 Homo sapiens Programmed cell death 1 ligand 1 Proteins 0.000 claims description 11
- 230000000694 effects Effects 0.000 claims description 11
- 102000048776 human CD274 Human genes 0.000 claims description 11
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 11
- 230000004913 activation Effects 0.000 claims description 8
- NFGXHKASABOEEW-UHFFFAOYSA-N 1-methylethyl 11-methoxy-3,7,11-trimethyl-2,4-dodecadienoate Chemical compound COC(C)(C)CCCC(C)CC=CC(C)=CC(=O)OC(C)C NFGXHKASABOEEW-UHFFFAOYSA-N 0.000 claims description 7
- 239000003937 drug carrier Substances 0.000 claims description 7
- 230000001965 increasing effect Effects 0.000 claims description 7
- 108010021064 CTLA-4 Antigen Proteins 0.000 claims description 6
- 102000008203 CTLA-4 Antigen Human genes 0.000 claims description 6
- 229940045513 CTLA4 antagonist Drugs 0.000 claims description 6
- 102000019034 Chemokines Human genes 0.000 claims description 6
- 108010012236 Chemokines Proteins 0.000 claims description 6
- 102000037982 Immune checkpoint proteins Human genes 0.000 claims description 6
- 108091008036 Immune checkpoint proteins Proteins 0.000 claims description 6
- 108010017736 Leukocyte Immunoglobulin-like Receptor B1 Proteins 0.000 claims description 6
- 102100025584 Leukocyte immunoglobulin-like receptor subfamily B member 1 Human genes 0.000 claims description 6
- 230000000139 costimulatory effect Effects 0.000 claims description 6
- 229940126546 immune checkpoint molecule Drugs 0.000 claims description 6
- 210000004881 tumor cell Anatomy 0.000 claims description 6
- 210000004899 c-terminal region Anatomy 0.000 claims description 5
- 102000052116 epidermal growth factor receptor activity proteins Human genes 0.000 claims description 5
- 108700015053 epidermal growth factor receptor activity proteins Proteins 0.000 claims description 5
- YOHYSYJDKVYCJI-UHFFFAOYSA-N n-[3-[[6-[3-(trifluoromethyl)anilino]pyrimidin-4-yl]amino]phenyl]cyclopropanecarboxamide Chemical compound FC(F)(F)C1=CC=CC(NC=2N=CN=C(NC=3C=C(NC(=O)C4CC4)C=CC=3)C=2)=C1 YOHYSYJDKVYCJI-UHFFFAOYSA-N 0.000 claims description 5
- 230000001737 promoting effect Effects 0.000 claims description 5
- 102100027207 CD27 antigen Human genes 0.000 claims description 4
- 101150013553 CD40 gene Proteins 0.000 claims description 4
- 102100034458 Hepatitis A virus cellular receptor 2 Human genes 0.000 claims description 4
- 101710083479 Hepatitis A virus cellular receptor 2 homolog Proteins 0.000 claims description 4
- 101000914511 Homo sapiens CD27 antigen Proteins 0.000 claims description 4
- 101000984186 Homo sapiens Leukocyte immunoglobulin-like receptor subfamily B member 4 Proteins 0.000 claims description 4
- 101001012157 Homo sapiens Receptor tyrosine-protein kinase erbB-2 Proteins 0.000 claims description 4
- 101000884271 Homo sapiens Signal transducer CD24 Proteins 0.000 claims description 4
- 101000831007 Homo sapiens T-cell immunoreceptor with Ig and ITIM domains Proteins 0.000 claims description 4
- 101000801234 Homo sapiens Tumor necrosis factor receptor superfamily member 18 Proteins 0.000 claims description 4
- 101000851370 Homo sapiens Tumor necrosis factor receptor superfamily member 9 Proteins 0.000 claims description 4
- 101000807561 Homo sapiens Tyrosine-protein kinase receptor UFO Proteins 0.000 claims description 4
- 101000666896 Homo sapiens V-type immunoglobulin domain-containing suppressor of T-cell activation Proteins 0.000 claims description 4
- 102000017578 LAG3 Human genes 0.000 claims description 4
- 101150030213 Lag3 gene Proteins 0.000 claims description 4
- 102100025578 Leukocyte immunoglobulin-like receptor subfamily B member 4 Human genes 0.000 claims description 4
- 102100030086 Receptor tyrosine-protein kinase erbB-2 Human genes 0.000 claims description 4
- 102100038081 Signal transducer CD24 Human genes 0.000 claims description 4
- 229940126547 T-cell immunoglobulin mucin-3 Drugs 0.000 claims description 4
- 102100024834 T-cell immunoreceptor with Ig and ITIM domains Human genes 0.000 claims description 4
- 102100033728 Tumor necrosis factor receptor superfamily member 18 Human genes 0.000 claims description 4
- 101710165473 Tumor necrosis factor receptor superfamily member 4 Proteins 0.000 claims description 4
- 102100022153 Tumor necrosis factor receptor superfamily member 4 Human genes 0.000 claims description 4
- 102100040245 Tumor necrosis factor receptor superfamily member 5 Human genes 0.000 claims description 4
- 102100036856 Tumor necrosis factor receptor superfamily member 9 Human genes 0.000 claims description 4
- 102100037236 Tyrosine-protein kinase receptor UFO Human genes 0.000 claims description 4
- 102100038282 V-type immunoglobulin domain-containing suppressor of T-cell activation Human genes 0.000 claims description 4
- 210000003690 classically activated macrophage Anatomy 0.000 claims description 4
- IJJVMEJXYNJXOJ-UHFFFAOYSA-N fluquinconazole Chemical compound C=1C=C(Cl)C=C(Cl)C=1N1C(=O)C2=CC(F)=CC=C2N=C1N1C=NC=N1 IJJVMEJXYNJXOJ-UHFFFAOYSA-N 0.000 claims description 4
- 230000010287 polarization Effects 0.000 claims description 4
- 230000003389 potentiating effect Effects 0.000 claims description 4
- 102100025672 Angiopoietin-related protein 2 Human genes 0.000 claims description 3
- 206010005003 Bladder cancer Diseases 0.000 claims description 3
- 208000001333 Colorectal Neoplasms Diseases 0.000 claims description 3
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 claims description 3
- 101000693081 Homo sapiens Angiopoietin-related protein 2 Proteins 0.000 claims description 3
- 206010058467 Lung neoplasm malignant Diseases 0.000 claims description 3
- 102000010410 Nogo Proteins Human genes 0.000 claims description 3
- 108010077641 Nogo Proteins Proteins 0.000 claims description 3
- 206010033128 Ovarian cancer Diseases 0.000 claims description 3
- 206010061535 Ovarian neoplasm Diseases 0.000 claims description 3
- 206010039491 Sarcoma Diseases 0.000 claims description 3
- 201000001441 melanoma Diseases 0.000 claims description 3
- 230000006641 stabilisation Effects 0.000 claims description 3
- 238000011105 stabilization Methods 0.000 claims description 3
- 206010006187 Breast cancer Diseases 0.000 claims description 2
- 208000026310 Breast neoplasm Diseases 0.000 claims description 2
- 206010009944 Colon cancer Diseases 0.000 claims description 2
- 206010025323 Lymphomas Diseases 0.000 claims description 2
- 206010060862 Prostate cancer Diseases 0.000 claims description 2
- 208000000236 Prostatic Neoplasms Diseases 0.000 claims description 2
- 208000006265 Renal cell carcinoma Diseases 0.000 claims description 2
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 claims description 2
- 201000005202 lung cancer Diseases 0.000 claims description 2
- 208000020816 lung neoplasm Diseases 0.000 claims description 2
- 201000005112 urinary bladder cancer Diseases 0.000 claims description 2
- 208000000102 Squamous Cell Carcinoma of Head and Neck Diseases 0.000 claims 1
- 230000003213 activating effect Effects 0.000 claims 1
- 208000005017 glioblastoma Diseases 0.000 claims 1
- 201000000459 head and neck squamous cell carcinoma Diseases 0.000 claims 1
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 44
- 235000001014 amino acid Nutrition 0.000 description 38
- 150000001875 compounds Chemical class 0.000 description 35
- 108090000623 proteins and genes Proteins 0.000 description 34
- 229940024606 amino acid Drugs 0.000 description 30
- 239000003795 chemical substances by application Substances 0.000 description 27
- 235000018102 proteins Nutrition 0.000 description 26
- 102000004169 proteins and genes Human genes 0.000 description 26
- 239000013604 expression vector Substances 0.000 description 21
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 20
- 101000611936 Homo sapiens Programmed cell death protein 1 Proteins 0.000 description 18
- 230000001225 therapeutic effect Effects 0.000 description 18
- 108060003951 Immunoglobulin Proteins 0.000 description 17
- 102000018358 immunoglobulin Human genes 0.000 description 17
- 201000010099 disease Diseases 0.000 description 16
- 238000011282 treatment Methods 0.000 description 16
- 239000002671 adjuvant Substances 0.000 description 14
- 230000014509 gene expression Effects 0.000 description 14
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 12
- 125000000539 amino acid group Chemical group 0.000 description 12
- 230000000890 antigenic effect Effects 0.000 description 12
- 239000002158 endotoxin Substances 0.000 description 12
- 230000003308 immunostimulating effect Effects 0.000 description 12
- 238000004458 analytical method Methods 0.000 description 11
- 239000003814 drug Substances 0.000 description 11
- 150000003839 salts Chemical class 0.000 description 11
- 239000000523 sample Substances 0.000 description 11
- 238000002965 ELISA Methods 0.000 description 10
- 108091028043 Nucleic acid sequence Proteins 0.000 description 10
- PXIPVTKHYLBLMZ-UHFFFAOYSA-N Sodium azide Chemical compound [Na+].[N-]=[N+]=[N-] PXIPVTKHYLBLMZ-UHFFFAOYSA-N 0.000 description 10
- 239000012491 analyte Substances 0.000 description 10
- 238000003556 assay Methods 0.000 description 10
- 239000013024 dilution buffer Substances 0.000 description 10
- 210000004602 germ cell Anatomy 0.000 description 10
- 210000004408 hybridoma Anatomy 0.000 description 10
- 239000002502 liposome Substances 0.000 description 10
- 210000001616 monocyte Anatomy 0.000 description 10
- 241000894007 species Species 0.000 description 10
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 9
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 9
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 9
- 210000000612 antigen-presenting cell Anatomy 0.000 description 9
- 230000005764 inhibitory process Effects 0.000 description 9
- 230000003993 interaction Effects 0.000 description 9
- 229960005486 vaccine Drugs 0.000 description 9
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 8
- 241000700605 Viruses Species 0.000 description 8
- 238000012575 bio-layer interferometry Methods 0.000 description 8
- 230000007423 decrease Effects 0.000 description 8
- 238000009472 formulation Methods 0.000 description 8
- 244000052769 pathogen Species 0.000 description 8
- 239000008194 pharmaceutical composition Substances 0.000 description 8
- 102000004196 processed proteins & peptides Human genes 0.000 description 8
- 102000005962 receptors Human genes 0.000 description 8
- 108020003175 receptors Proteins 0.000 description 8
- 239000000126 substance Substances 0.000 description 8
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 8
- 108020004414 DNA Proteins 0.000 description 7
- 241000699666 Mus <mouse, genus> Species 0.000 description 7
- 239000004698 Polyethylene Substances 0.000 description 7
- 210000001744 T-lymphocyte Anatomy 0.000 description 7
- 239000004480 active ingredient Substances 0.000 description 7
- 230000001580 bacterial effect Effects 0.000 description 7
- 210000004443 dendritic cell Anatomy 0.000 description 7
- 229940079593 drug Drugs 0.000 description 7
- 230000006698 induction Effects 0.000 description 7
- 239000000463 material Substances 0.000 description 7
- 230000035755 proliferation Effects 0.000 description 7
- 239000007790 solid phase Substances 0.000 description 7
- 239000000243 solution Substances 0.000 description 7
- 239000006228 supernatant Substances 0.000 description 7
- 230000003612 virological effect Effects 0.000 description 7
- 241000283707 Capra Species 0.000 description 6
- 238000010521 absorption reaction Methods 0.000 description 6
- 239000002253 acid Substances 0.000 description 6
- 238000007792 addition Methods 0.000 description 6
- 239000000556 agonist Substances 0.000 description 6
- 239000003153 chemical reaction reagent Substances 0.000 description 6
- 239000006185 dispersion Substances 0.000 description 6
- 239000002552 dosage form Substances 0.000 description 6
- 230000004927 fusion Effects 0.000 description 6
- 210000000987 immune system Anatomy 0.000 description 6
- 238000001802 infusion Methods 0.000 description 6
- 238000004519 manufacturing process Methods 0.000 description 6
- 229940035032 monophosphoryl lipid a Drugs 0.000 description 6
- 230000035772 mutation Effects 0.000 description 6
- 230000001717 pathogenic effect Effects 0.000 description 6
- 239000013612 plasmid Substances 0.000 description 6
- 238000002360 preparation method Methods 0.000 description 6
- 230000004044 response Effects 0.000 description 6
- 239000011780 sodium chloride Substances 0.000 description 6
- 230000000638 stimulation Effects 0.000 description 6
- 239000003053 toxin Substances 0.000 description 6
- 231100000765 toxin Toxicity 0.000 description 6
- 108700012359 toxins Proteins 0.000 description 6
- 230000006433 tumor necrosis factor production Effects 0.000 description 6
- 108091026890 Coding region Proteins 0.000 description 5
- 241000588724 Escherichia coli Species 0.000 description 5
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 description 5
- 102100039620 Granulocyte-macrophage colony-stimulating factor Human genes 0.000 description 5
- 108010029485 Protein Isoforms Proteins 0.000 description 5
- 102000001708 Protein Isoforms Human genes 0.000 description 5
- 238000012217 deletion Methods 0.000 description 5
- 230000037430 deletion Effects 0.000 description 5
- 238000012377 drug delivery Methods 0.000 description 5
- 238000001727 in vivo Methods 0.000 description 5
- 238000002347 injection Methods 0.000 description 5
- 239000007924 injection Substances 0.000 description 5
- 238000013507 mapping Methods 0.000 description 5
- 230000001404 mediated effect Effects 0.000 description 5
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 5
- 108091033319 polynucleotide Proteins 0.000 description 5
- 102000040430 polynucleotide Human genes 0.000 description 5
- 239000002157 polynucleotide Substances 0.000 description 5
- 239000002904 solvent Substances 0.000 description 5
- 210000001519 tissue Anatomy 0.000 description 5
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 5
- MZOFCQQQCNRIBI-VMXHOPILSA-N (3s)-4-[[(2s)-1-[[(2s)-1-[[(1s)-1-carboxy-2-hydroxyethyl]amino]-4-methyl-1-oxopentan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-3-[[2-[[(2s)-2,6-diaminohexanoyl]amino]acetyl]amino]-4-oxobutanoic acid Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@@H](N)CCCCN MZOFCQQQCNRIBI-VMXHOPILSA-N 0.000 description 4
- IIZPXYDJLKNOIY-JXPKJXOSSA-N 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCC\C=C/C\C=C/C\C=C/C\C=C/CCCCC IIZPXYDJLKNOIY-JXPKJXOSSA-N 0.000 description 4
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 description 4
- 241000233866 Fungi Species 0.000 description 4
- 108010074328 Interferon-gamma Proteins 0.000 description 4
- 102100028123 Macrophage colony-stimulating factor 1 Human genes 0.000 description 4
- 241001529936 Murinae Species 0.000 description 4
- 108700006640 OspA Proteins 0.000 description 4
- 108700023315 OspC Proteins 0.000 description 4
- 101100431670 Rattus norvegicus Ybx3 gene Proteins 0.000 description 4
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 4
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 description 4
- RJURFGZVJUQBHK-UHFFFAOYSA-N actinomycin D Natural products CC1OC(=O)C(C(C)C)N(C)C(=O)CN(C)C(=O)C2CCCN2C(=O)C(C(C)C)NC(=O)C1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=CC=C3C(=O)NC4C(=O)NC(C(N5CCCC5C(=O)N(C)CC(=O)N(C)C(C(C)C)C(=O)OC4C)=O)C(C)C)=C3N=C21 RJURFGZVJUQBHK-UHFFFAOYSA-N 0.000 description 4
- 239000002585 base Substances 0.000 description 4
- 238000004422 calculation algorithm Methods 0.000 description 4
- 239000000969 carrier Substances 0.000 description 4
- 230000001413 cellular effect Effects 0.000 description 4
- DQLATGHUWYMOKM-UHFFFAOYSA-L cisplatin Chemical compound N[Pt](N)(Cl)Cl DQLATGHUWYMOKM-UHFFFAOYSA-L 0.000 description 4
- 238000000576 coating method Methods 0.000 description 4
- 230000021615 conjugation Effects 0.000 description 4
- 208000035475 disorder Diseases 0.000 description 4
- 150000004676 glycans Chemical class 0.000 description 4
- 208000015181 infectious disease Diseases 0.000 description 4
- 238000001990 intravenous administration Methods 0.000 description 4
- 239000007951 isotonicity adjuster Substances 0.000 description 4
- 239000000787 lecithin Substances 0.000 description 4
- 229940067606 lecithin Drugs 0.000 description 4
- 235000010445 lecithin Nutrition 0.000 description 4
- 238000005259 measurement Methods 0.000 description 4
- 229960003301 nivolumab Drugs 0.000 description 4
- 229920001223 polyethylene glycol Polymers 0.000 description 4
- 229920001282 polysaccharide Polymers 0.000 description 4
- 239000005017 polysaccharide Substances 0.000 description 4
- 239000000843 powder Substances 0.000 description 4
- 238000003127 radioimmunoassay Methods 0.000 description 4
- 238000010561 standard procedure Methods 0.000 description 4
- 235000000346 sugar Nutrition 0.000 description 4
- 150000008163 sugars Chemical class 0.000 description 4
- 238000012360 testing method Methods 0.000 description 4
- KIUMMUBSPKGMOY-UHFFFAOYSA-N 3,3'-Dithiobis(6-nitrobenzoic acid) Chemical compound C1=C([N+]([O-])=O)C(C(=O)O)=CC(SSC=2C=C(C(=CC=2)[N+]([O-])=O)C(O)=O)=C1 KIUMMUBSPKGMOY-UHFFFAOYSA-N 0.000 description 3
- STQGQHZAVUOBTE-UHFFFAOYSA-N 7-Cyan-hept-2t-en-4,6-diinsaeure Natural products C1=2C(O)=C3C(=O)C=4C(OC)=CC=CC=4C(=O)C3=C(O)C=2CC(O)(C(C)=O)CC1OC1CC(N)C(O)C(C)O1 STQGQHZAVUOBTE-UHFFFAOYSA-N 0.000 description 3
- 241000894006 Bacteria Species 0.000 description 3
- 206010008342 Cervix carcinoma Diseases 0.000 description 3
- 208000035473 Communicable disease Diseases 0.000 description 3
- 241000759568 Corixa Species 0.000 description 3
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 3
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 3
- 108010092160 Dactinomycin Proteins 0.000 description 3
- 108010010803 Gelatin Proteins 0.000 description 3
- 102100037877 Intercellular adhesion molecule 1 Human genes 0.000 description 3
- 102100037850 Interferon gamma Human genes 0.000 description 3
- 108010065805 Interleukin-12 Proteins 0.000 description 3
- 102000013462 Interleukin-12 Human genes 0.000 description 3
- 108010002350 Interleukin-2 Proteins 0.000 description 3
- 102000000588 Interleukin-2 Human genes 0.000 description 3
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 3
- 241001465754 Metazoa Species 0.000 description 3
- NWIBSHFKIJFRCO-WUDYKRTCSA-N Mytomycin Chemical compound C1N2C(C(C(C)=C(N)C3=O)=O)=C3[C@@H](COC(N)=O)[C@@]2(OC)[C@@H]2[C@H]1N2 NWIBSHFKIJFRCO-WUDYKRTCSA-N 0.000 description 3
- 206010035226 Plasma cell myeloma Diseases 0.000 description 3
- 239000002202 Polyethylene glycol Substances 0.000 description 3
- 102100024216 Programmed cell death 1 ligand 1 Human genes 0.000 description 3
- 101710094000 Programmed cell death 1 ligand 1 Proteins 0.000 description 3
- 108020004511 Recombinant DNA Proteins 0.000 description 3
- 239000006146 Roswell Park Memorial Institute medium Substances 0.000 description 3
- 102000002689 Toll-like receptor Human genes 0.000 description 3
- 108020000411 Toll-like receptor Proteins 0.000 description 3
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 description 3
- 150000007513 acids Chemical class 0.000 description 3
- 230000001464 adherent effect Effects 0.000 description 3
- 239000003242 anti bacterial agent Substances 0.000 description 3
- 239000003963 antioxidant agent Substances 0.000 description 3
- 235000006708 antioxidants Nutrition 0.000 description 3
- 230000006907 apoptotic process Effects 0.000 description 3
- 230000001588 bifunctional effect Effects 0.000 description 3
- 230000008499 blood brain barrier function Effects 0.000 description 3
- 210000001218 blood-brain barrier Anatomy 0.000 description 3
- 201000010881 cervical cancer Diseases 0.000 description 3
- KRKNYBCHXYNGOX-UHFFFAOYSA-N citric acid Chemical compound OC(=O)CC(O)(C(O)=O)CC(O)=O KRKNYBCHXYNGOX-UHFFFAOYSA-N 0.000 description 3
- 238000010367 cloning Methods 0.000 description 3
- 239000011248 coating agent Substances 0.000 description 3
- 230000001143 conditioned effect Effects 0.000 description 3
- STQGQHZAVUOBTE-VGBVRHCVSA-N daunorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(C)=O)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 STQGQHZAVUOBTE-VGBVRHCVSA-N 0.000 description 3
- 239000002612 dispersion medium Substances 0.000 description 3
- 229950009791 durvalumab Drugs 0.000 description 3
- 230000017188 evasion or tolerance of host immune response Effects 0.000 description 3
- 230000006870 function Effects 0.000 description 3
- 108020001507 fusion proteins Proteins 0.000 description 3
- 102000037865 fusion proteins Human genes 0.000 description 3
- 239000008273 gelatin Substances 0.000 description 3
- 229920000159 gelatin Polymers 0.000 description 3
- 235000019322 gelatine Nutrition 0.000 description 3
- 235000011852 gelatine desserts Nutrition 0.000 description 3
- 208000006454 hepatitis Diseases 0.000 description 3
- 231100000283 hepatitis Toxicity 0.000 description 3
- 102000048362 human PDCD1 Human genes 0.000 description 3
- DOUYETYNHWVLEO-UHFFFAOYSA-N imiquimod Chemical compound C1=CC=CC2=C3N(CC(C)C)C=NC3=C(N)N=C21 DOUYETYNHWVLEO-UHFFFAOYSA-N 0.000 description 3
- 210000002865 immune cell Anatomy 0.000 description 3
- 229940072221 immunoglobulins Drugs 0.000 description 3
- 239000003018 immunosuppressive agent Substances 0.000 description 3
- 229940125721 immunosuppressive agent Drugs 0.000 description 3
- 239000007943 implant Substances 0.000 description 3
- 238000000338 in vitro Methods 0.000 description 3
- 239000004615 ingredient Substances 0.000 description 3
- 238000003780 insertion Methods 0.000 description 3
- 230000037431 insertion Effects 0.000 description 3
- 238000007918 intramuscular administration Methods 0.000 description 3
- 230000000670 limiting effect Effects 0.000 description 3
- 238000012423 maintenance Methods 0.000 description 3
- 239000011159 matrix material Substances 0.000 description 3
- 239000012528 membrane Substances 0.000 description 3
- 210000004379 membrane Anatomy 0.000 description 3
- 231100000252 nontoxic Toxicity 0.000 description 3
- 230000003000 nontoxic effect Effects 0.000 description 3
- 239000002245 particle Substances 0.000 description 3
- 230000037361 pathway Effects 0.000 description 3
- 229920005862 polyol Polymers 0.000 description 3
- 150000003077 polyols Chemical class 0.000 description 3
- 230000002265 prevention Effects 0.000 description 3
- 239000000047 product Substances 0.000 description 3
- 238000000159 protein binding assay Methods 0.000 description 3
- 230000010076 replication Effects 0.000 description 3
- BXNMTOQRYBFHNZ-UHFFFAOYSA-N resiquimod Chemical compound C1=CC=CC2=C(N(C(COCC)=N3)CC(C)(C)O)C3=C(N)N=C21 BXNMTOQRYBFHNZ-UHFFFAOYSA-N 0.000 description 3
- VUFNRPJNRFOTGK-UHFFFAOYSA-M sodium;1-[4-[(2,5-dioxopyrrol-1-yl)methyl]cyclohexanecarbonyl]oxy-2,5-dioxopyrrolidine-3-sulfonate Chemical compound [Na+].O=C1C(S(=O)(=O)[O-])CC(=O)N1OC(=O)C1CCC(CN2C(C=CC2=O)=O)CC1 VUFNRPJNRFOTGK-UHFFFAOYSA-M 0.000 description 3
- 239000000600 sorbitol Substances 0.000 description 3
- 230000009870 specific binding Effects 0.000 description 3
- 230000004936 stimulating effect Effects 0.000 description 3
- 238000007920 subcutaneous administration Methods 0.000 description 3
- 239000004094 surface-active agent Substances 0.000 description 3
- 208000024891 symptom Diseases 0.000 description 3
- 230000008685 targeting Effects 0.000 description 3
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 3
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 2
- GVJHHUAWPYXKBD-IEOSBIPESA-N (R)-alpha-Tocopherol Natural products OC1=C(C)C(C)=C2O[C@@](CCC[C@H](C)CCC[C@H](C)CCCC(C)C)(C)CCC2=C1C GVJHHUAWPYXKBD-IEOSBIPESA-N 0.000 description 2
- 102000040650 (ribonucleotides)n+m Human genes 0.000 description 2
- 206010069754 Acquired gene mutation Diseases 0.000 description 2
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 2
- 208000023275 Autoimmune disease Diseases 0.000 description 2
- 208000036170 B-Cell Marginal Zone Lymphoma Diseases 0.000 description 2
- 208000010839 B-cell chronic lymphocytic leukemia Diseases 0.000 description 2
- 241000193738 Bacillus anthracis Species 0.000 description 2
- 206010004146 Basal cell carcinoma Diseases 0.000 description 2
- 108030001720 Bontoxilysin Proteins 0.000 description 2
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 2
- 208000011691 Burkitt lymphomas Diseases 0.000 description 2
- 239000004322 Butylated hydroxytoluene Substances 0.000 description 2
- NLZUEZXRPGMBCV-UHFFFAOYSA-N Butylhydroxytoluene Chemical compound CC1=CC(C(C)(C)C)=C(O)C(C(C)(C)C)=C1 NLZUEZXRPGMBCV-UHFFFAOYSA-N 0.000 description 2
- QOFRNSMLZCPQKL-KTIIIUPTSA-N CCN(CC)CC.CCCCCCCCCCCCCC(=O)O[C@H](CCCCCCCCCCC)CC(=O)NCCO[C@@H]1O[C@H](CO)[C@@H](OP(O)(O)=O)[C@H](OC(=O)C[C@@H](CCCCCCCCCCC)OC(=O)CCCCCCCCCCCCC)[C@H]1NC(=O)C[C@@H](CCCCCCCCCCC)OC(=O)CCCCCCCCCCCCC Chemical compound CCN(CC)CC.CCCCCCCCCCCCCC(=O)O[C@H](CCCCCCCCCCC)CC(=O)NCCO[C@@H]1O[C@H](CO)[C@@H](OP(O)(O)=O)[C@H](OC(=O)C[C@@H](CCCCCCCCCCC)OC(=O)CCCCCCCCCCCCC)[C@H]1NC(=O)C[C@@H](CCCCCCCCCCC)OC(=O)CCCCCCCCCCCCC QOFRNSMLZCPQKL-KTIIIUPTSA-N 0.000 description 2
- 108010029697 CD40 Ligand Proteins 0.000 description 2
- 102100032937 CD40 ligand Human genes 0.000 description 2
- 210000001266 CD8-positive T-lymphocyte Anatomy 0.000 description 2
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical class [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 2
- 201000009030 Carcinoma Diseases 0.000 description 2
- 206010007953 Central nervous system lymphoma Diseases 0.000 description 2
- 241001227713 Chiron Species 0.000 description 2
- 241000606161 Chlamydia Species 0.000 description 2
- 108010049048 Cholera Toxin Proteins 0.000 description 2
- 102000009016 Cholera Toxin Human genes 0.000 description 2
- 208000006332 Choriocarcinoma Diseases 0.000 description 2
- 241000193403 Clostridium Species 0.000 description 2
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 2
- 102000053602 DNA Human genes 0.000 description 2
- 102100037840 Dehydrogenase/reductase SDR family member 2, mitochondrial Human genes 0.000 description 2
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 2
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 2
- 102000004269 Granulocyte Colony-Stimulating Factor Human genes 0.000 description 2
- 108010017080 Granulocyte Colony-Stimulating Factor Proteins 0.000 description 2
- 241000606768 Haemophilus influenzae Species 0.000 description 2
- 208000017604 Hodgkin disease Diseases 0.000 description 2
- 208000010747 Hodgkins lymphoma Diseases 0.000 description 2
- 101000971171 Homo sapiens Apoptosis regulator Bcl-2 Proteins 0.000 description 2
- 101000599852 Homo sapiens Intercellular adhesion molecule 1 Proteins 0.000 description 2
- 101000984196 Homo sapiens Leukocyte immunoglobulin-like receptor subfamily A member 5 Proteins 0.000 description 2
- 101000914484 Homo sapiens T-lymphocyte activation antigen CD80 Proteins 0.000 description 2
- 101000831496 Homo sapiens Toll-like receptor 3 Proteins 0.000 description 2
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 2
- 241000700588 Human alphaherpesvirus 1 Species 0.000 description 2
- 241000701074 Human alphaherpesvirus 2 Species 0.000 description 2
- 241000713772 Human immunodeficiency virus 1 Species 0.000 description 2
- 108010091358 Hypoxanthine Phosphoribosyltransferase Proteins 0.000 description 2
- 102100029098 Hypoxanthine-guanine phosphoribosyltransferase Human genes 0.000 description 2
- 108091008028 Immune checkpoint receptors Proteins 0.000 description 2
- 102000037978 Immune checkpoint receptors Human genes 0.000 description 2
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 2
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 2
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 2
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 2
- 108700005091 Immunoglobulin Genes Proteins 0.000 description 2
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 description 2
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 description 2
- 108090000978 Interleukin-4 Proteins 0.000 description 2
- 108090001005 Interleukin-6 Proteins 0.000 description 2
- 102000004889 Interleukin-6 Human genes 0.000 description 2
- XEEYBQQBJWHFJM-UHFFFAOYSA-N Iron Chemical class [Fe] XEEYBQQBJWHFJM-UHFFFAOYSA-N 0.000 description 2
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 2
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 2
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 2
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 2
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 2
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 2
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 2
- 102000001109 Leukocyte L1 Antigen Complex Human genes 0.000 description 2
- 108010069316 Leukocyte L1 Antigen Complex Proteins 0.000 description 2
- 102100025574 Leukocyte immunoglobulin-like receptor subfamily A member 5 Human genes 0.000 description 2
- 108090001030 Lipoproteins Proteins 0.000 description 2
- 102000004895 Lipoproteins Human genes 0.000 description 2
- 101710164436 Listeriolysin O Proteins 0.000 description 2
- GQYIWUVLTXOXAJ-UHFFFAOYSA-N Lomustine Chemical compound ClCCN(N=O)C(=O)NC1CCCCC1 GQYIWUVLTXOXAJ-UHFFFAOYSA-N 0.000 description 2
- 208000016604 Lyme disease Diseases 0.000 description 2
- 208000031422 Lymphocytic Chronic B-Cell Leukemia Diseases 0.000 description 2
- 108010046938 Macrophage Colony-Stimulating Factor Proteins 0.000 description 2
- 101710127797 Macrophage colony-stimulating factor 1 Proteins 0.000 description 2
- 101710105759 Major outer membrane porin Proteins 0.000 description 2
- 101710164702 Major outer membrane protein Proteins 0.000 description 2
- 241000124008 Mammalia Species 0.000 description 2
- 229930195725 Mannitol Natural products 0.000 description 2
- 208000025205 Mantle-Cell Lymphoma Diseases 0.000 description 2
- 102100022430 Melanocyte protein PMEL Human genes 0.000 description 2
- 101710151805 Mitochondrial intermediate peptidase 1 Proteins 0.000 description 2
- 101100407308 Mus musculus Pdcd1lg2 gene Proteins 0.000 description 2
- 241000588653 Neisseria Species 0.000 description 2
- 206010029260 Neuroblastoma Diseases 0.000 description 2
- 102100029438 Nitric oxide synthase, inducible Human genes 0.000 description 2
- 101710089543 Nitric oxide synthase, inducible Proteins 0.000 description 2
- 108091005461 Nucleic proteins Proteins 0.000 description 2
- 206010030155 Oesophageal carcinoma Diseases 0.000 description 2
- 108091034117 Oligonucleotide Proteins 0.000 description 2
- 206010061902 Pancreatic neoplasm Diseases 0.000 description 2
- 108010067902 Peptide Library Proteins 0.000 description 2
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Chemical compound OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 2
- NBIIXXVUZAFLBC-UHFFFAOYSA-N Phosphoric acid Chemical compound OP(O)(O)=O NBIIXXVUZAFLBC-UHFFFAOYSA-N 0.000 description 2
- 241000224016 Plasmodium Species 0.000 description 2
- 102100035181 Plastin-1 Human genes 0.000 description 2
- 206010035664 Pneumonia Diseases 0.000 description 2
- 229920001213 Polysorbate 20 Polymers 0.000 description 2
- 108700030875 Programmed Cell Death 1 Ligand 2 Proteins 0.000 description 2
- 102100024213 Programmed cell death 1 ligand 2 Human genes 0.000 description 2
- ZTHYODDOHIVTJV-UHFFFAOYSA-N Propyl gallate Chemical compound CCCOC(=O)C1=CC(O)=C(O)C(O)=C1 ZTHYODDOHIVTJV-UHFFFAOYSA-N 0.000 description 2
- 101710188053 Protein D Proteins 0.000 description 2
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 2
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 2
- 101710132893 Resolvase Proteins 0.000 description 2
- 201000000582 Retinoblastoma Diseases 0.000 description 2
- 208000005718 Stomach Neoplasms Diseases 0.000 description 2
- 108091008874 T cell receptors Proteins 0.000 description 2
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 2
- 102100027222 T-lymphocyte activation antigen CD80 Human genes 0.000 description 2
- 229940124614 TLR 8 agonist Drugs 0.000 description 2
- 208000024313 Testicular Neoplasms Diseases 0.000 description 2
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 2
- 239000004473 Threonine Substances 0.000 description 2
- IQFYYKKMVGJFEH-XLPZGREQSA-N Thymidine Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 IQFYYKKMVGJFEH-XLPZGREQSA-N 0.000 description 2
- 102100024324 Toll-like receptor 3 Human genes 0.000 description 2
- 241000223997 Toxoplasma gondii Species 0.000 description 2
- 102000004887 Transforming Growth Factor beta Human genes 0.000 description 2
- 108090001012 Transforming Growth Factor beta Proteins 0.000 description 2
- 108700019146 Transgenes Proteins 0.000 description 2
- 241000589884 Treponema pallidum Species 0.000 description 2
- 101000980463 Treponema pallidum (strain Nichols) Chaperonin GroEL Proteins 0.000 description 2
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 2
- VGQOVCHZGQWAOI-UHFFFAOYSA-N UNPD55612 Natural products N1C(O)C2CC(C=CC(N)=O)=CN2C(=O)C2=CC=C(C)C(O)=C12 VGQOVCHZGQWAOI-UHFFFAOYSA-N 0.000 description 2
- 208000002495 Uterine Neoplasms Diseases 0.000 description 2
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 2
- JXLYSJRDGCGARV-WWYNWVTFSA-N Vinblastine Natural products O=C(O[C@H]1[C@](O)(C(=O)OC)[C@@H]2N(C)c3c(cc(c(OC)c3)[C@]3(C(=O)OC)c4[nH]c5c(c4CCN4C[C@](O)(CC)C[C@H](C3)C4)cccc5)[C@@]32[C@H]2[C@@]1(CC)C=CCN2CC3)C JXLYSJRDGCGARV-WWYNWVTFSA-N 0.000 description 2
- RJURFGZVJUQBHK-IIXSONLDSA-N actinomycin D Chemical compound C[C@H]1OC(=O)[C@H](C(C)C)N(C)C(=O)CN(C)C(=O)[C@@H]2CCCN2C(=O)[C@@H](C(C)C)NC(=O)[C@H]1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=CC=C3C(=O)N[C@@H]4C(=O)N[C@@H](C(N5CCC[C@H]5C(=O)N(C)CC(=O)N(C)[C@@H](C(C)C)C(=O)O[C@@H]4C)=O)C(C)C)=C3N=C21 RJURFGZVJUQBHK-IIXSONLDSA-N 0.000 description 2
- 230000009471 action Effects 0.000 description 2
- 239000000654 additive Substances 0.000 description 2
- 230000000996 additive effect Effects 0.000 description 2
- 208000009956 adenocarcinoma Diseases 0.000 description 2
- 229940087168 alpha tocopherol Drugs 0.000 description 2
- 150000001412 amines Chemical class 0.000 description 2
- 230000006229 amino acid addition Effects 0.000 description 2
- VGQOVCHZGQWAOI-HYUHUPJXSA-N anthramycin Chemical compound N1[C@@H](O)[C@@H]2CC(\C=C\C(N)=O)=CN2C(=O)C2=CC=C(C)C(O)=C12 VGQOVCHZGQWAOI-HYUHUPJXSA-N 0.000 description 2
- 230000000844 anti-bacterial effect Effects 0.000 description 2
- 239000003429 antifungal agent Substances 0.000 description 2
- 229940121375 antifungal agent Drugs 0.000 description 2
- 239000003435 antirheumatic agent Substances 0.000 description 2
- 230000002238 attenuated effect Effects 0.000 description 2
- 229950002916 avelumab Drugs 0.000 description 2
- 210000003719 b-lymphocyte Anatomy 0.000 description 2
- 230000033228 biological regulation Effects 0.000 description 2
- 229940053031 botulinum toxin Drugs 0.000 description 2
- 229940098773 bovine serum albumin Drugs 0.000 description 2
- 239000000872 buffer Substances 0.000 description 2
- 235000010354 butylated hydroxytoluene Nutrition 0.000 description 2
- 229940095259 butylated hydroxytoluene Drugs 0.000 description 2
- AIYUHDOJVYHVIT-UHFFFAOYSA-M caesium chloride Chemical compound [Cl-].[Cs+] AIYUHDOJVYHVIT-UHFFFAOYSA-M 0.000 description 2
- 229910052791 calcium Inorganic materials 0.000 description 2
- 239000011575 calcium Substances 0.000 description 2
- 239000012876 carrier material Substances 0.000 description 2
- 230000003197 catalytic effect Effects 0.000 description 2
- 210000003169 central nervous system Anatomy 0.000 description 2
- SQQXRXKYTKFFSM-UHFFFAOYSA-N chembl1992147 Chemical compound OC1=C(OC)C(OC)=CC=C1C1=C(C)C(C(O)=O)=NC(C=2N=C3C4=NC(C)(C)N=C4C(OC)=C(O)C3=CC=2)=C1N SQQXRXKYTKFFSM-UHFFFAOYSA-N 0.000 description 2
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 2
- OSASVXMJTNOKOY-UHFFFAOYSA-N chlorobutanol Chemical compound CC(C)(O)C(Cl)(Cl)Cl OSASVXMJTNOKOY-UHFFFAOYSA-N 0.000 description 2
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 2
- 208000032852 chronic lymphocytic leukemia Diseases 0.000 description 2
- 238000004440 column chromatography Methods 0.000 description 2
- 238000002648 combination therapy Methods 0.000 description 2
- 238000012875 competitive assay Methods 0.000 description 2
- 239000002299 complementary DNA Substances 0.000 description 2
- 238000013270 controlled release Methods 0.000 description 2
- 238000007796 conventional method Methods 0.000 description 2
- 230000008878 coupling Effects 0.000 description 2
- 238000010168 coupling process Methods 0.000 description 2
- 238000005859 coupling reaction Methods 0.000 description 2
- 239000006071 cream Substances 0.000 description 2
- 239000003431 cross linking reagent Substances 0.000 description 2
- OPTASPLRGRRNAP-UHFFFAOYSA-N cytosine Chemical compound NC=1C=CNC(=O)N=1 OPTASPLRGRRNAP-UHFFFAOYSA-N 0.000 description 2
- 229960000640 dactinomycin Drugs 0.000 description 2
- 229960000975 daunorubicin Drugs 0.000 description 2
- 230000001934 delay Effects 0.000 description 2
- CFCUWKMKBJTWLW-UHFFFAOYSA-N deoliosyl-3C-alpha-L-digitoxosyl-MTM Natural products CC=1C(O)=C2C(O)=C3C(=O)C(OC4OC(C)C(O)C(OC5OC(C)C(O)C(OC6OC(C)C(O)C(C)(O)C6)C5)C4)C(C(OC)C(=O)C(O)C(C)O)CC3=CC2=CC=1OC(OC(C)C1O)CC1OC1CC(O)C(O)C(C)O1 CFCUWKMKBJTWLW-UHFFFAOYSA-N 0.000 description 2
- 230000004069 differentiation Effects 0.000 description 2
- UGMCXQCYOVCMTB-UHFFFAOYSA-K dihydroxy(stearato)aluminium Chemical compound CCCCCCCCCCCCCCCCCC(=O)O[Al](O)O UGMCXQCYOVCMTB-UHFFFAOYSA-K 0.000 description 2
- 239000003085 diluting agent Substances 0.000 description 2
- 238000010790 dilution Methods 0.000 description 2
- 239000012895 dilution Substances 0.000 description 2
- 239000002988 disease modifying antirheumatic drug Substances 0.000 description 2
- 229960004679 doxorubicin Drugs 0.000 description 2
- 239000012636 effector Substances 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 238000002474 experimental method Methods 0.000 description 2
- 239000012530 fluid Substances 0.000 description 2
- 230000002538 fungal effect Effects 0.000 description 2
- 206010017758 gastric cancer Diseases 0.000 description 2
- 239000000499 gel Substances 0.000 description 2
- 238000001641 gel filtration chromatography Methods 0.000 description 2
- 238000010353 genetic engineering Methods 0.000 description 2
- 230000012010 growth Effects 0.000 description 2
- 210000002443 helper t lymphocyte Anatomy 0.000 description 2
- 102000022382 heparin binding proteins Human genes 0.000 description 2
- 108091012216 heparin binding proteins Proteins 0.000 description 2
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 2
- JYGXADMDTFJGBT-VWUMJDOOSA-N hydrocortisone Chemical compound O=C1CC[C@]2(C)[C@H]3[C@@H](O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 JYGXADMDTFJGBT-VWUMJDOOSA-N 0.000 description 2
- FDGQSTZJBFJUBT-UHFFFAOYSA-N hypoxanthine Chemical compound O=C1NC=NC2=C1NC=N2 FDGQSTZJBFJUBT-UHFFFAOYSA-N 0.000 description 2
- 229940124669 imidazoquinoline Drugs 0.000 description 2
- 229960002751 imiquimod Drugs 0.000 description 2
- 230000008629 immune suppression Effects 0.000 description 2
- 208000026278 immune system disease Diseases 0.000 description 2
- 238000003018 immunoassay Methods 0.000 description 2
- 230000001506 immunosuppresive effect Effects 0.000 description 2
- 230000001976 improved effect Effects 0.000 description 2
- 239000000411 inducer Substances 0.000 description 2
- 239000003112 inhibitor Substances 0.000 description 2
- 239000007972 injectable composition Substances 0.000 description 2
- 238000010255 intramuscular injection Methods 0.000 description 2
- 239000007927 intramuscular injection Substances 0.000 description 2
- 238000007912 intraperitoneal administration Methods 0.000 description 2
- 238000002955 isolation Methods 0.000 description 2
- 229960000310 isoleucine Drugs 0.000 description 2
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 2
- 208000032839 leukemia Diseases 0.000 description 2
- 150000002632 lipids Chemical class 0.000 description 2
- 239000007788 liquid Substances 0.000 description 2
- 238000004020 luminiscence type Methods 0.000 description 2
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 description 2
- 239000000594 mannitol Substances 0.000 description 2
- 235000010355 mannitol Nutrition 0.000 description 2
- 201000007924 marginal zone B-cell lymphoma Diseases 0.000 description 2
- 208000021937 marginal zone lymphoma Diseases 0.000 description 2
- 230000035800 maturation Effects 0.000 description 2
- GLVAUDGFNGKCSF-UHFFFAOYSA-N mercaptopurine Chemical compound S=C1NC=NC2=C1NC=N2 GLVAUDGFNGKCSF-UHFFFAOYSA-N 0.000 description 2
- 244000005700 microbiome Species 0.000 description 2
- CFCUWKMKBJTWLW-BKHRDMLASA-N mithramycin Chemical compound O([C@@H]1C[C@@H](O[C@H](C)[C@H]1O)OC=1C=C2C=C3C[C@H]([C@@H](C(=O)C3=C(O)C2=C(O)C=1C)O[C@@H]1O[C@H](C)[C@@H](O)[C@H](O[C@@H]2O[C@H](C)[C@H](O)[C@H](O[C@@H]3O[C@H](C)[C@@H](O)[C@@](C)(O)C3)C2)C1)[C@H](OC)C(=O)[C@@H](O)[C@@H](C)O)[C@H]1C[C@@H](O)[C@H](O)[C@@H](C)O1 CFCUWKMKBJTWLW-BKHRDMLASA-N 0.000 description 2
- 229960004857 mitomycin Drugs 0.000 description 2
- 238000002703 mutagenesis Methods 0.000 description 2
- 231100000350 mutagenesis Toxicity 0.000 description 2
- 210000000066 myeloid cell Anatomy 0.000 description 2
- 201000000050 myeloid neoplasm Diseases 0.000 description 2
- 230000003204 osmotic effect Effects 0.000 description 2
- 201000008968 osteosarcoma Diseases 0.000 description 2
- 201000002528 pancreatic cancer Diseases 0.000 description 2
- 208000008443 pancreatic carcinoma Diseases 0.000 description 2
- 244000045947 parasite Species 0.000 description 2
- 238000007911 parenteral administration Methods 0.000 description 2
- 239000006072 paste Substances 0.000 description 2
- 229960002621 pembrolizumab Drugs 0.000 description 2
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 2
- 108010049148 plastin Proteins 0.000 description 2
- 229960003171 plicamycin Drugs 0.000 description 2
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 2
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 2
- 229920001184 polypeptide Polymers 0.000 description 2
- 229920000136 polysorbate Polymers 0.000 description 2
- 230000035935 pregnancy Effects 0.000 description 2
- 239000003755 preservative agent Substances 0.000 description 2
- 208000016800 primary central nervous system lymphoma Diseases 0.000 description 2
- MFDFERRIHVXMIY-UHFFFAOYSA-N procaine Chemical compound CCN(CC)CCOC(=O)C1=CC=C(N)C=C1 MFDFERRIHVXMIY-UHFFFAOYSA-N 0.000 description 2
- 229960004919 procaine Drugs 0.000 description 2
- 230000008569 process Effects 0.000 description 2
- 230000000770 proinflammatory effect Effects 0.000 description 2
- 230000002035 prolonged effect Effects 0.000 description 2
- AQHHHDLHHXJYJD-UHFFFAOYSA-N propranolol Chemical compound C1=CC=C2C(OCC(O)CNC(C)C)=CC=CC2=C1 AQHHHDLHHXJYJD-UHFFFAOYSA-N 0.000 description 2
- RXWNCPJZOCPEPQ-NVWDDTSBSA-N puromycin Chemical compound C1=CC(OC)=CC=C1C[C@H](N)C(=O)N[C@H]1[C@@H](O)[C@H](N2C3=NC=NC(=C3N=C2)N(C)C)O[C@@H]1CO RXWNCPJZOCPEPQ-NVWDDTSBSA-N 0.000 description 2
- 230000009257 reactivity Effects 0.000 description 2
- 230000008707 rearrangement Effects 0.000 description 2
- 238000003259 recombinant expression Methods 0.000 description 2
- 229950010550 resiquimod Drugs 0.000 description 2
- 230000002441 reversible effect Effects 0.000 description 2
- 238000012552 review Methods 0.000 description 2
- 201000009410 rhabdomyosarcoma Diseases 0.000 description 2
- 229930182490 saponin Natural products 0.000 description 2
- 235000017709 saponins Nutrition 0.000 description 2
- 150000007949 saponins Chemical class 0.000 description 2
- 238000013207 serial dilution Methods 0.000 description 2
- 238000002741 site-directed mutagenesis Methods 0.000 description 2
- GEHJYWRUCIMESM-UHFFFAOYSA-L sodium sulfite Chemical compound [Na+].[Na+].[O-]S([O-])=O GEHJYWRUCIMESM-UHFFFAOYSA-L 0.000 description 2
- 239000007787 solid Substances 0.000 description 2
- 230000037439 somatic mutation Effects 0.000 description 2
- 239000007921 spray Substances 0.000 description 2
- 150000003431 steroids Chemical class 0.000 description 2
- 201000011549 stomach cancer Diseases 0.000 description 2
- 238000003860 storage Methods 0.000 description 2
- 238000010254 subcutaneous injection Methods 0.000 description 2
- 239000007929 subcutaneous injection Substances 0.000 description 2
- 239000000758 substrate Substances 0.000 description 2
- 150000005846 sugar alcohols Polymers 0.000 description 2
- 201000003120 testicular cancer Diseases 0.000 description 2
- 229940124597 therapeutic agent Drugs 0.000 description 2
- 230000004797 therapeutic response Effects 0.000 description 2
- WYWHKKSPHMUBEB-UHFFFAOYSA-N tioguanine Chemical compound N1C(N)=NC(=S)C2=C1N=CN2 WYWHKKSPHMUBEB-UHFFFAOYSA-N 0.000 description 2
- AOBORMOPSGHCAX-DGHZZKTQSA-N tocofersolan Chemical compound OCCOC(=O)CCC(=O)OC1=C(C)C(C)=C2O[C@](CCC[C@H](C)CCC[C@H](C)CCCC(C)C)(C)CCC2=C1C AOBORMOPSGHCAX-DGHZZKTQSA-N 0.000 description 2
- 229960000984 tocofersolan Drugs 0.000 description 2
- 230000000699 topical effect Effects 0.000 description 2
- 238000013518 transcription Methods 0.000 description 2
- 230000035897 transcription Effects 0.000 description 2
- 230000009261 transgenic effect Effects 0.000 description 2
- 102000035160 transmembrane proteins Human genes 0.000 description 2
- 108091005703 transmembrane proteins Proteins 0.000 description 2
- 201000008827 tuberculosis Diseases 0.000 description 2
- 210000003171 tumor-infiltrating lymphocyte Anatomy 0.000 description 2
- 241000712461 unidentified influenza virus Species 0.000 description 2
- 206010046766 uterine cancer Diseases 0.000 description 2
- 239000004474 valine Substances 0.000 description 2
- 229960003048 vinblastine Drugs 0.000 description 2
- JXLYSJRDGCGARV-XQKSVPLYSA-N vincaleukoblastine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1NC1=CC=CC=C21 JXLYSJRDGCGARV-XQKSVPLYSA-N 0.000 description 2
- OGWKCGZFUXNPDA-XQKSVPLYSA-N vincristine Chemical compound C([N@]1C[C@@H](C[C@]2(C(=O)OC)C=3C(=CC4=C([C@]56[C@H]([C@@]([C@H](OC(C)=O)[C@]7(CC)C=CCN([C@H]67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)C[C@@](C1)(O)CC)CC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-XQKSVPLYSA-N 0.000 description 2
- 229960004528 vincristine Drugs 0.000 description 2
- OGWKCGZFUXNPDA-UHFFFAOYSA-N vincristine Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(OC(C)=O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-UHFFFAOYSA-N 0.000 description 2
- 239000013603 viral vector Substances 0.000 description 2
- 238000005406 washing Methods 0.000 description 2
- 239000002076 α-tocopherol Substances 0.000 description 2
- 235000004835 α-tocopherol Nutrition 0.000 description 2
- DGVVWUTYPXICAM-UHFFFAOYSA-N β‐Mercaptoethanol Chemical compound OCCS DGVVWUTYPXICAM-UHFFFAOYSA-N 0.000 description 2
- QIJRTFXNRTXDIP-UHFFFAOYSA-N (1-carboxy-2-sulfanylethyl)azanium;chloride;hydrate Chemical compound O.Cl.SCC(N)C(O)=O QIJRTFXNRTXDIP-UHFFFAOYSA-N 0.000 description 1
- JWDFQMWEFLOOED-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 3-(pyridin-2-yldisulfanyl)propanoate Chemical compound O=C1CCC(=O)N1OC(=O)CCSSC1=CC=CC=N1 JWDFQMWEFLOOED-UHFFFAOYSA-N 0.000 description 1
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 1
- ZADWXFSZEAPBJS-SNVBAGLBSA-N (2r)-2-amino-3-(1-methylindol-3-yl)propanoic acid Chemical compound C1=CC=C2N(C)C=C(C[C@@H](N)C(O)=O)C2=C1 ZADWXFSZEAPBJS-SNVBAGLBSA-N 0.000 description 1
- SSOORFWOBGFTHL-OTEJMHTDSA-N (4S)-5-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-6-amino-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[2-[(2S)-2-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-6-amino-1-[[(2S)-1-[[(2S)-1-[[(2S,3S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-6-amino-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-5-amino-1-[[(2S)-1-[[(2S)-1-[[(2S)-6-amino-1-[[(2S)-6-amino-1-[[(2S)-1-[[(2S)-1-[[(2S)-5-amino-1-[[(2S)-5-carbamimidamido-1-[[(2S)-5-carbamimidamido-1-[[(1S)-4-carbamimidamido-1-carboxybutyl]amino]-1-oxopentan-2-yl]amino]-1-oxopentan-2-yl]amino]-1,5-dioxopentan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-1-oxohexan-2-yl]amino]-1-oxohexan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-1,5-dioxopentan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-1-oxopropan-2-yl]amino]-1-oxohexan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-3-methyl-1-oxopentan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-1-oxohexan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-1-oxopropan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]carbamoyl]pyrrolidin-1-yl]-2-oxoethyl]amino]-3-(1H-indol-3-yl)-1-oxopropan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-1-oxohexan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-3-(1H-imidazol-4-yl)-1-oxopropan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-4-[[(2S)-2-[[(2S)-2-[[(2S)-2,6-diaminohexanoyl]amino]-3-methylbutanoyl]amino]propanoyl]amino]-5-oxopentanoic acid Chemical compound CC[C@H](C)[C@H](NC(=O)[C@@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@@H](N)CCCCN)C(C)C)C(C)C)C(C)C)C(C)C)C(C)C)C(C)C)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O SSOORFWOBGFTHL-OTEJMHTDSA-N 0.000 description 1
- YYGNTYWPHWGJRM-UHFFFAOYSA-N (6E,10E,14E,18E)-2,6,10,15,19,23-hexamethyltetracosa-2,6,10,14,18,22-hexaene Chemical compound CC(C)=CCCC(C)=CCCC(C)=CCCC=C(C)CCC=C(C)CCC=C(C)C YYGNTYWPHWGJRM-UHFFFAOYSA-N 0.000 description 1
- NBMKJKDGKREAPL-CXSFZGCWSA-N (8s,9r,10s,11s,13s,14s,16r,17r)-9-chloro-11,17-dihydroxy-17-(2-hydroxyacetyl)-10,13,16-trimethyl-6,7,8,11,12,14,15,16-octahydrocyclopenta[a]phenanthren-3-one Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(Cl)[C@@H]1[C@@H]1C[C@@H](C)[C@@](C(=O)CO)(O)[C@@]1(C)C[C@@H]2O NBMKJKDGKREAPL-CXSFZGCWSA-N 0.000 description 1
- FDKXTQMXEQVLRF-ZHACJKMWSA-N (E)-dacarbazine Chemical compound CN(C)\N=N\c1[nH]cnc1C(N)=O FDKXTQMXEQVLRF-ZHACJKMWSA-N 0.000 description 1
- IAKHMKGGTNLKSZ-INIZCTEOSA-N (S)-colchicine Chemical compound C1([C@@H](NC(C)=O)CC2)=CC(=O)C(OC)=CC=C1C1=C2C=C(OC)C(OC)=C1OC IAKHMKGGTNLKSZ-INIZCTEOSA-N 0.000 description 1
- SNKAWJBJQDLSFF-NVKMUCNASA-N 1,2-dioleoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCCCCCC\C=C/CCCCCCCC SNKAWJBJQDLSFF-NVKMUCNASA-N 0.000 description 1
- FUFLCEKSBBHCMO-UHFFFAOYSA-N 11-dehydrocorticosterone Natural products O=C1CCC2(C)C3C(=O)CC(C)(C(CC4)C(=O)CO)C4C3CCC2=C1 FUFLCEKSBBHCMO-UHFFFAOYSA-N 0.000 description 1
- ZESRJSPZRDMNHY-YFWFAHHUSA-N 11-deoxycorticosterone Chemical compound O=C1CC[C@]2(C)[C@H]3CC[C@](C)([C@H](CC4)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 ZESRJSPZRDMNHY-YFWFAHHUSA-N 0.000 description 1
- 108020005345 3' Untranslated Regions Proteins 0.000 description 1
- DJBRKGZFUXKLKO-UHFFFAOYSA-N 3-(pyridin-2-yldisulfanyl)propanoic acid Chemical compound OC(=O)CCSSC1=CC=CC=N1 DJBRKGZFUXKLKO-UHFFFAOYSA-N 0.000 description 1
- RHKWIGHJGOEUSM-UHFFFAOYSA-N 3h-imidazo[4,5-h]quinoline Chemical class C1=CN=C2C(N=CN3)=C3C=CC2=C1 RHKWIGHJGOEUSM-UHFFFAOYSA-N 0.000 description 1
- XEDONBRPTABQFB-UHFFFAOYSA-N 4-[(2-formyl-3-hydroxyphenoxy)methyl]benzoic acid Chemical compound C1=CC(C(=O)O)=CC=C1COC1=CC=CC(O)=C1C=O XEDONBRPTABQFB-UHFFFAOYSA-N 0.000 description 1
- TVZGACDUOSZQKY-LBPRGKRZSA-N 4-aminofolic acid Chemical compound C1=NC2=NC(N)=NC(N)=C2N=C1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 TVZGACDUOSZQKY-LBPRGKRZSA-N 0.000 description 1
- FJKROLUGYXJWQN-UHFFFAOYSA-N 4-hydroxybenzoic acid Chemical compound OC(=O)C1=CC=C(O)C=C1 FJKROLUGYXJWQN-UHFFFAOYSA-N 0.000 description 1
- 108010068327 4-hydroxyphenylpyruvate dioxygenase Proteins 0.000 description 1
- 101000768957 Acholeplasma phage L2 Uncharacterized 37.2 kDa protein Proteins 0.000 description 1
- 101000823746 Acidianus ambivalens Uncharacterized 17.7 kDa protein in bps2 3'region Proteins 0.000 description 1
- 101000916369 Acidianus ambivalens Uncharacterized protein in sor 5'region Proteins 0.000 description 1
- 101000769342 Acinetobacter guillouiae Uncharacterized protein in rpoN-murA intergenic region Proteins 0.000 description 1
- 101000823696 Actinobacillus pleuropneumoniae Uncharacterized glycosyltransferase in aroQ 3'region Proteins 0.000 description 1
- 208000024893 Acute lymphoblastic leukemia Diseases 0.000 description 1
- 208000014697 Acute lymphocytic leukaemia Diseases 0.000 description 1
- 208000031261 Acute myeloid leukaemia Diseases 0.000 description 1
- 101000786513 Agrobacterium tumefaciens (strain 15955) Uncharacterized protein outside the virF region Proteins 0.000 description 1
- PQSUYGKTWSAVDQ-ZVIOFETBSA-N Aldosterone Chemical compound C([C@@]1([C@@H](C(=O)CO)CC[C@H]1[C@@H]1CC2)C=O)[C@H](O)[C@@H]1[C@]1(C)C2=CC(=O)CC1 PQSUYGKTWSAVDQ-ZVIOFETBSA-N 0.000 description 1
- PQSUYGKTWSAVDQ-UHFFFAOYSA-N Aldosterone Natural products C1CC2C3CCC(C(=O)CO)C3(C=O)CC(O)C2C2(C)C1=CC(=O)CC2 PQSUYGKTWSAVDQ-UHFFFAOYSA-N 0.000 description 1
- 101000618005 Alkalihalobacillus pseudofirmus (strain ATCC BAA-2126 / JCM 17055 / OF4) Uncharacterized protein BpOF4_00885 Proteins 0.000 description 1
- 206010001935 American trypanosomiasis Diseases 0.000 description 1
- 201000003076 Angiosarcoma Diseases 0.000 description 1
- 102100020724 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 Human genes 0.000 description 1
- 241000272478 Aquila Species 0.000 description 1
- 101100162403 Arabidopsis thaliana ALEU gene Proteins 0.000 description 1
- 240000005528 Arctium lappa Species 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 206010003571 Astrocytoma Diseases 0.000 description 1
- 101000967489 Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571) Uncharacterized protein AZC_3924 Proteins 0.000 description 1
- 102100024222 B-lymphocyte antigen CD19 Human genes 0.000 description 1
- 238000011725 BALB/c mouse Methods 0.000 description 1
- 241000223836 Babesia Species 0.000 description 1
- 241000193830 Bacillus <bacterium> Species 0.000 description 1
- 101000823761 Bacillus licheniformis Uncharacterized 9.4 kDa protein in flaL 3'region Proteins 0.000 description 1
- 101000819719 Bacillus methanolicus Uncharacterized N-acetyltransferase in lysA 3'region Proteins 0.000 description 1
- 101000789586 Bacillus subtilis (strain 168) UPF0702 transmembrane protein YkjA Proteins 0.000 description 1
- 101000792624 Bacillus subtilis (strain 168) Uncharacterized protein YbxH Proteins 0.000 description 1
- 101000790792 Bacillus subtilis (strain 168) Uncharacterized protein YckC Proteins 0.000 description 1
- 101000819705 Bacillus subtilis (strain 168) Uncharacterized protein YlxR Proteins 0.000 description 1
- 101000948218 Bacillus subtilis (strain 168) Uncharacterized protein YtxJ Proteins 0.000 description 1
- 101000718627 Bacillus thuringiensis subsp. kurstaki Putative RNA polymerase sigma-G factor Proteins 0.000 description 1
- 208000035143 Bacterial infection Diseases 0.000 description 1
- DWRXFEITVBNRMK-UHFFFAOYSA-N Beta-D-1-Arabinofuranosylthymine Natural products O=C1NC(=O)C(C)=CN1C1C(O)C(O)C(CO)O1 DWRXFEITVBNRMK-UHFFFAOYSA-N 0.000 description 1
- 206010004593 Bile duct cancer Diseases 0.000 description 1
- 108010006654 Bleomycin Proteins 0.000 description 1
- 101000641200 Bombyx mori densovirus Putative non-structural protein Proteins 0.000 description 1
- 206010005949 Bone cancer Diseases 0.000 description 1
- 208000018084 Bone neoplasm Diseases 0.000 description 1
- 241000588807 Bordetella Species 0.000 description 1
- 241000588832 Bordetella pertussis Species 0.000 description 1
- 241000589968 Borrelia Species 0.000 description 1
- 241000589978 Borrelia hermsii Species 0.000 description 1
- 241000495356 Borrelia microti Species 0.000 description 1
- 241001148604 Borreliella afzelii Species 0.000 description 1
- 241000142472 Borreliella andersonii Species 0.000 description 1
- 241000589969 Borreliella burgdorferi Species 0.000 description 1
- 241001148605 Borreliella garinii Species 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 208000003508 Botulism Diseases 0.000 description 1
- 241000589893 Brachyspira hyodysenteriae Species 0.000 description 1
- VOVIALXJUBGFJZ-KWVAZRHASA-N Budesonide Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@@H]2[C@@H]1[C@@H]1C[C@H]3OC(CCC)O[C@@]3(C(=O)CO)[C@@]1(C)C[C@@H]2O VOVIALXJUBGFJZ-KWVAZRHASA-N 0.000 description 1
- COVZYZSDYWQREU-UHFFFAOYSA-N Busulfan Chemical compound CS(=O)(=O)OCCCCOS(C)(=O)=O COVZYZSDYWQREU-UHFFFAOYSA-N 0.000 description 1
- 102100036301 C-C chemokine receptor type 7 Human genes 0.000 description 1
- 102100021943 C-C motif chemokine 2 Human genes 0.000 description 1
- 101710155857 C-C motif chemokine 2 Proteins 0.000 description 1
- 102100032367 C-C motif chemokine 5 Human genes 0.000 description 1
- 241000589876 Campylobacter Species 0.000 description 1
- 241000589877 Campylobacter coli Species 0.000 description 1
- 241000589875 Campylobacter jejuni Species 0.000 description 1
- 241000222120 Candida <Saccharomycetales> Species 0.000 description 1
- 241000222122 Candida albicans Species 0.000 description 1
- 208000009458 Carcinoma in Situ Diseases 0.000 description 1
- 208000017897 Carcinoma of esophagus Diseases 0.000 description 1
- DLGOEMSEDOSKAD-UHFFFAOYSA-N Carmustine Chemical compound ClCCNC(=O)N(N=O)CCCl DLGOEMSEDOSKAD-UHFFFAOYSA-N 0.000 description 1
- 102100035882 Catalase Human genes 0.000 description 1
- 108010053835 Catalase Proteins 0.000 description 1
- 108010055166 Chemokine CCL5 Proteins 0.000 description 1
- 240000006162 Chenopodium quinoa Species 0.000 description 1
- 235000015493 Chenopodium quinoa Nutrition 0.000 description 1
- 241001647378 Chlamydia psittaci Species 0.000 description 1
- 241000606153 Chlamydia trachomatis Species 0.000 description 1
- 206010008631 Cholera Diseases 0.000 description 1
- 102100028757 Chondroitin sulfate proteoglycan 4 Human genes 0.000 description 1
- 201000009047 Chordoma Diseases 0.000 description 1
- 101000947633 Claviceps purpurea Uncharacterized 13.8 kDa protein Proteins 0.000 description 1
- 241000193163 Clostridioides difficile Species 0.000 description 1
- 241000193155 Clostridium botulinum Species 0.000 description 1
- 241000193449 Clostridium tetani Species 0.000 description 1
- 102000008186 Collagen Human genes 0.000 description 1
- 108010035532 Collagen Proteins 0.000 description 1
- 102000007644 Colony-Stimulating Factors Human genes 0.000 description 1
- 108010071942 Colony-Stimulating Factors Proteins 0.000 description 1
- MFYSYFVPBJMHGN-ZPOLXVRWSA-N Cortisone Chemical compound O=C1CC[C@]2(C)[C@H]3C(=O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 MFYSYFVPBJMHGN-ZPOLXVRWSA-N 0.000 description 1
- MFYSYFVPBJMHGN-UHFFFAOYSA-N Cortisone Natural products O=C1CCC2(C)C3C(=O)CC(C)(C(CC4)(O)C(=O)CO)C4C3CCC2=C1 MFYSYFVPBJMHGN-UHFFFAOYSA-N 0.000 description 1
- 241000186216 Corynebacterium Species 0.000 description 1
- 241000186227 Corynebacterium diphtheriae Species 0.000 description 1
- 108091029430 CpG site Proteins 0.000 description 1
- 208000009798 Craniopharyngioma Diseases 0.000 description 1
- 241000699802 Cricetulus griseus Species 0.000 description 1
- 241001337994 Cryptococcus <scale insect> Species 0.000 description 1
- 241000221204 Cryptococcus neoformans Species 0.000 description 1
- PMATZTZNYRCHOR-CGLBZJNRSA-N Cyclosporin A Chemical compound CC[C@@H]1NC(=O)[C@H]([C@H](O)[C@H](C)C\C=C\C)N(C)C(=O)[C@H](C(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)N(C)C(=O)[C@H](C(C)C)NC(=O)[C@H](CC(C)C)N(C)C(=O)CN(C)C1=O PMATZTZNYRCHOR-CGLBZJNRSA-N 0.000 description 1
- 229930105110 Cyclosporin A Natural products 0.000 description 1
- 108010036949 Cyclosporine Proteins 0.000 description 1
- UHDGCWIWMRVCDJ-CCXZUQQUSA-N Cytarabine Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@@H](O)[C@H](O)[C@@H](CO)O1 UHDGCWIWMRVCDJ-CCXZUQQUSA-N 0.000 description 1
- 241000701022 Cytomegalovirus Species 0.000 description 1
- WQZGKKKJIJFFOK-QTVWNMPRSA-N D-mannopyranose Chemical compound OC[C@H]1OC(O)[C@@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-QTVWNMPRSA-N 0.000 description 1
- YVGGHNCTFXOJCH-UHFFFAOYSA-N DDT Chemical compound C1=CC(Cl)=CC=C1C(C(Cl)(Cl)Cl)C1=CC=C(Cl)C=C1 YVGGHNCTFXOJCH-UHFFFAOYSA-N 0.000 description 1
- 238000011238 DNA vaccination Methods 0.000 description 1
- WEAHRLBPCANXCN-UHFFFAOYSA-N Daunomycin Natural products CCC1(O)CC(OC2CC(N)C(O)C(C)O2)c3cc4C(=O)c5c(OC)cccc5C(=O)c4c(O)c3C1 WEAHRLBPCANXCN-UHFFFAOYSA-N 0.000 description 1
- 102100031262 Deleted in malignant brain tumors 1 protein Human genes 0.000 description 1
- 241000725619 Dengue virus Species 0.000 description 1
- 241000702421 Dependoparvovirus Species 0.000 description 1
- FEWJPZIEWOKRBE-JCYAYHJZSA-N Dextrotartaric acid Chemical compound OC(=O)[C@H](O)[C@@H](O)C(O)=O FEWJPZIEWOKRBE-JCYAYHJZSA-N 0.000 description 1
- 238000009007 Diagnostic Kit Methods 0.000 description 1
- 208000002699 Digestive System Neoplasms Diseases 0.000 description 1
- QRLVDLBMBULFAL-UHFFFAOYSA-N Digitonin Natural products CC1CCC2(OC1)OC3C(O)C4C5CCC6CC(OC7OC(CO)C(OC8OC(CO)C(O)C(OC9OCC(O)C(O)C9OC%10OC(CO)C(O)C(OC%11OC(CO)C(O)C(O)C%11O)C%10O)C8O)C(O)C7O)C(O)CC6(C)C5CCC4(C)C3C2C QRLVDLBMBULFAL-UHFFFAOYSA-N 0.000 description 1
- 108010053187 Diphtheria Toxin Proteins 0.000 description 1
- 102000016607 Diphtheria Toxin Human genes 0.000 description 1
- 101150029707 ERBB2 gene Proteins 0.000 description 1
- 241000605314 Ehrlichia Species 0.000 description 1
- LVGKNOAMLMIIKO-UHFFFAOYSA-N Elaidinsaeure-aethylester Natural products CCCCCCCCC=CCCCCCCCC(=O)OCC LVGKNOAMLMIIKO-UHFFFAOYSA-N 0.000 description 1
- 201000009051 Embryonal Carcinoma Diseases 0.000 description 1
- 241000196324 Embryophyta Species 0.000 description 1
- MBYXEBXZARTUSS-QLWBXOBMSA-N Emetamine Natural products O(C)c1c(OC)cc2c(c(C[C@@H]3[C@H](CC)CN4[C@H](c5c(cc(OC)c(OC)c5)CC4)C3)ncc2)c1 MBYXEBXZARTUSS-QLWBXOBMSA-N 0.000 description 1
- 206010014733 Endometrial cancer Diseases 0.000 description 1
- 206010014759 Endometrial neoplasm Diseases 0.000 description 1
- 241000224431 Entamoeba Species 0.000 description 1
- 241001133638 Entamoeba equi Species 0.000 description 1
- 241000224432 Entamoeba histolytica Species 0.000 description 1
- 101000948901 Enterobacteria phage T4 Uncharacterized 16.0 kDa protein in segB-ipI intergenic region Proteins 0.000 description 1
- 241000194033 Enterococcus Species 0.000 description 1
- 241000194032 Enterococcus faecalis Species 0.000 description 1
- 241000194031 Enterococcus faecium Species 0.000 description 1
- 101710146739 Enterotoxin Proteins 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 206010014967 Ependymoma Diseases 0.000 description 1
- 101000805958 Equine herpesvirus 4 (strain 1942) Virion protein US10 homolog Proteins 0.000 description 1
- 208000031637 Erythroblastic Acute Leukemia Diseases 0.000 description 1
- 208000036566 Erythroleukaemia Diseases 0.000 description 1
- 241000588722 Escherichia Species 0.000 description 1
- 101000790442 Escherichia coli Insertion element IS2 uncharacterized 11.1 kDa protein Proteins 0.000 description 1
- 101000788354 Escherichia phage P2 Uncharacterized 8.2 kDa protein in gpA 5'region Proteins 0.000 description 1
- 208000000461 Esophageal Neoplasms Diseases 0.000 description 1
- 108700039887 Essential Genes Proteins 0.000 description 1
- 108010008165 Etanercept Proteins 0.000 description 1
- PIICEJLVQHRZGT-UHFFFAOYSA-N Ethylenediamine Chemical compound NCCN PIICEJLVQHRZGT-UHFFFAOYSA-N 0.000 description 1
- 208000006168 Ewing Sarcoma Diseases 0.000 description 1
- 108700024394 Exon Proteins 0.000 description 1
- 101710104359 F protein Proteins 0.000 description 1
- 201000008808 Fibrosarcoma Diseases 0.000 description 1
- 108010040721 Flagellin Proteins 0.000 description 1
- 241000710831 Flavivirus Species 0.000 description 1
- UUOUOERPONYGOS-CLCRDYEYSA-N Fluocinolone Chemical compound O=C1C=C[C@]2(C)[C@@]3(F)[C@@H](O)C[C@](C)([C@@]([C@H](O)C4)(O)C(=O)CO)[C@@H]4[C@@H]3C[C@H](F)C2=C1 UUOUOERPONYGOS-CLCRDYEYSA-N 0.000 description 1
- WJOHZNCJWYWUJD-IUGZLZTKSA-N Fluocinonide Chemical compound C1([C@@H](F)C2)=CC(=O)C=C[C@]1(C)[C@]1(F)[C@@H]2[C@@H]2C[C@H]3OC(C)(C)O[C@@]3(C(=O)COC(=O)C)[C@@]2(C)C[C@@H]1O WJOHZNCJWYWUJD-IUGZLZTKSA-N 0.000 description 1
- GHASVSINZRGABV-UHFFFAOYSA-N Fluorouracil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 description 1
- POPFMWWJOGLOIF-XWCQMRHXSA-N Flurandrenolide Chemical compound C1([C@@H](F)C2)=CC(=O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2C[C@H]3OC(C)(C)O[C@@]3(C(=O)CO)[C@@]2(C)C[C@@H]1O POPFMWWJOGLOIF-XWCQMRHXSA-N 0.000 description 1
- 101000770304 Frankia alni UPF0460 protein in nifX-nifW intergenic region Proteins 0.000 description 1
- 108091006027 G proteins Proteins 0.000 description 1
- 101150074355 GS gene Proteins 0.000 description 1
- 102000030782 GTP binding Human genes 0.000 description 1
- 108091000058 GTP-Binding Proteins 0.000 description 1
- 241000287828 Gallus gallus Species 0.000 description 1
- 229930182566 Gentamicin Natural products 0.000 description 1
- CEAZRRDELHUEMR-URQXQFDESA-N Gentamicin Chemical compound O1[C@H](C(C)NC)CC[C@@H](N)[C@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](NC)[C@@](C)(O)CO2)O)[C@H](N)C[C@@H]1N CEAZRRDELHUEMR-URQXQFDESA-N 0.000 description 1
- 101000797344 Geobacillus stearothermophilus Putative tRNA (cytidine(34)-2'-O)-methyltransferase Proteins 0.000 description 1
- 101000748410 Geobacillus stearothermophilus Uncharacterized protein in fumA 3'region Proteins 0.000 description 1
- 241000224466 Giardia Species 0.000 description 1
- 241000224467 Giardia intestinalis Species 0.000 description 1
- 208000032612 Glial tumor Diseases 0.000 description 1
- 206010018338 Glioma Diseases 0.000 description 1
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 102000003886 Glycoproteins Human genes 0.000 description 1
- 108090000288 Glycoproteins Proteins 0.000 description 1
- 108010026389 Gramicidin Proteins 0.000 description 1
- 241001316290 Gypsophila Species 0.000 description 1
- 241000606790 Haemophilus Species 0.000 description 1
- 101000772675 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) UPF0438 protein HI_0847 Proteins 0.000 description 1
- 101000631019 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) Uncharacterized protein HI_0350 Proteins 0.000 description 1
- 101100406392 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) omp26 gene Proteins 0.000 description 1
- 101000768938 Haemophilus phage HP1 (strain HP1c1) Uncharacterized 8.9 kDa protein in int-C1 intergenic region Proteins 0.000 description 1
- MUQNGPZZQDCDFT-JNQJZLCISA-N Halcinonide Chemical compound C1CC2=CC(=O)CC[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@H]3OC(C)(C)O[C@@]3(C(=O)CCl)[C@@]1(C)C[C@@H]2O MUQNGPZZQDCDFT-JNQJZLCISA-N 0.000 description 1
- 108010004889 Heat-Shock Proteins Proteins 0.000 description 1
- 102000002812 Heat-Shock Proteins Human genes 0.000 description 1
- 241000589989 Helicobacter Species 0.000 description 1
- 101710154606 Hemagglutinin Proteins 0.000 description 1
- 208000001258 Hemangiosarcoma Diseases 0.000 description 1
- 241000711549 Hepacivirus C Species 0.000 description 1
- 102100034459 Hepatitis A virus cellular receptor 1 Human genes 0.000 description 1
- 241000700721 Hepatitis B virus Species 0.000 description 1
- 241000724675 Hepatitis E virus Species 0.000 description 1
- 241000709721 Hepatovirus A Species 0.000 description 1
- 108010088652 Histocompatibility Antigens Class I Proteins 0.000 description 1
- 102000008949 Histocompatibility Antigens Class I Human genes 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 101000785414 Homo sapiens Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 Proteins 0.000 description 1
- 101000980825 Homo sapiens B-lymphocyte antigen CD19 Proteins 0.000 description 1
- 101000716065 Homo sapiens C-C chemokine receptor type 7 Proteins 0.000 description 1
- 101000777387 Homo sapiens C-C motif chemokine 3 Proteins 0.000 description 1
- 101000914324 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 5 Proteins 0.000 description 1
- 101000914321 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 7 Proteins 0.000 description 1
- 101000916489 Homo sapiens Chondroitin sulfate proteoglycan 4 Proteins 0.000 description 1
- 101000844721 Homo sapiens Deleted in malignant brain tumors 1 protein Proteins 0.000 description 1
- 101000876511 Homo sapiens General transcription and DNA repair factor IIH helicase subunit XPD Proteins 0.000 description 1
- 101001068136 Homo sapiens Hepatitis A virus cellular receptor 1 Proteins 0.000 description 1
- 101001103039 Homo sapiens Inactive tyrosine-protein kinase transmembrane receptor ROR1 Proteins 0.000 description 1
- 101000984198 Homo sapiens Leukocyte immunoglobulin-like receptor subfamily A member 1 Proteins 0.000 description 1
- 101000984197 Homo sapiens Leukocyte immunoglobulin-like receptor subfamily A member 2 Proteins 0.000 description 1
- 101000984199 Homo sapiens Leukocyte immunoglobulin-like receptor subfamily A member 4 Proteins 0.000 description 1
- 101000620359 Homo sapiens Melanocyte protein PMEL Proteins 0.000 description 1
- 101000578784 Homo sapiens Melanoma antigen recognized by T-cells 1 Proteins 0.000 description 1
- 101000616778 Homo sapiens Myelin-associated glycoprotein Proteins 0.000 description 1
- 101001103036 Homo sapiens Nuclear receptor ROR-alpha Proteins 0.000 description 1
- 101000617725 Homo sapiens Pregnancy-specific beta-1-glycoprotein 2 Proteins 0.000 description 1
- 101000831286 Homo sapiens Protein timeless homolog Proteins 0.000 description 1
- 101001130441 Homo sapiens Ras-related protein Rap-2a Proteins 0.000 description 1
- 101001094545 Homo sapiens Retrotransposon-like protein 1 Proteins 0.000 description 1
- 101000752245 Homo sapiens Rho guanine nucleotide exchange factor 5 Proteins 0.000 description 1
- 101000650820 Homo sapiens Semaphorin-4A Proteins 0.000 description 1
- 101000669447 Homo sapiens Toll-like receptor 4 Proteins 0.000 description 1
- 101000669460 Homo sapiens Toll-like receptor 5 Proteins 0.000 description 1
- 101000669402 Homo sapiens Toll-like receptor 7 Proteins 0.000 description 1
- 101000904724 Homo sapiens Transmembrane glycoprotein NMB Proteins 0.000 description 1
- 101000611183 Homo sapiens Tumor necrosis factor Proteins 0.000 description 1
- 241000701085 Human alphaherpesvirus 3 Species 0.000 description 1
- 206010071038 Human anaplasmosis Diseases 0.000 description 1
- 241000701044 Human gammaherpesvirus 4 Species 0.000 description 1
- 241000701806 Human papillomavirus Species 0.000 description 1
- UGQMRVRMYYASKQ-UHFFFAOYSA-N Hypoxanthine nucleoside Natural products OC1C(O)C(CO)OC1N1C(NC=NC2=O)=C2N=C1 UGQMRVRMYYASKQ-UHFFFAOYSA-N 0.000 description 1
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 1
- 102100039615 Inactive tyrosine-protein kinase transmembrane receptor ROR1 Human genes 0.000 description 1
- 229930010555 Inosine Natural products 0.000 description 1
- UGQMRVRMYYASKQ-KQYNXXCUSA-N Inosine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C2=NC=NC(O)=C2N=C1 UGQMRVRMYYASKQ-KQYNXXCUSA-N 0.000 description 1
- 108010064593 Intercellular Adhesion Molecule-1 Proteins 0.000 description 1
- 102100026720 Interferon beta Human genes 0.000 description 1
- 108010047761 Interferon-alpha Proteins 0.000 description 1
- 102000006992 Interferon-alpha Human genes 0.000 description 1
- 108090000467 Interferon-beta Proteins 0.000 description 1
- 102000008070 Interferon-gamma Human genes 0.000 description 1
- 108010050904 Interferons Proteins 0.000 description 1
- 102000014150 Interferons Human genes 0.000 description 1
- 102100020881 Interleukin-1 alpha Human genes 0.000 description 1
- 102000003777 Interleukin-1 beta Human genes 0.000 description 1
- 108090000193 Interleukin-1 beta Proteins 0.000 description 1
- 108090000174 Interleukin-10 Proteins 0.000 description 1
- 108090000176 Interleukin-13 Proteins 0.000 description 1
- 102000003812 Interleukin-15 Human genes 0.000 description 1
- 108090000172 Interleukin-15 Proteins 0.000 description 1
- 108010082786 Interleukin-1alpha Proteins 0.000 description 1
- 108010002616 Interleukin-5 Proteins 0.000 description 1
- 108010002586 Interleukin-7 Proteins 0.000 description 1
- 102100021592 Interleukin-7 Human genes 0.000 description 1
- 241000710842 Japanese encephalitis virus Species 0.000 description 1
- 101000782488 Junonia coenia densovirus (isolate pBRJ/1990) Putative non-structural protein NS2 Proteins 0.000 description 1
- 208000008839 Kidney Neoplasms Diseases 0.000 description 1
- 101000811523 Klebsiella pneumoniae Uncharacterized 55.8 kDa protein in cps region Proteins 0.000 description 1
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 1
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 1
- 108010092694 L-Selectin Proteins 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- 239000011786 L-ascorbyl-6-palmitate Substances 0.000 description 1
- QAQJMLQRFWZOBN-LAUBAEHRSA-N L-ascorbyl-6-palmitate Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](O)[C@H]1OC(=O)C(O)=C1O QAQJMLQRFWZOBN-LAUBAEHRSA-N 0.000 description 1
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 1
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 1
- 229930182816 L-glutamine Natural products 0.000 description 1
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 1
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 1
- 102000016551 L-selectin Human genes 0.000 description 1
- 101000818409 Lactococcus lactis subsp. lactis Uncharacterized HTH-type transcriptional regulator in lacX 3'region Proteins 0.000 description 1
- 102100032241 Lactotransferrin Human genes 0.000 description 1
- 206010023825 Laryngeal cancer Diseases 0.000 description 1
- 241000589248 Legionella Species 0.000 description 1
- 241000589242 Legionella pneumophila Species 0.000 description 1
- 208000007764 Legionnaires' Disease Diseases 0.000 description 1
- 208000018142 Leiomyosarcoma Diseases 0.000 description 1
- 241000270322 Lepidosauria Species 0.000 description 1
- 101000878851 Leptolyngbya boryana Putative Fe(2+) transport protein A Proteins 0.000 description 1
- 241000589902 Leptospira Species 0.000 description 1
- 241000589929 Leptospira interrogans Species 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 102100025587 Leukocyte immunoglobulin-like receptor subfamily A member 1 Human genes 0.000 description 1
- 102100025586 Leukocyte immunoglobulin-like receptor subfamily A member 2 Human genes 0.000 description 1
- 102100025555 Leukocyte immunoglobulin-like receptor subfamily A member 4 Human genes 0.000 description 1
- LAZPBGZRMVRFKY-HNCPQSOCSA-N Levamisole hydrochloride Chemical compound Cl.C1([C@H]2CN3CCSC3=N2)=CC=CC=C1 LAZPBGZRMVRFKY-HNCPQSOCSA-N 0.000 description 1
- NNJVILVZKWQKPM-UHFFFAOYSA-N Lidocaine Chemical compound CCN(CC)CC(=O)NC1=C(C)C=CC=C1C NNJVILVZKWQKPM-UHFFFAOYSA-N 0.000 description 1
- 241000186781 Listeria Species 0.000 description 1
- 241000186779 Listeria monocytogenes Species 0.000 description 1
- 102100033486 Lymphocyte antigen 75 Human genes 0.000 description 1
- 101710157884 Lymphocyte antigen 75 Proteins 0.000 description 1
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- 102000043129 MHC class I family Human genes 0.000 description 1
- 108091054437 MHC class I family Proteins 0.000 description 1
- 241000282567 Macaca fascicularis Species 0.000 description 1
- FYYHWMGAXLPEAU-UHFFFAOYSA-N Magnesium Chemical compound [Mg] FYYHWMGAXLPEAU-UHFFFAOYSA-N 0.000 description 1
- 108010031099 Mannose Receptor Proteins 0.000 description 1
- 101710085938 Matrix protein Proteins 0.000 description 1
- 241000712079 Measles morbillivirus Species 0.000 description 1
- 208000007054 Medullary Carcinoma Diseases 0.000 description 1
- 208000000172 Medulloblastoma Diseases 0.000 description 1
- 102100028389 Melanoma antigen recognized by T-cells 1 Human genes 0.000 description 1
- 101710127721 Membrane protein Proteins 0.000 description 1
- 102000003735 Mesothelin Human genes 0.000 description 1
- 108090000015 Mesothelin Proteins 0.000 description 1
- 206010027406 Mesothelioma Diseases 0.000 description 1
- 101000758828 Methanosarcina barkeri (strain Fusaro / DSM 804) Uncharacterized protein Mbar_A1602 Proteins 0.000 description 1
- FQISKWAFAHGMGT-SGJOWKDISA-M Methylprednisolone sodium succinate Chemical compound [Na+].C([C@@]12C)=CC(=O)C=C1[C@@H](C)C[C@@H]1[C@@H]2[C@@H](O)C[C@]2(C)[C@@](O)(C(=O)COC(=O)CCC([O-])=O)CC[C@H]21 FQISKWAFAHGMGT-SGJOWKDISA-M 0.000 description 1
- 101001122401 Middle East respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) Non-structural protein ORF3 Proteins 0.000 description 1
- VFKZTMPDYBFSTM-KVTDHHQDSA-N Mitobronitol Chemical compound BrC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CBr VFKZTMPDYBFSTM-KVTDHHQDSA-N 0.000 description 1
- 229930192392 Mitomycin Natural products 0.000 description 1
- 241000588621 Moraxella Species 0.000 description 1
- 241000588622 Moraxella bovis Species 0.000 description 1
- 241000588655 Moraxella catarrhalis Species 0.000 description 1
- 108010008707 Mucin-1 Proteins 0.000 description 1
- 102100034256 Mucin-1 Human genes 0.000 description 1
- 208000034578 Multiple myelomas Diseases 0.000 description 1
- 241000711386 Mumps virus Species 0.000 description 1
- MSFSPUZXLOGKHJ-UHFFFAOYSA-N Muraminsaeure Natural products OC(=O)C(C)OC1C(N)C(O)OC(CO)C1O MSFSPUZXLOGKHJ-UHFFFAOYSA-N 0.000 description 1
- 101000713102 Mus musculus C-C motif chemokine 1 Proteins 0.000 description 1
- 101000905241 Mus musculus Heart- and neural crest derivatives-expressed protein 1 Proteins 0.000 description 1
- 101100027996 Mus musculus Omg gene Proteins 0.000 description 1
- 101100519207 Mus musculus Pdcd1 gene Proteins 0.000 description 1
- 241000699670 Mus sp. Species 0.000 description 1
- 241000186359 Mycobacterium Species 0.000 description 1
- 241000186367 Mycobacterium avium Species 0.000 description 1
- 241000187482 Mycobacterium avium subsp. paratuberculosis Species 0.000 description 1
- 241000186362 Mycobacterium leprae Species 0.000 description 1
- 241000187480 Mycobacterium smegmatis Species 0.000 description 1
- 101001055788 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) Pentapeptide repeat protein MfpA Proteins 0.000 description 1
- 108010083674 Myelin Proteins Proteins 0.000 description 1
- 102000006386 Myelin Proteins Human genes 0.000 description 1
- 208000033776 Myeloid Acute Leukemia Diseases 0.000 description 1
- MBBZMMPHUWSWHV-BDVNFPICSA-N N-methylglucamine Chemical compound CNC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO MBBZMMPHUWSWHV-BDVNFPICSA-N 0.000 description 1
- 238000005481 NMR spectroscopy Methods 0.000 description 1
- 208000002454 Nasopharyngeal Carcinoma Diseases 0.000 description 1
- 206010061306 Nasopharyngeal cancer Diseases 0.000 description 1
- 241000588652 Neisseria gonorrhoeae Species 0.000 description 1
- 241000588650 Neisseria meningitidis Species 0.000 description 1
- 102100035069 Neuronal vesicle trafficking-associated protein 2 Human genes 0.000 description 1
- 101710085178 Neuronal vesicle trafficking-associated protein 2 Proteins 0.000 description 1
- HCUVEUVIUAJXRB-UHFFFAOYSA-N OC1=C(C=C(CNC(CCCC=2SC=CC=2)=O)C=C1)OC Chemical compound OC1=C(C=C(CNC(CCCC=2SC=CC=2)=O)C=C1)OC HCUVEUVIUAJXRB-UHFFFAOYSA-N 0.000 description 1
- 201000010133 Oligodendroglioma Diseases 0.000 description 1
- 108700026244 Open Reading Frames Proteins 0.000 description 1
- 101000740670 Orgyia pseudotsugata multicapsid polyhedrosis virus Protein C42 Proteins 0.000 description 1
- 101710093908 Outer capsid protein VP4 Proteins 0.000 description 1
- 101710135467 Outer capsid protein sigma-1 Proteins 0.000 description 1
- 101710116435 Outer membrane protein Proteins 0.000 description 1
- 229940124060 PD-1 antagonist Drugs 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 229930012538 Paclitaxel Natural products 0.000 description 1
- MKPDWECBUAZOHP-AFYJWTTESA-N Paramethasone Chemical compound C1([C@@H](F)C2)=CC(=O)C=C[C@]1(C)[C@@H]1[C@@H]2[C@@H]2C[C@@H](C)[C@@](C(=O)CO)(O)[C@@]2(C)C[C@@H]1O MKPDWECBUAZOHP-AFYJWTTESA-N 0.000 description 1
- 208000002606 Paramyxoviridae Infections Diseases 0.000 description 1
- 208000030852 Parasitic disease Diseases 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 108010013639 Peptidoglycan Proteins 0.000 description 1
- 241000009328 Perro Species 0.000 description 1
- 108010081690 Pertussis Toxin Proteins 0.000 description 1
- 206010057249 Phagocytosis Diseases 0.000 description 1
- 101000769182 Photorhabdus luminescens Uncharacterized protein in pnp 3'region Proteins 0.000 description 1
- 101710099976 Photosystem I P700 chlorophyll a apoprotein A1 Proteins 0.000 description 1
- 208000007641 Pinealoma Diseases 0.000 description 1
- 101000983333 Plasmodium falciparum (isolate NF54) 25 kDa ookinete surface antigen Proteins 0.000 description 1
- 241000233870 Pneumocystis Species 0.000 description 1
- 241000233872 Pneumocystis carinii Species 0.000 description 1
- 101710183389 Pneumolysin Proteins 0.000 description 1
- 241000276498 Pollachius virens Species 0.000 description 1
- 101710159752 Poly(3-hydroxyalkanoate) polymerase subunit PhaE Proteins 0.000 description 1
- 229920002732 Polyanhydride Polymers 0.000 description 1
- 229920000954 Polyglycolide Polymers 0.000 description 1
- 108091036414 Polyinosinic:polycytidylic acid Proteins 0.000 description 1
- 229920001710 Polyorthoester Polymers 0.000 description 1
- ZLMJMSJWJFRBEC-UHFFFAOYSA-N Potassium Chemical compound [K] ZLMJMSJWJFRBEC-UHFFFAOYSA-N 0.000 description 1
- 208000006664 Precursor Cell Lymphoblastic Leukemia-Lymphoma Diseases 0.000 description 1
- 102100022019 Pregnancy-specific beta-1-glycoprotein 2 Human genes 0.000 description 1
- 101710130262 Probable Vpr-like protein Proteins 0.000 description 1
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 1
- 101710176177 Protein A56 Proteins 0.000 description 1
- 101000961392 Pseudescherichia vulneris Uncharacterized 29.9 kDa protein in crtE 3'region Proteins 0.000 description 1
- 241000589516 Pseudomonas Species 0.000 description 1
- 101000731030 Pseudomonas oleovorans Poly(3-hydroxyalkanoate) polymerase 2 Proteins 0.000 description 1
- 101001065485 Pseudomonas putida Probable fatty acid methyltransferase Proteins 0.000 description 1
- 238000002123 RNA extraction Methods 0.000 description 1
- 238000011530 RNeasy Mini Kit Methods 0.000 description 1
- 239000012980 RPMI-1640 medium Substances 0.000 description 1
- 238000011529 RT qPCR Methods 0.000 description 1
- 102100022851 Rab5 GDP/GTP exchange factor Human genes 0.000 description 1
- 241000711798 Rabies lyssavirus Species 0.000 description 1
- 102100031420 Ras-related protein Rap-2a Human genes 0.000 description 1
- 208000015634 Rectal Neoplasms Diseases 0.000 description 1
- 206010038389 Renal cancer Diseases 0.000 description 1
- 101710203837 Replication-associated protein Proteins 0.000 description 1
- 241000725643 Respiratory syncytial virus Species 0.000 description 1
- 101000711023 Rhizobium leguminosarum bv. trifolii Uncharacterized protein in tfuA 3'region Proteins 0.000 description 1
- 101000948156 Rhodococcus erythropolis Uncharacterized 47.3 kDa protein in thcA 5'region Proteins 0.000 description 1
- 101000917565 Rhodococcus fascians Uncharacterized 33.6 kDa protein in fasciation locus Proteins 0.000 description 1
- 241000606701 Rickettsia Species 0.000 description 1
- 241000606695 Rickettsia rickettsii Species 0.000 description 1
- 241000702670 Rotavirus Species 0.000 description 1
- AUVVAXYIELKVAI-UHFFFAOYSA-N SJ000285215 Natural products N1CCC2=CC(OC)=C(OC)C=C2C1CC1CC2C3=CC(OC)=C(OC)C=C3CCN2CC1CC AUVVAXYIELKVAI-UHFFFAOYSA-N 0.000 description 1
- 101000999689 Saimiriine herpesvirus 2 (strain 11) Transcriptional regulator ICP22 homolog Proteins 0.000 description 1
- 101000790284 Saimiriine herpesvirus 2 (strain 488) Uncharacterized 9.5 kDa protein in DHFR 3'region Proteins 0.000 description 1
- 241000607142 Salmonella Species 0.000 description 1
- 241001138501 Salmonella enterica Species 0.000 description 1
- 241001354013 Salmonella enterica subsp. enterica serovar Enteritidis Species 0.000 description 1
- 241000531795 Salmonella enterica subsp. enterica serovar Paratyphi A Species 0.000 description 1
- 241000293871 Salmonella enterica subsp. enterica serovar Typhi Species 0.000 description 1
- 239000002262 Schiff base Substances 0.000 description 1
- 150000004753 Schiff bases Chemical class 0.000 description 1
- 241000242680 Schistosoma mansoni Species 0.000 description 1
- 102100027718 Semaphorin-4A Human genes 0.000 description 1
- 201000010208 Seminoma Diseases 0.000 description 1
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 1
- 241000607768 Shigella Species 0.000 description 1
- 241000607764 Shigella dysenteriae Species 0.000 description 1
- 241000607760 Shigella sonnei Species 0.000 description 1
- 201000004283 Shwachman-Diamond syndrome Diseases 0.000 description 1
- 208000000453 Skin Neoplasms Diseases 0.000 description 1
- 241000191940 Staphylococcus Species 0.000 description 1
- 241000191963 Staphylococcus epidermidis Species 0.000 description 1
- 241000194017 Streptococcus Species 0.000 description 1
- 101000936719 Streptococcus gordonii Accessory Sec system protein Asp3 Proteins 0.000 description 1
- 108010011834 Streptolysins Proteins 0.000 description 1
- 101000788499 Streptomyces coelicolor Uncharacterized oxidoreductase in mprA 5'region Proteins 0.000 description 1
- 101001102841 Streptomyces griseus Purine nucleoside phosphorylase ORF3 Proteins 0.000 description 1
- 101000708557 Streptomyces lincolnensis Uncharacterized 17.2 kDa protein in melC2-rnhH intergenic region Proteins 0.000 description 1
- ZSJLQEPLLKMAKR-UHFFFAOYSA-N Streptozotocin Natural products O=NN(C)C(=O)NC1C(O)OC(CO)C(O)C1O ZSJLQEPLLKMAKR-UHFFFAOYSA-N 0.000 description 1
- 239000012505 Superdex™ Substances 0.000 description 1
- 101800001271 Surface protein Proteins 0.000 description 1
- 230000006052 T cell proliferation Effects 0.000 description 1
- QJJXYPPXXYFBGM-LFZNUXCKSA-N Tacrolimus Chemical compound C1C[C@@H](O)[C@H](OC)C[C@@H]1\C=C(/C)[C@@H]1[C@H](C)[C@@H](O)CC(=O)[C@H](CC=C)/C=C(C)/C[C@H](C)C[C@H](OC)[C@H]([C@H](C[C@H]2C)OC)O[C@@]2(O)C(=O)C(=O)N2CCCC[C@H]2C(=O)O1 QJJXYPPXXYFBGM-LFZNUXCKSA-N 0.000 description 1
- FEWJPZIEWOKRBE-UHFFFAOYSA-N Tartaric acid Natural products [H+].[H+].[O-]C(=O)C(O)C(O)C([O-])=O FEWJPZIEWOKRBE-UHFFFAOYSA-N 0.000 description 1
- BPEGJWRSRHCHSN-UHFFFAOYSA-N Temozolomide Chemical compound O=C1N(C)N=NC2=C(C(N)=O)N=CN21 BPEGJWRSRHCHSN-UHFFFAOYSA-N 0.000 description 1
- 206010057644 Testis cancer Diseases 0.000 description 1
- 206010043376 Tetanus Diseases 0.000 description 1
- 108010055044 Tetanus Toxin Proteins 0.000 description 1
- BHEOSNUKNHRBNM-UHFFFAOYSA-N Tetramethylsqualene Natural products CC(=C)C(C)CCC(=C)C(C)CCC(C)=CCCC=C(C)CCC(C)C(=C)CCC(C)C(C)=C BHEOSNUKNHRBNM-UHFFFAOYSA-N 0.000 description 1
- 101000649826 Thermotoga neapolitana Putative anti-sigma factor antagonist TM1081 homolog Proteins 0.000 description 1
- 208000024770 Thyroid neoplasm Diseases 0.000 description 1
- 241000710771 Tick-borne encephalitis virus Species 0.000 description 1
- 108010060825 Toll-Like Receptor 7 Proteins 0.000 description 1
- 102000008236 Toll-Like Receptor 7 Human genes 0.000 description 1
- 229940123384 Toll-like receptor (TLR) agonist Drugs 0.000 description 1
- 102100039360 Toll-like receptor 4 Human genes 0.000 description 1
- 102100039357 Toll-like receptor 5 Human genes 0.000 description 1
- 102100039390 Toll-like receptor 7 Human genes 0.000 description 1
- 241000223996 Toxoplasma Species 0.000 description 1
- 101710134694 Transcriptional regulator ICP22 homolog Proteins 0.000 description 1
- 102000010912 Transferrin-Binding Proteins Human genes 0.000 description 1
- 108010062476 Transferrin-Binding Proteins Proteins 0.000 description 1
- 101800004564 Transforming growth factor alpha Proteins 0.000 description 1
- 102400001320 Transforming growth factor alpha Human genes 0.000 description 1
- 102100023935 Transmembrane glycoprotein NMB Human genes 0.000 description 1
- 241000589886 Treponema Species 0.000 description 1
- 241000589892 Treponema denticola Species 0.000 description 1
- 241000224526 Trichomonas Species 0.000 description 1
- 241000224527 Trichomonas vaginalis Species 0.000 description 1
- 241000223104 Trypanosoma Species 0.000 description 1
- 241000223109 Trypanosoma cruzi Species 0.000 description 1
- GBOGMAARMMDZGR-UHFFFAOYSA-N UNPD149280 Natural products N1C(=O)C23OC(=O)C=CC(O)CCCC(C)CC=CC3C(O)C(=C)C(C)C2C1CC1=CC=CC=C1 GBOGMAARMMDZGR-UHFFFAOYSA-N 0.000 description 1
- 108010046334 Urease Proteins 0.000 description 1
- 241000700647 Variola virus Species 0.000 description 1
- 241000251539 Vertebrata <Metazoa> Species 0.000 description 1
- 208000014070 Vestibular schwannoma Diseases 0.000 description 1
- 241000607598 Vibrio Species 0.000 description 1
- 101000827562 Vibrio alginolyticus Uncharacterized protein in proC 3'region Proteins 0.000 description 1
- 241000607626 Vibrio cholerae Species 0.000 description 1
- 101000778915 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) Uncharacterized membrane protein VP2115 Proteins 0.000 description 1
- 208000033559 Waldenström macroglobulinemia Diseases 0.000 description 1
- 208000008383 Wilms tumor Diseases 0.000 description 1
- 241000710772 Yellow fever virus Species 0.000 description 1
- 241000607734 Yersinia <bacteria> Species 0.000 description 1
- 241000607447 Yersinia enterocolitica Species 0.000 description 1
- 241000607479 Yersinia pestis Species 0.000 description 1
- 241000607477 Yersinia pseudotuberculosis Species 0.000 description 1
- HCHKCACWOHOZIP-UHFFFAOYSA-N Zinc Chemical class [Zn] HCHKCACWOHOZIP-UHFFFAOYSA-N 0.000 description 1
- UZQJVUCHXGYFLQ-AYDHOLPZSA-N [(2s,3r,4s,5r,6r)-4-[(2s,3r,4s,5r,6r)-4-[(2r,3r,4s,5r,6r)-4-[(2s,3r,4s,5r,6r)-3,5-dihydroxy-6-(hydroxymethyl)-4-[(2s,3r,4s,5s,6r)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxyoxan-2-yl]oxy-3,5-dihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy-3,5-dihydroxy-6-(hy Chemical compound O([C@H]1[C@H](O)[C@@H](CO)O[C@H]([C@@H]1O)O[C@H]1[C@H](O)[C@@H](CO)O[C@H]([C@@H]1O)O[C@H]1CC[C@]2(C)[C@H]3CC=C4[C@@]([C@@]3(CC[C@H]2[C@@]1(C=O)C)C)(C)CC(O)[C@]1(CCC(CC14)(C)C)C(=O)O[C@H]1[C@@H]([C@@H](O[C@H]2[C@@H]([C@@H](O[C@H]3[C@@H]([C@@H](O[C@H]4[C@@H]([C@@H](O[C@H]5[C@@H]([C@@H](O)[C@H](O)[C@@H](CO)O5)O)[C@H](O)[C@@H](CO)O4)O)[C@H](O)[C@@H](CO)O3)O)[C@H](O)[C@@H](CO)O2)O)[C@H](O)[C@@H](CO)O1)O)[C@@H]1O[C@H](CO)[C@@H](O)[C@H](O)[C@H]1O UZQJVUCHXGYFLQ-AYDHOLPZSA-N 0.000 description 1
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 1
- HMNZFMSWFCAGGW-XPWSMXQVSA-N [3-[hydroxy(2-hydroxyethoxy)phosphoryl]oxy-2-[(e)-octadec-9-enoyl]oxypropyl] (e)-octadec-9-enoate Chemical compound CCCCCCCC\C=C\CCCCCCCC(=O)OCC(COP(O)(=O)OCCO)OC(=O)CCCCCCC\C=C\CCCCCCCC HMNZFMSWFCAGGW-XPWSMXQVSA-N 0.000 description 1
- LTOCXIVQWDANEX-UXCYUTBZSA-M [Br-].CCCC\C=C/CCCCCCCCOCC(C[N+](C)(C)CCCN)OCCCCCCCC\C=C/CCCC.CC(C)CCCC(C)CCCC(C)CCCC(C)CC(=O)OC[C@H](COP(O)(=O)OCCN)OC(=O)CC(C)CCCC(C)CCCC(C)CCCC(C)C Chemical compound [Br-].CCCC\C=C/CCCCCCCCOCC(C[N+](C)(C)CCCN)OCCCCCCCC\C=C/CCCC.CC(C)CCCC(C)CCCC(C)CCCC(C)CC(=O)OC[C@H](COP(O)(=O)OCCN)OC(=O)CC(C)CCCC(C)CCCC(C)CCCC(C)C LTOCXIVQWDANEX-UXCYUTBZSA-M 0.000 description 1
- 239000003070 absorption delaying agent Substances 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 208000004064 acoustic neuroma Diseases 0.000 description 1
- 208000017733 acquired polycythemia vera Diseases 0.000 description 1
- 229930183665 actinomycin Natural products 0.000 description 1
- 239000013543 active substance Substances 0.000 description 1
- 208000021841 acute erythroid leukemia Diseases 0.000 description 1
- 229960002964 adalimumab Drugs 0.000 description 1
- 230000003044 adaptive effect Effects 0.000 description 1
- 238000011374 additional therapy Methods 0.000 description 1
- 108060000200 adenylate cyclase Proteins 0.000 description 1
- 102000030621 adenylate cyclase Human genes 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 238000000246 agarose gel electrophoresis Methods 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 229960002478 aldosterone Drugs 0.000 description 1
- 125000001931 aliphatic group Chemical group 0.000 description 1
- 229910052784 alkaline earth metal Inorganic materials 0.000 description 1
- 150000001342 alkaline earth metals Chemical class 0.000 description 1
- 229940100198 alkylating agent Drugs 0.000 description 1
- 239000002168 alkylating agent Substances 0.000 description 1
- 229940037003 alum Drugs 0.000 description 1
- AZDRQVAHHNSJOQ-UHFFFAOYSA-N alumane Chemical class [AlH3] AZDRQVAHHNSJOQ-UHFFFAOYSA-N 0.000 description 1
- ILRRQNADMUWWFW-UHFFFAOYSA-K aluminium phosphate Chemical compound O1[Al]2OP1(=O)O2 ILRRQNADMUWWFW-UHFFFAOYSA-K 0.000 description 1
- 229910000147 aluminium phosphate Inorganic materials 0.000 description 1
- 229940024546 aluminum hydroxide gel Drugs 0.000 description 1
- SMYKVLBUSSNXMV-UHFFFAOYSA-K aluminum;trihydroxide;hydrate Chemical compound O.[OH-].[OH-].[OH-].[Al+3] SMYKVLBUSSNXMV-UHFFFAOYSA-K 0.000 description 1
- 101150078331 ama-1 gene Proteins 0.000 description 1
- 150000001408 amides Chemical class 0.000 description 1
- 229960003896 aminopterin Drugs 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 238000005571 anion exchange chromatography Methods 0.000 description 1
- MWPLVEDNUUSJAV-UHFFFAOYSA-N anthracene Chemical compound C1=CC=CC2=CC3=CC=CC=C3C=C21 MWPLVEDNUUSJAV-UHFFFAOYSA-N 0.000 description 1
- 229940045799 anthracyclines and related substance Drugs 0.000 description 1
- 229940121363 anti-inflammatory agent Drugs 0.000 description 1
- 239000002260 anti-inflammatory agent Substances 0.000 description 1
- 230000000340 anti-metabolite Effects 0.000 description 1
- 230000000259 anti-tumor effect Effects 0.000 description 1
- 229940088710 antibiotic agent Drugs 0.000 description 1
- 230000009830 antibody antigen interaction Effects 0.000 description 1
- 238000009175 antibody therapy Methods 0.000 description 1
- 229940100197 antimetabolite Drugs 0.000 description 1
- 239000002256 antimetabolite Substances 0.000 description 1
- 239000003080 antimitotic agent Substances 0.000 description 1
- 239000002246 antineoplastic agent Substances 0.000 description 1
- 238000013459 approach Methods 0.000 description 1
- 239000012062 aqueous buffer Substances 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 159000000032 aromatic acids Chemical class 0.000 description 1
- 125000003118 aryl group Chemical group 0.000 description 1
- 235000010323 ascorbic acid Nutrition 0.000 description 1
- 229960005070 ascorbic acid Drugs 0.000 description 1
- 239000011668 ascorbic acid Substances 0.000 description 1
- 235000010385 ascorbyl palmitate Nutrition 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- 229960003852 atezolizumab Drugs 0.000 description 1
- 201000008680 babesiosis Diseases 0.000 description 1
- 229940092705 beclomethasone Drugs 0.000 description 1
- NBMKJKDGKREAPL-DVTGEIKXSA-N beclomethasone Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(Cl)[C@@H]1[C@@H]1C[C@H](C)[C@@](C(=O)CO)(O)[C@@]1(C)C[C@@H]2O NBMKJKDGKREAPL-DVTGEIKXSA-N 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- JUHORIMYRDESRB-UHFFFAOYSA-N benzathine Chemical compound C=1C=CC=CC=1CNCCNCC1=CC=CC=C1 JUHORIMYRDESRB-UHFFFAOYSA-N 0.000 description 1
- 102000015736 beta 2-Microglobulin Human genes 0.000 description 1
- 108010081355 beta 2-Microglobulin Proteins 0.000 description 1
- IQFYYKKMVGJFEH-UHFFFAOYSA-N beta-L-thymidine Natural products O=C1NC(=O)C(C)=CN1C1OC(CO)C(O)C1 IQFYYKKMVGJFEH-UHFFFAOYSA-N 0.000 description 1
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 1
- 229960002537 betamethasone Drugs 0.000 description 1
- UREBDLICKHMUKA-DVTGEIKXSA-N betamethasone Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@H](C)[C@@](C(=O)CO)(O)[C@@]1(C)C[C@@H]2O UREBDLICKHMUKA-DVTGEIKXSA-N 0.000 description 1
- 201000007180 bile duct carcinoma Diseases 0.000 description 1
- 201000009036 biliary tract cancer Diseases 0.000 description 1
- 208000020790 biliary tract neoplasm Diseases 0.000 description 1
- 229920000249 biocompatible polymer Polymers 0.000 description 1
- 230000004791 biological behavior Effects 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 229960000074 biopharmaceutical Drugs 0.000 description 1
- 229960002685 biotin Drugs 0.000 description 1
- 235000020958 biotin Nutrition 0.000 description 1
- 239000011616 biotin Substances 0.000 description 1
- 201000001531 bladder carcinoma Diseases 0.000 description 1
- 229960001561 bleomycin Drugs 0.000 description 1
- OYVAGSVQBOHSSS-UAPAGMARSA-O bleomycin A2 Chemical compound N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC=C(N=1)C=1SC=C(N=1)C(=O)NCCC[S+](C)C)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1N=CNC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C OYVAGSVQBOHSSS-UAPAGMARSA-O 0.000 description 1
- RSIHSRDYCUFFLA-DYKIIFRCSA-N boldenone Chemical compound O=C1C=C[C@]2(C)[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3CCC2=C1 RSIHSRDYCUFFLA-DYKIIFRCSA-N 0.000 description 1
- 210000000133 brain stem Anatomy 0.000 description 1
- 208000003362 bronchogenic carcinoma Diseases 0.000 description 1
- 229960004436 budesonide Drugs 0.000 description 1
- 239000007975 buffered saline Substances 0.000 description 1
- 229960002092 busulfan Drugs 0.000 description 1
- DQXBYHZEEUGOBF-UHFFFAOYSA-N but-3-enoic acid;ethene Chemical compound C=C.OC(=O)CC=C DQXBYHZEEUGOBF-UHFFFAOYSA-N 0.000 description 1
- 235000019282 butylated hydroxyanisole Nutrition 0.000 description 1
- 238000010804 cDNA synthesis Methods 0.000 description 1
- 125000002915 carbonyl group Chemical group [*:2]C([*:1])=O 0.000 description 1
- 229960005243 carmustine Drugs 0.000 description 1
- 239000005018 casein Substances 0.000 description 1
- BECPQYXYKAMYBN-UHFFFAOYSA-N casein, tech. Chemical compound NCCCCC(C(O)=O)N=C(O)C(CC(O)=O)N=C(O)C(CCC(O)=N)N=C(O)C(CC(C)C)N=C(O)C(CCC(O)=O)N=C(O)C(CC(O)=O)N=C(O)C(CCC(O)=O)N=C(O)C(C(C)O)N=C(O)C(CCC(O)=N)N=C(O)C(CCC(O)=N)N=C(O)C(CCC(O)=N)N=C(O)C(CCC(O)=O)N=C(O)C(CCC(O)=O)N=C(O)C(COP(O)(O)=O)N=C(O)C(CCC(O)=N)N=C(O)C(N)CC1=CC=CC=C1 BECPQYXYKAMYBN-UHFFFAOYSA-N 0.000 description 1
- 235000021240 caseins Nutrition 0.000 description 1
- 238000002507 cathodic stripping potentiometry Methods 0.000 description 1
- 239000013592 cell lysate Substances 0.000 description 1
- 229940121420 cemiplimab Drugs 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 239000002738 chelating agent Substances 0.000 description 1
- NDAYQJDHGXTBJL-MWWSRJDJSA-N chembl557217 Chemical compound C1=CC=C2C(C[C@H](NC(=O)[C@@H](CC(C)C)NC(=O)[C@H](CC=3C4=CC=CC=C4NC=3)NC(=O)[C@@H](CC(C)C)NC(=O)[C@H](CC=3C4=CC=CC=C4NC=3)NC(=O)[C@@H](CC(C)C)NC(=O)[C@H](CC=3C4=CC=CC=C4NC=3)NC(=O)[C@@H](C(C)C)NC(=O)[C@H](C(C)C)NC(=O)[C@@H](C(C)C)NC(=O)[C@H](C)NC(=O)[C@H](NC(=O)CNC(=O)[C@@H](NC=O)C(C)C)CC(C)C)C(=O)NCCO)=CNC2=C1 NDAYQJDHGXTBJL-MWWSRJDJSA-N 0.000 description 1
- 235000013330 chicken meat Nutrition 0.000 description 1
- 229960004630 chlorambucil Drugs 0.000 description 1
- JCKYGMPEJWAADB-UHFFFAOYSA-N chlorambucil Chemical compound OC(=O)CCCC1=CC=C(N(CCCl)CCCl)C=C1 JCKYGMPEJWAADB-UHFFFAOYSA-N 0.000 description 1
- 229960004926 chlorobutanol Drugs 0.000 description 1
- VDANGULDQQJODZ-UHFFFAOYSA-N chloroprocaine Chemical compound CCN(CC)CCOC(=O)C1=CC=C(N)C=C1Cl VDANGULDQQJODZ-UHFFFAOYSA-N 0.000 description 1
- 229960002023 chloroprocaine Drugs 0.000 description 1
- 235000012000 cholesterol Nutrition 0.000 description 1
- OEYIOHPDSNJKLS-UHFFFAOYSA-N choline Chemical compound C[N+](C)(C)CCO OEYIOHPDSNJKLS-UHFFFAOYSA-N 0.000 description 1
- 229960001231 choline Drugs 0.000 description 1
- 108091016312 choline binding proteins Proteins 0.000 description 1
- 230000001684 chronic effect Effects 0.000 description 1
- 208000024207 chronic leukemia Diseases 0.000 description 1
- 229960001265 ciclosporin Drugs 0.000 description 1
- 229960004316 cisplatin Drugs 0.000 description 1
- 238000003776 cleavage reaction Methods 0.000 description 1
- 229960002219 cloprednol Drugs 0.000 description 1
- YTJIBEDMAQUYSZ-FDNPDPBUSA-N cloprednol Chemical compound O=C1C=C[C@]2(C)[C@H]3[C@@H](O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3C=C(Cl)C2=C1 YTJIBEDMAQUYSZ-FDNPDPBUSA-N 0.000 description 1
- 229920001436 collagen Polymers 0.000 description 1
- 201000002660 colon sarcoma Diseases 0.000 description 1
- 229940047120 colony stimulating factors Drugs 0.000 description 1
- 201000010989 colorectal carcinoma Diseases 0.000 description 1
- 230000009137 competitive binding Effects 0.000 description 1
- 230000006957 competitive inhibition Effects 0.000 description 1
- 230000000295 complement effect Effects 0.000 description 1
- 230000004154 complement system Effects 0.000 description 1
- 238000013329 compounding Methods 0.000 description 1
- 238000005094 computer simulation Methods 0.000 description 1
- 201000010918 connective tissue cancer Diseases 0.000 description 1
- 108091036078 conserved sequence Proteins 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 239000000356 contaminant Substances 0.000 description 1
- 230000001276 controlling effect Effects 0.000 description 1
- 229960004544 cortisone Drugs 0.000 description 1
- 229960003840 cortivazol Drugs 0.000 description 1
- RKHQGWMMUURILY-UHRZLXHJSA-N cortivazol Chemical compound C([C@H]1[C@@H]2C[C@H]([C@]([C@@]2(C)C[C@H](O)[C@@H]1[C@@]1(C)C2)(O)C(=O)COC(C)=O)C)=C(C)C1=CC1=C2C=NN1C1=CC=CC=C1 RKHQGWMMUURILY-UHRZLXHJSA-N 0.000 description 1
- 239000007822 coupling agent Substances 0.000 description 1
- 238000004132 cross linking Methods 0.000 description 1
- 239000013078 crystal Substances 0.000 description 1
- 239000012228 culture supernatant Substances 0.000 description 1
- 229930182912 cyclosporin Natural products 0.000 description 1
- 208000002445 cystadenocarcinoma Diseases 0.000 description 1
- 229960002433 cysteine Drugs 0.000 description 1
- 235000018417 cysteine Nutrition 0.000 description 1
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 1
- 229960001305 cysteine hydrochloride Drugs 0.000 description 1
- 229960000684 cytarabine Drugs 0.000 description 1
- GBOGMAARMMDZGR-TYHYBEHESA-N cytochalasin B Chemical compound C([C@H]1[C@@H]2[C@@H](C([C@@H](O)[C@@H]3/C=C/C[C@H](C)CCC[C@@H](O)/C=C/C(=O)O[C@@]23C(=O)N1)=C)C)C1=CC=CC=C1 GBOGMAARMMDZGR-TYHYBEHESA-N 0.000 description 1
- GBOGMAARMMDZGR-JREHFAHYSA-N cytochalasin B Natural products C[C@H]1CCC[C@@H](O)C=CC(=O)O[C@@]23[C@H](C=CC1)[C@H](O)C(=C)[C@@H](C)[C@@H]2[C@H](Cc4ccccc4)NC3=O GBOGMAARMMDZGR-JREHFAHYSA-N 0.000 description 1
- 229940104302 cytosine Drugs 0.000 description 1
- 230000001086 cytosolic effect Effects 0.000 description 1
- 229940127089 cytotoxic agent Drugs 0.000 description 1
- 231100000599 cytotoxic agent Toxicity 0.000 description 1
- 231100000135 cytotoxicity Toxicity 0.000 description 1
- 230000003013 cytotoxicity Effects 0.000 description 1
- 239000002619 cytotoxin Substances 0.000 description 1
- 230000002950 deficient Effects 0.000 description 1
- RSIHSRDYCUFFLA-UHFFFAOYSA-N dehydrotestosterone Natural products O=C1C=CC2(C)C3CCC(C)(C(CC4)O)C4C3CCC2=C1 RSIHSRDYCUFFLA-UHFFFAOYSA-N 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 229960003662 desonide Drugs 0.000 description 1
- WBGKWQHBNHJJPZ-LECWWXJVSA-N desonide Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@@H]2[C@@H]1[C@@H]1C[C@H]3OC(C)(C)O[C@@]3(C(=O)CO)[C@@]1(C)C[C@@H]2O WBGKWQHBNHJJPZ-LECWWXJVSA-N 0.000 description 1
- 229960002593 desoximetasone Drugs 0.000 description 1
- VWVSBHGCDBMOOT-IIEHVVJPSA-N desoximetasone Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@@H](C)[C@H](C(=O)CO)[C@@]1(C)C[C@@H]2O VWVSBHGCDBMOOT-IIEHVVJPSA-N 0.000 description 1
- 229960003654 desoxycortone Drugs 0.000 description 1
- 229960003957 dexamethasone Drugs 0.000 description 1
- UREBDLICKHMUKA-CXSFZGCWSA-N dexamethasone Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@@H](C)[C@@](C(=O)CO)(O)[C@@]1(C)C[C@@H]2O UREBDLICKHMUKA-CXSFZGCWSA-N 0.000 description 1
- 150000001991 dicarboxylic acids Chemical class 0.000 description 1
- ZBCBWPMODOFKDW-UHFFFAOYSA-N diethanolamine Chemical compound OCCNCCO ZBCBWPMODOFKDW-UHFFFAOYSA-N 0.000 description 1
- 229940043237 diethanolamine Drugs 0.000 description 1
- UVYVLBIGDKGWPX-KUAJCENISA-N digitonin Chemical compound O([C@@H]1[C@@H]([C@]2(CC[C@@H]3[C@@]4(C)C[C@@H](O)[C@H](O[C@H]5[C@@H]([C@@H](O)[C@@H](O[C@H]6[C@@H]([C@@H](O[C@H]7[C@@H]([C@@H](O)[C@H](O)CO7)O)[C@H](O)[C@@H](CO)O6)O[C@H]6[C@@H]([C@@H](O[C@H]7[C@@H]([C@@H](O)[C@H](O)[C@@H](CO)O7)O)[C@@H](O)[C@@H](CO)O6)O)[C@@H](CO)O5)O)C[C@@H]4CC[C@H]3[C@@H]2[C@@H]1O)C)[C@@H]1C)[C@]11CC[C@@H](C)CO1 UVYVLBIGDKGWPX-KUAJCENISA-N 0.000 description 1
- UVYVLBIGDKGWPX-UHFFFAOYSA-N digitonine Natural products CC1C(C2(CCC3C4(C)CC(O)C(OC5C(C(O)C(OC6C(C(OC7C(C(O)C(O)CO7)O)C(O)C(CO)O6)OC6C(C(OC7C(C(O)C(O)C(CO)O7)O)C(O)C(CO)O6)O)C(CO)O5)O)CC4CCC3C2C2O)C)C2OC11CCC(C)CO1 UVYVLBIGDKGWPX-UHFFFAOYSA-N 0.000 description 1
- 206010013023 diphtheria Diseases 0.000 description 1
- 239000002270 dispersing agent Substances 0.000 description 1
- 238000009826 distribution Methods 0.000 description 1
- PRAKJMSDJKAYCZ-UHFFFAOYSA-N dodecahydrosqualene Natural products CC(C)CCCC(C)CCCC(C)CCCCC(C)CCCC(C)CCCC(C)C PRAKJMSDJKAYCZ-UHFFFAOYSA-N 0.000 description 1
- 235000013601 eggs Nutrition 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- AUVVAXYIELKVAI-CKBKHPSWSA-N emetine Chemical compound N1CCC2=CC(OC)=C(OC)C=C2[C@H]1C[C@H]1C[C@H]2C3=CC(OC)=C(OC)C=C3CCN2C[C@@H]1CC AUVVAXYIELKVAI-CKBKHPSWSA-N 0.000 description 1
- 229960002694 emetine Drugs 0.000 description 1
- AUVVAXYIELKVAI-UWBTVBNJSA-N emetine Natural products N1CCC2=CC(OC)=C(OC)C=C2[C@H]1C[C@H]1C[C@H]2C3=CC(OC)=C(OC)C=C3CCN2C[C@H]1CC AUVVAXYIELKVAI-UWBTVBNJSA-N 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 239000000839 emulsion Substances 0.000 description 1
- 239000003623 enhancer Substances 0.000 description 1
- 230000000369 enteropathogenic effect Effects 0.000 description 1
- 231100000249 enterotoxic Toxicity 0.000 description 1
- 230000002242 enterotoxic effect Effects 0.000 description 1
- 239000000147 enterotoxin Substances 0.000 description 1
- 231100000655 enterotoxin Toxicity 0.000 description 1
- 230000007613 environmental effect Effects 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 108010087914 epidermal growth factor receptor VIII Proteins 0.000 description 1
- 208000037828 epithelial carcinoma Diseases 0.000 description 1
- 229940011399 escin Drugs 0.000 description 1
- 229930186222 escin Natural products 0.000 description 1
- 201000004101 esophageal cancer Diseases 0.000 description 1
- 201000005619 esophageal carcinoma Diseases 0.000 description 1
- 150000002148 esters Chemical class 0.000 description 1
- 229960000403 etanercept Drugs 0.000 description 1
- ZINJLDJMHCUBIP-UHFFFAOYSA-N ethametsulfuron-methyl Chemical compound CCOC1=NC(NC)=NC(NC(=O)NS(=O)(=O)C=2C(=CC=CC=2)C(=O)OC)=N1 ZINJLDJMHCUBIP-UHFFFAOYSA-N 0.000 description 1
- BEFDCLMNVWHSGT-UHFFFAOYSA-N ethenylcyclopentane Chemical compound C=CC1CCCC1 BEFDCLMNVWHSGT-UHFFFAOYSA-N 0.000 description 1
- ZMMJGEGLRURXTF-UHFFFAOYSA-N ethidium bromide Chemical compound [Br-].C12=CC(N)=CC=C2C2=CC=C(N)C=C2[N+](CC)=C1C1=CC=CC=C1 ZMMJGEGLRURXTF-UHFFFAOYSA-N 0.000 description 1
- 229960005542 ethidium bromide Drugs 0.000 description 1
- LVGKNOAMLMIIKO-QXMHVHEDSA-N ethyl oleate Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OCC LVGKNOAMLMIIKO-QXMHVHEDSA-N 0.000 description 1
- 229940093471 ethyl oleate Drugs 0.000 description 1
- 239000005038 ethylene vinyl acetate Substances 0.000 description 1
- 229940012017 ethylenediamine Drugs 0.000 description 1
- VJJPUSNTGOMMGY-MRVIYFEKSA-N etoposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@H](C)OC[C@H]4O3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 VJJPUSNTGOMMGY-MRVIYFEKSA-N 0.000 description 1
- 229960005420 etoposide Drugs 0.000 description 1
- 210000003527 eukaryotic cell Anatomy 0.000 description 1
- 230000029142 excretion Effects 0.000 description 1
- 238000010195 expression analysis Methods 0.000 description 1
- 239000013613 expression plasmid Substances 0.000 description 1
- 208000024519 eye neoplasm Diseases 0.000 description 1
- 230000001605 fetal effect Effects 0.000 description 1
- 238000000684 flow cytometry Methods 0.000 description 1
- 108700014844 flt3 ligand Proteins 0.000 description 1
- 229960001440 fluclorolone Drugs 0.000 description 1
- VTWKPILBIUBMDS-OTJLYDAYSA-N fluclorolone Chemical compound O=C1C=C[C@]2(C)[C@@]3(Cl)[C@@H](Cl)C[C@](C)([C@@]([C@H](O)C4)(O)C(=O)CO)[C@@H]4[C@@H]3C[C@H](F)C2=C1 VTWKPILBIUBMDS-OTJLYDAYSA-N 0.000 description 1
- AAXVEMMRQDVLJB-BULBTXNYSA-N fludrocortisone Chemical compound O=C1CC[C@]2(C)[C@@]3(F)[C@@H](O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 AAXVEMMRQDVLJB-BULBTXNYSA-N 0.000 description 1
- 229960004511 fludroxycortide Drugs 0.000 description 1
- 229960003469 flumetasone Drugs 0.000 description 1
- WXURHACBFYSXBI-GQKYHHCASA-N flumethasone Chemical compound C1([C@@H](F)C2)=CC(=O)C=C[C@]1(C)[C@]1(F)[C@@H]2[C@@H]2C[C@@H](C)[C@@](C(=O)CO)(O)[C@@]2(C)C[C@@H]1O WXURHACBFYSXBI-GQKYHHCASA-N 0.000 description 1
- 229960000676 flunisolide Drugs 0.000 description 1
- 229940043075 fluocinolone Drugs 0.000 description 1
- 229960000785 fluocinonide Drugs 0.000 description 1
- 229950008509 fluocortin butyl Drugs 0.000 description 1
- XWTIDFOGTCVGQB-FHIVUSPVSA-N fluocortin butyl Chemical group C1([C@@H](F)C2)=CC(=O)C=C[C@]1(C)[C@@H]1[C@@H]2[C@@H]2C[C@@H](C)[C@H](C(=O)C(=O)OCCCC)[C@@]2(C)C[C@@H]1O XWTIDFOGTCVGQB-FHIVUSPVSA-N 0.000 description 1
- GAKMQHDJQHZUTJ-ULHLPKEOSA-N fluocortolone Chemical compound C1([C@@H](F)C2)=CC(=O)C=C[C@]1(C)[C@@H]1[C@@H]2[C@@H]2C[C@@H](C)[C@H](C(=O)CO)[C@@]2(C)C[C@@H]1O GAKMQHDJQHZUTJ-ULHLPKEOSA-N 0.000 description 1
- 229960001048 fluorometholone Drugs 0.000 description 1
- FAOZLTXFLGPHNG-KNAQIMQKSA-N fluorometholone Chemical compound C([C@@]12C)=CC(=O)C=C1[C@@H](C)C[C@@H]1[C@]2(F)[C@@H](O)C[C@]2(C)[C@@](O)(C(C)=O)CC[C@H]21 FAOZLTXFLGPHNG-KNAQIMQKSA-N 0.000 description 1
- 229960002949 fluorouracil Drugs 0.000 description 1
- 229960002714 fluticasone Drugs 0.000 description 1
- MGNNYOODZCAHBA-GQKYHHCASA-N fluticasone Chemical compound C1([C@@H](F)C2)=CC(=O)C=C[C@]1(C)[C@]1(F)[C@@H]2[C@@H]2C[C@@H](C)[C@@](C(=O)SCF)(O)[C@@]2(C)C[C@@H]1O MGNNYOODZCAHBA-GQKYHHCASA-N 0.000 description 1
- 239000006260 foam Substances 0.000 description 1
- 229940014144 folate Drugs 0.000 description 1
- OVBPIULPVIDEAO-LBPRGKRZSA-N folic acid Chemical compound C=1N=C2NC(N)=NC(=O)C2=NC=1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 OVBPIULPVIDEAO-LBPRGKRZSA-N 0.000 description 1
- 235000019152 folic acid Nutrition 0.000 description 1
- 239000011724 folic acid Substances 0.000 description 1
- 238000004108 freeze drying Methods 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 239000003862 glucocorticoid Substances 0.000 description 1
- 235000013922 glutamic acid Nutrition 0.000 description 1
- 239000004220 glutamic acid Substances 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- 229940093915 gynecological organic acid Drugs 0.000 description 1
- 229960002383 halcinonide Drugs 0.000 description 1
- 201000010536 head and neck cancer Diseases 0.000 description 1
- 208000014829 head and neck neoplasm Diseases 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 208000025750 heavy chain disease Diseases 0.000 description 1
- 239000000185 hemagglutinin Substances 0.000 description 1
- 201000002222 hemangioblastoma Diseases 0.000 description 1
- 208000002672 hepatitis B Diseases 0.000 description 1
- 206010073071 hepatocellular carcinoma Diseases 0.000 description 1
- 239000000833 heterodimer Substances 0.000 description 1
- 210000003630 histaminocyte Anatomy 0.000 description 1
- 102000043726 human CCL3 Human genes 0.000 description 1
- 102000057041 human TNF Human genes 0.000 description 1
- 201000009163 human granulocytic anaplasmosis Diseases 0.000 description 1
- 208000022340 human granulocytic ehrlichiosis Diseases 0.000 description 1
- 238000009396 hybridization Methods 0.000 description 1
- BHEPBYXIRTUNPN-UHFFFAOYSA-N hydridophosphorus(.) (triplet) Chemical compound [PH] BHEPBYXIRTUNPN-UHFFFAOYSA-N 0.000 description 1
- 229960000890 hydrocortisone Drugs 0.000 description 1
- 150000002433 hydrophilic molecules Chemical class 0.000 description 1
- 125000004356 hydroxy functional group Chemical group O* 0.000 description 1
- 230000036039 immunity Effects 0.000 description 1
- 230000003053 immunization Effects 0.000 description 1
- 238000003119 immunoblot Methods 0.000 description 1
- 230000002163 immunogen Effects 0.000 description 1
- 238000001114 immunoprecipitation Methods 0.000 description 1
- 238000005462 in vivo assay Methods 0.000 description 1
- 238000011065 in-situ storage Methods 0.000 description 1
- 230000002779 inactivation Effects 0.000 description 1
- 108020004201 indoleamine 2,3-dioxygenase Proteins 0.000 description 1
- 102000006639 indoleamine 2,3-dioxygenase Human genes 0.000 description 1
- 239000003701 inert diluent Substances 0.000 description 1
- 230000028709 inflammatory response Effects 0.000 description 1
- 229960000598 infliximab Drugs 0.000 description 1
- 206010022000 influenza Diseases 0.000 description 1
- 229960003786 inosine Drugs 0.000 description 1
- 229940079322 interferon Drugs 0.000 description 1
- 229960003130 interferon gamma Drugs 0.000 description 1
- 238000001361 intraarterial administration Methods 0.000 description 1
- 208000020082 intraepithelial neoplasia Diseases 0.000 description 1
- 238000007913 intrathecal administration Methods 0.000 description 1
- 238000010253 intravenous injection Methods 0.000 description 1
- 238000011835 investigation Methods 0.000 description 1
- 229910052742 iron Inorganic materials 0.000 description 1
- 201000010982 kidney cancer Diseases 0.000 description 1
- 206010023841 laryngeal neoplasm Diseases 0.000 description 1
- 201000004962 larynx cancer Diseases 0.000 description 1
- 210000000265 leukocyte Anatomy 0.000 description 1
- 229960003734 levamisole hydrochloride Drugs 0.000 description 1
- 229960004194 lidocaine Drugs 0.000 description 1
- 210000000088 lip Anatomy 0.000 description 1
- GZQKNULLWNGMCW-PWQABINMSA-N lipid A (E. coli) Chemical compound O1[C@H](CO)[C@@H](OP(O)(O)=O)[C@H](OC(=O)C[C@@H](CCCCCCCCCCC)OC(=O)CCCCCCCCCCCCC)[C@@H](NC(=O)C[C@@H](CCCCCCCCCCC)OC(=O)CCCCCCCCCCC)[C@@H]1OC[C@@H]1[C@@H](O)[C@H](OC(=O)C[C@H](O)CCCCCCCCCCC)[C@@H](NC(=O)C[C@H](O)CCCCCCCCCCC)[C@@H](OP(O)(O)=O)O1 GZQKNULLWNGMCW-PWQABINMSA-N 0.000 description 1
- 206010024627 liposarcoma Diseases 0.000 description 1
- 201000007270 liver cancer Diseases 0.000 description 1
- 208000014018 liver neoplasm Diseases 0.000 description 1
- 229960002247 lomustine Drugs 0.000 description 1
- 230000007774 longterm Effects 0.000 description 1
- 239000006210 lotion Substances 0.000 description 1
- 201000005296 lung carcinoma Diseases 0.000 description 1
- 208000037829 lymphangioendotheliosarcoma Diseases 0.000 description 1
- 208000012804 lymphangiosarcoma Diseases 0.000 description 1
- 101710130522 mRNA export factor Proteins 0.000 description 1
- 229910052749 magnesium Inorganic materials 0.000 description 1
- 239000011777 magnesium Substances 0.000 description 1
- 150000008146 mannosides Chemical class 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- 229960004961 mechlorethamine Drugs 0.000 description 1
- HAWPXGHAZFHHAD-UHFFFAOYSA-N mechlorethamine Chemical compound ClCCN(C)CCCl HAWPXGHAZFHHAD-UHFFFAOYSA-N 0.000 description 1
- 239000012577 media supplement Substances 0.000 description 1
- 208000023356 medullary thyroid gland carcinoma Diseases 0.000 description 1
- SGDBTWWWUNNDEQ-LBPRGKRZSA-N melphalan Chemical compound OC(=O)[C@@H](N)CC1=CC=C(N(CCCl)CCCl)C=C1 SGDBTWWWUNNDEQ-LBPRGKRZSA-N 0.000 description 1
- 229960001924 melphalan Drugs 0.000 description 1
- 229960001810 meprednisone Drugs 0.000 description 1
- PIDANAQULIKBQS-RNUIGHNZSA-N meprednisone Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@@H]2[C@@H]1[C@@H]1C[C@H](C)[C@@](C(=O)CO)(O)[C@@]1(C)CC2=O PIDANAQULIKBQS-RNUIGHNZSA-N 0.000 description 1
- 229960001428 mercaptopurine Drugs 0.000 description 1
- 229910052751 metal Inorganic materials 0.000 description 1
- 239000002184 metal Substances 0.000 description 1
- 229930182817 methionine Natural products 0.000 description 1
- 229960000485 methotrexate Drugs 0.000 description 1
- 229960004584 methylprednisolone Drugs 0.000 description 1
- 239000004530 micro-emulsion Substances 0.000 description 1
- 238000001471 micro-filtration Methods 0.000 description 1
- 230000000813 microbial effect Effects 0.000 description 1
- 239000004005 microsphere Substances 0.000 description 1
- 150000007522 mineralic acids Chemical class 0.000 description 1
- 229960005485 mitobronitol Drugs 0.000 description 1
- 229960001156 mitoxantrone Drugs 0.000 description 1
- KKZJGLLVHKMTCM-UHFFFAOYSA-N mitoxantrone Chemical compound O=C1C2=C(O)C=CC(O)=C2C(=O)C2=C1C(NCCNCCO)=CC=C2NCCNCCO KKZJGLLVHKMTCM-UHFFFAOYSA-N 0.000 description 1
- 238000007799 mixed lymphocyte reaction assay Methods 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 210000000214 mouth Anatomy 0.000 description 1
- 210000005012 myelin Anatomy 0.000 description 1
- 210000001167 myeloblast Anatomy 0.000 description 1
- 210000003643 myeloid progenitor cell Anatomy 0.000 description 1
- 210000004985 myeloid-derived suppressor cell Anatomy 0.000 description 1
- 208000001611 myxosarcoma Diseases 0.000 description 1
- OHDXDNUPVVYWOV-UHFFFAOYSA-N n-methyl-1-(2-naphthalen-1-ylsulfanylphenyl)methanamine Chemical compound CNCC1=CC=CC=C1SC1=CC=CC2=CC=CC=C12 OHDXDNUPVVYWOV-UHFFFAOYSA-N 0.000 description 1
- 201000011216 nasopharynx carcinoma Diseases 0.000 description 1
- 210000000581 natural killer T-cell Anatomy 0.000 description 1
- 210000000822 natural killer cell Anatomy 0.000 description 1
- 230000017066 negative regulation of growth Effects 0.000 description 1
- 208000025189 neoplasm of testis Diseases 0.000 description 1
- 208000002154 non-small cell lung carcinoma Diseases 0.000 description 1
- 230000005257 nucleotidylation Effects 0.000 description 1
- 201000008106 ocular cancer Diseases 0.000 description 1
- 239000002674 ointment Substances 0.000 description 1
- 235000008390 olive oil Nutrition 0.000 description 1
- 239000004006 olive oil Substances 0.000 description 1
- 201000005443 oral cavity cancer Diseases 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 150000007524 organic acids Chemical class 0.000 description 1
- 235000005985 organic acids Nutrition 0.000 description 1
- 150000002895 organic esters Chemical class 0.000 description 1
- 229960001592 paclitaxel Drugs 0.000 description 1
- 208000004019 papillary adenocarcinoma Diseases 0.000 description 1
- 201000010198 papillary carcinoma Diseases 0.000 description 1
- 229960002858 paramethasone Drugs 0.000 description 1
- 230000003071 parasitic effect Effects 0.000 description 1
- 230000036961 partial effect Effects 0.000 description 1
- 230000008506 pathogenesis Effects 0.000 description 1
- 239000008188 pellet Substances 0.000 description 1
- 210000003200 peritoneal cavity Anatomy 0.000 description 1
- 108010021711 pertactin Proteins 0.000 description 1
- 238000002823 phage display Methods 0.000 description 1
- 230000008782 phagocytosis Effects 0.000 description 1
- 210000003800 pharynx Anatomy 0.000 description 1
- 208000024724 pineal body neoplasm Diseases 0.000 description 1
- 201000004123 pineal gland cancer Diseases 0.000 description 1
- 230000003169 placental effect Effects 0.000 description 1
- 201000000317 pneumocystosis Diseases 0.000 description 1
- 229920001200 poly(ethylene-vinyl acetate) Polymers 0.000 description 1
- 229920000747 poly(lactic acid) Polymers 0.000 description 1
- 229920002627 poly(phosphazenes) Polymers 0.000 description 1
- 230000008488 polyadenylation Effects 0.000 description 1
- 208000037244 polycythemia vera Diseases 0.000 description 1
- 239000004633 polyglycolic acid Substances 0.000 description 1
- 229940115272 polyinosinic:polycytidylic acid Drugs 0.000 description 1
- 239000004626 polylactic acid Substances 0.000 description 1
- 229940051841 polyoxyethylene ether Drugs 0.000 description 1
- 229920000056 polyoxyethylene ether Polymers 0.000 description 1
- 239000000244 polyoxyethylene sorbitan monooleate Substances 0.000 description 1
- 235000010482 polyoxyethylene sorbitan monooleate Nutrition 0.000 description 1
- 229920000053 polysorbate 80 Polymers 0.000 description 1
- 229940068968 polysorbate 80 Drugs 0.000 description 1
- 239000011591 potassium Substances 0.000 description 1
- 229910052700 potassium Inorganic materials 0.000 description 1
- 229960005205 prednisolone Drugs 0.000 description 1
- OIGNJSKKLXVSLS-VWUMJDOOSA-N prednisolone Chemical compound O=C1C=C[C@]2(C)[C@H]3[C@@H](O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 OIGNJSKKLXVSLS-VWUMJDOOSA-N 0.000 description 1
- 229960004618 prednisone Drugs 0.000 description 1
- XOFYZVNMUHMLCC-ZPOLXVRWSA-N prednisone Chemical compound O=C1C=C[C@]2(C)[C@H]3C(=O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 XOFYZVNMUHMLCC-ZPOLXVRWSA-N 0.000 description 1
- 210000004765 promyelocyte Anatomy 0.000 description 1
- 239000003380 propellant Substances 0.000 description 1
- 230000000069 prophylactic effect Effects 0.000 description 1
- 229960003712 propranolol Drugs 0.000 description 1
- 239000000473 propyl gallate Substances 0.000 description 1
- 235000010388 propyl gallate Nutrition 0.000 description 1
- 229940075579 propyl gallate Drugs 0.000 description 1
- 230000001681 protective effect Effects 0.000 description 1
- 238000001742 protein purification Methods 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 229950010131 puromycin Drugs 0.000 description 1
- MIXMJCQRHVAJIO-TZHJZOAOSA-N qk4dys664x Chemical compound O.C1([C@@H](F)C2)=CC(=O)C=C[C@]1(C)[C@@H]1[C@@H]2[C@@H]2C[C@H]3OC(C)(C)O[C@@]3(C(=O)CO)[C@@]2(C)C[C@@H]1O.C1([C@@H](F)C2)=CC(=O)C=C[C@]1(C)[C@@H]1[C@@H]2[C@@H]2C[C@H]3OC(C)(C)O[C@@]3(C(=O)CO)[C@@]2(C)C[C@@H]1O MIXMJCQRHVAJIO-TZHJZOAOSA-N 0.000 description 1
- ZADWXFSZEAPBJS-UHFFFAOYSA-N racemic N-methyl tryptophan Natural products C1=CC=C2N(C)C=C(CC(N)C(O)=O)C2=C1 ZADWXFSZEAPBJS-UHFFFAOYSA-N 0.000 description 1
- 238000001959 radiotherapy Methods 0.000 description 1
- 238000002708 random mutagenesis Methods 0.000 description 1
- ZAHRKKWIAAJSAO-UHFFFAOYSA-N rapamycin Natural products COCC(O)C(=C/C(C)C(=O)CC(OC(=O)C1CCCCN1C(=O)C(=O)C2(O)OC(CC(OC)C(=CC=CC=CC(C)CC(C)C(=O)C)C)CCC2C)C(C)CC3CCC(O)C(C3)OC)C ZAHRKKWIAAJSAO-UHFFFAOYSA-N 0.000 description 1
- 238000003753 real-time PCR Methods 0.000 description 1
- 238000010188 recombinant method Methods 0.000 description 1
- 230000006798 recombination Effects 0.000 description 1
- 238000005215 recombination Methods 0.000 description 1
- 230000007115 recruitment Effects 0.000 description 1
- 206010038038 rectal cancer Diseases 0.000 description 1
- 201000001275 rectum cancer Diseases 0.000 description 1
- 230000002829 reductive effect Effects 0.000 description 1
- 210000003289 regulatory T cell Anatomy 0.000 description 1
- 230000001105 regulatory effect Effects 0.000 description 1
- 210000002345 respiratory system Anatomy 0.000 description 1
- 230000000717 retained effect Effects 0.000 description 1
- 230000007017 scission Effects 0.000 description 1
- 238000012216 screening Methods 0.000 description 1
- 201000008407 sebaceous adenocarcinoma Diseases 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 229960002930 sirolimus Drugs 0.000 description 1
- QFJCIRLUMZQUOT-HPLJOQBZSA-N sirolimus Chemical compound C1C[C@@H](O)[C@H](OC)C[C@@H]1C[C@@H](C)[C@H]1OC(=O)[C@@H]2CCCCN2C(=O)C(=O)[C@](O)(O2)[C@H](C)CC[C@H]2C[C@H](OC)/C(C)=C/C=C/C=C/[C@@H](C)C[C@@H](C)C(=O)[C@H](OC)[C@H](O)/C(C)=C/[C@@H](C)C(=O)C1 QFJCIRLUMZQUOT-HPLJOQBZSA-N 0.000 description 1
- 210000003491 skin Anatomy 0.000 description 1
- 201000000849 skin cancer Diseases 0.000 description 1
- 208000000587 small cell lung carcinoma Diseases 0.000 description 1
- 229940126586 small molecule drug Drugs 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- 229910052708 sodium Inorganic materials 0.000 description 1
- WBHQBSYUUJJSRZ-UHFFFAOYSA-M sodium bisulfate Chemical compound [Na+].OS([O-])(=O)=O WBHQBSYUUJJSRZ-UHFFFAOYSA-M 0.000 description 1
- 229910000342 sodium bisulfate Inorganic materials 0.000 description 1
- 229940100996 sodium bisulfate Drugs 0.000 description 1
- HRZFUMHJMZEROT-UHFFFAOYSA-L sodium disulfite Chemical compound [Na+].[Na+].[O-]S(=O)S([O-])(=O)=O HRZFUMHJMZEROT-UHFFFAOYSA-L 0.000 description 1
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 1
- 229940001584 sodium metabisulfite Drugs 0.000 description 1
- 235000010262 sodium metabisulphite Nutrition 0.000 description 1
- 229940001482 sodium sulfite Drugs 0.000 description 1
- 235000010265 sodium sulphite Nutrition 0.000 description 1
- 235000010199 sorbic acid Nutrition 0.000 description 1
- 239000004334 sorbic acid Substances 0.000 description 1
- 229940075582 sorbic acid Drugs 0.000 description 1
- 238000011895 specific detection Methods 0.000 description 1
- 210000000952 spleen Anatomy 0.000 description 1
- 210000004989 spleen cell Anatomy 0.000 description 1
- 210000004988 splenocyte Anatomy 0.000 description 1
- 229940031439 squalene Drugs 0.000 description 1
- TUHBEKDERLKLEC-UHFFFAOYSA-N squalene Natural products CC(=CCCC(=CCCC(=CCCC=C(/C)CCC=C(/C)CC=C(C)C)C)C)C TUHBEKDERLKLEC-UHFFFAOYSA-N 0.000 description 1
- 206010041823 squamous cell carcinoma Diseases 0.000 description 1
- 230000001954 sterilising effect Effects 0.000 description 1
- 238000004659 sterilization and disinfection Methods 0.000 description 1
- 238000012414 sterilization procedure Methods 0.000 description 1
- 229960001052 streptozocin Drugs 0.000 description 1
- ZSJLQEPLLKMAKR-GKHCUFPYSA-N streptozocin Chemical compound O=NN(C)C(=O)N[C@H]1[C@@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O ZSJLQEPLLKMAKR-GKHCUFPYSA-N 0.000 description 1
- 229940031626 subunit vaccine Drugs 0.000 description 1
- 239000013589 supplement Substances 0.000 description 1
- 108010033090 surfactant protein A receptor Proteins 0.000 description 1
- 230000004083 survival effect Effects 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 230000002459 sustained effect Effects 0.000 description 1
- 238000013268 sustained release Methods 0.000 description 1
- 201000010965 sweat gland carcinoma Diseases 0.000 description 1
- 230000002195 synergetic effect Effects 0.000 description 1
- 206010042863 synovial sarcoma Diseases 0.000 description 1
- 208000006379 syphilis Diseases 0.000 description 1
- 229940037128 systemic glucocorticoids Drugs 0.000 description 1
- QJJXYPPXXYFBGM-SHYZHZOCSA-N tacrolimus Natural products CO[C@H]1C[C@H](CC[C@@H]1O)C=C(C)[C@H]2OC(=O)[C@H]3CCCCN3C(=O)C(=O)[C@@]4(O)O[C@@H]([C@H](C[C@H]4C)OC)[C@@H](C[C@H](C)CC(=C[C@@H](CC=C)C(=O)C[C@H](O)[C@H]2C)C)OC QJJXYPPXXYFBGM-SHYZHZOCSA-N 0.000 description 1
- 239000011975 tartaric acid Substances 0.000 description 1
- 235000002906 tartaric acid Nutrition 0.000 description 1
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 description 1
- 229940066453 tecentriq Drugs 0.000 description 1
- 229960004964 temozolomide Drugs 0.000 description 1
- NRUKOCRGYNPUPR-QBPJDGROSA-N teniposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@@H](OC[C@H]4O3)C=3SC=CC=3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 NRUKOCRGYNPUPR-QBPJDGROSA-N 0.000 description 1
- 229960001278 teniposide Drugs 0.000 description 1
- 229940118376 tetanus toxin Drugs 0.000 description 1
- 229960002372 tetracaine Drugs 0.000 description 1
- GKCBAIGFKIBETG-UHFFFAOYSA-N tetracaine Chemical compound CCCCNC1=CC=C(C(=O)OCCN(C)C)C=C1 GKCBAIGFKIBETG-UHFFFAOYSA-N 0.000 description 1
- ZRKFYGHZFMAOKI-QMGMOQQFSA-N tgfbeta Chemical compound C([C@H](NC(=O)[C@H](C(C)C)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CCSC)C(C)C)[C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O)C1=CC=C(O)C=C1 ZRKFYGHZFMAOKI-QMGMOQQFSA-N 0.000 description 1
- 229940104230 thymidine Drugs 0.000 description 1
- 201000002510 thyroid cancer Diseases 0.000 description 1
- 229960003087 tioguanine Drugs 0.000 description 1
- 229960004631 tixocortol Drugs 0.000 description 1
- BISFDZNIUZIKJD-XDANTLIUSA-N tixocortol pivalate Chemical compound C1CC2=CC(=O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@@](C(=O)CSC(=O)C(C)(C)C)(O)[C@@]1(C)C[C@@H]2O BISFDZNIUZIKJD-XDANTLIUSA-N 0.000 description 1
- 229940044616 toll-like receptor 7 agonist Drugs 0.000 description 1
- 210000002105 tongue Anatomy 0.000 description 1
- 238000011200 topical administration Methods 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 230000002110 toxicologic effect Effects 0.000 description 1
- 231100000759 toxicological effect Toxicity 0.000 description 1
- 230000005030 transcription termination Effects 0.000 description 1
- 238000003151 transfection method Methods 0.000 description 1
- 238000011830 transgenic mouse model Methods 0.000 description 1
- 230000014616 translation Effects 0.000 description 1
- 230000014621 translational initiation Effects 0.000 description 1
- 229960005294 triamcinolone Drugs 0.000 description 1
- GFNANZIMVAIWHM-OBYCQNJPSA-N triamcinolone Chemical compound O=C1C=C[C@]2(C)[C@@]3(F)[C@@H](O)C[C@](C)([C@@]([C@H](O)C4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 GFNANZIMVAIWHM-OBYCQNJPSA-N 0.000 description 1
- 229950009795 tucaresol Drugs 0.000 description 1
- 239000002451 tumor necrosis factor inhibitor Substances 0.000 description 1
- 150000003668 tyrosines Chemical class 0.000 description 1
- 241000701161 unidentified adenovirus Species 0.000 description 1
- 241001529453 unidentified herpesvirus Species 0.000 description 1
- 241001430294 unidentified retrovirus Species 0.000 description 1
- 208000010570 urinary bladder carcinoma Diseases 0.000 description 1
- 230000002485 urinary effect Effects 0.000 description 1
- 238000002255 vaccination Methods 0.000 description 1
- 230000002477 vacuolizing effect Effects 0.000 description 1
- 238000001291 vacuum drying Methods 0.000 description 1
- 238000009777 vacuum freeze-drying Methods 0.000 description 1
- 235000015112 vegetable and seed oil Nutrition 0.000 description 1
- 239000008158 vegetable oil Substances 0.000 description 1
- 239000003981 vehicle Substances 0.000 description 1
- 210000003501 vero cell Anatomy 0.000 description 1
- 239000000277 virosome Substances 0.000 description 1
- 230000003442 weekly effect Effects 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
- 238000002424 x-ray crystallography Methods 0.000 description 1
- 210000005253 yeast cell Anatomy 0.000 description 1
- 229940051021 yellow-fever virus Drugs 0.000 description 1
- 229910052727 yttrium Inorganic materials 0.000 description 1
- 229910052725 zinc Chemical class 0.000 description 1
- 239000011701 zinc Chemical class 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2827—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against B7 molecules, e.g. CD80, CD86
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/35—Valency
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
Definitions
- the inhibitory immune checkpoint receptor “immunoglobulin-like transcript 4”
- ILT4 is a member of the non-catalytic tyrosine-phosphorylated receptor family which is expressed on immune cells (such as T cells, B cells, NK cells, dendritic cells, macrophages and mast cells). Like other receptors in this family, ILT4 contains a conserved sequence of amino acids in the cytoplasmic domain referred to as an immunoreceptor tyrosine-based inhibitory motif (ITIM). (Veillette et al. (2002) Annual Review of Immunology 20(1):669- 707). Binding and activation of ILT4 by its cognate ligands (HLA-G and HLA Class I in myeloid cells) has immunosuppressive effects through multiple mechanisms.
- ITIM immunoreceptor tyrosine-based inhibitory motif
- ILT4 is also found in tumor cells and stroma cells in the tumor microenvironment of various cancers and has been shown to modulate the biological behaviors of tumor cells, thus promoting their immune escape. (Gao et al. (2016) Biochimica et Biophysica Acta (BBA) - Reviews on Cancer 1869(2):278-285). Accordingly, the expression of ILT4 in several tumor types is associated with poor outcome.
- Programmed death-ligand 1 is a 40kDa type 1 transmembrane protein associated with suppressing the immune system during particular events such as pregnancy, tissue allografts, autoimmune disease, and other disease states such as hepatitis. Normally the immune system reacts to foreign antigens that are associated with exogenous or endogenous danger signals, which triggers a proliferation of antigen- specific CD8+ T cells and/or CD4+ helper cells. Binding of PD-L1 to the receptor, Programmed cell death protein 1 (PD-1), transmits an inhibitory signal that reduces the proliferation of these T cells and can also induce apoptosis, which is further mediated by a lower regulation of the gene Bcl-2.
- PD-1 Programmed cell death protein 1
- PD-L1 is abundant in a variety of human cancers (Dong et al. (2002) Nat. Med. 8:787-9). The interaction between PD-1 and PD-L1 results in a decrease in tumor infiltrating lymphocytes, a decrease in T-cell receptor mediated proliferation, and immune evasion by the cancerous cells (Dong et al. (2003) J. Mol. Med.81:281-7; Blank et al. (2005) Cancer Immunol. Immunother.
- novel antibodies which bind to human ILT4, and antigen binding fragments thereof (e.g., fragments such as an Fab, Fab', F(ab') 2 , Fv, or a single chain Fv).
- Bispecific and multispecific constructs comprising such antibodies (or fragments) linked to at least one additional binding agent (e.g., a ligand, receptor/trap sequences, or an antibody or antigen binding fragment thereof) also are described, e.g., an additional antibody (or fragment) which binds to human PD-L1 and/or human PD-1.
- the ILT4 antibodies (and fragments) and constructs of the present invention can be used in methods of inducing or enhancing an immune response and methods of treating a disease or condition (e.g., cancer).
- the ILT4 antibody or antigen binding fragment thereof comprises heavy and light chain CDR1, CDR2 and CDR3 domains having the following sequences: (i) a heavy chain variable region CDR1 amino acid sequence selected from the consensus sequence: G Y T (I,M) H (SEQ ID NO: 21), or conservative sequence modifications thereof; (ii) a heavy chain variable region CDR2 amino acid sequence as set forth in SEQ ID NO:3, or conservative sequence modifications thereof; (iii) a heavy chain variable region CDR3 amino acid sequence selected from the consensus sequence: E R P G G S Q F I Y Y Y (P,A) (M,L) D Y (SEQ ID NO:22) , or conservative sequence modifications thereof; (iv) a light chain variable region CDR1 amino acid sequence selected from the consensus sequence: G Y
- an exemplary ILT4 antibody is antibody 7A3 as described herein.
- the ILT4 antibody or antigen binding fragment thereof comprises the heavy and light chain CDRs or variable regions of antibody 7A3.
- the antibody or antigen binding fragment thereof comprises the CDR1, CDR2, and CDR3 domains of the heavy chain variable region of antibody 7A3 having the sequence set forth in SEQ ID NO:9, and the CDR1, CDR2 and CDR3 domains of the light chain variable region of antibody 7A3 having the sequence set forth in SEQ ID NO:10.
- the antibody or antigen binding thereof comprises heavy chain CDR1, CDR2 and CDR3 domains having the sequences set forth in SEQ ID NOs:1, 3, and 5, respectively, or conservative sequence modifications thereof, and light chain CDR1, CDR2 and CDR3 domains having the sequences set forth in SEQ ID NOs:6, 7 and 8, respectively, or conservative sequence modifications thereof.
- the antibody or antigen binding thereof comprises a heavy chain variable region having the amino acid sequence set forth in SEQ ID NO:9.
- the antibody or antigen binding thereof comprises a light chain variable region having the amino acid sequence set forth in SEQ ID NO:10.
- the antibody or antigen binding fragment thereof comprises heavy and light chain variable regions having the amino acid sequences set forth in SEQ ID NO:9 and SEQ ID NO:10, respectively.
- the antibody or antigen binding thereof comprises a heavy chain having the amino acid sequence set forth in SEQ ID NO:25.
- the antibody or antigen binding thereof comprises a light chain having the amino acid sequence set forth in SEQ ID NO:26.
- the antibody comprises heavy and light chains having the amino acid sequences set forth in SEQ ID NO:25 and SEQ ID NO:26, respectively.
- Another exemplary ILT4 antibody is antibody 7B1 as described herein.
- the ILT4 antibody or antigen binding fragment thereof comprises the heavy and light chain CDRs or variable regions of antibody 7B1.
- the antibody or antigen binding fragment thereof comprises the CDR1, CDR2, and CDR3 domains of the heavy chain variable region of antibody 7B1 having the sequence set forth in SEQ ID NO:19, and the CDR1, CDR2 and CDR3 domains of the light chain variable region of antibody 7B1 having the sequence set forth in SEQ ID NO:20.
- the antibody or antigen binding fragment thereof comprises heavy chain CDR1, CDR2 and CDR3 domains having the sequences set forth in SEQ ID NOs:11, 13, and 15, respectively, or conservative sequence modifications thereof, and light chain CDR1, CDR2 and CDR3 domains having the sequences set forth in SEQ ID NOs: 16, 17, and 18, respectively, or conservative sequence modifications thereof.
- the antibody or antigen binding fragment thereof comprises a heavy chain variable region having the amino acid sequences set forth in SEQ ID NO:19. In another embodiment, the antibody or antigen binding fragment thereof comprises a light chain variable region having the amino acid sequences set forth in SEQ ID NO:20. In another embodiment, the antibody or antigen binding fragment thereof comprises heavy and light chain variable regions having the amino acid sequences set forth in SEQ ID NO:19 and SEQ ID NO:20, respectively. In another embodiment, the antibody or antigen binding thereof comprises a heavy chain having the amino acid sequence set forth in SEQ ID NO:27. In another embodiment, the antibody or antigen binding thereof comprises a light chain having the amino acid sequence set forth in SEQ ID NO:28.
- the antibody comprises heavy and light chains having the amino acid sequences set forth in SEQ ID NO:27 and SEQ ID NO:28, respectively.
- the ILT4 antibodies (or antigen binding fragments thereof) of the present invention comprise: (a) a heavy chain variable region amino acid sequence selected from the group consisting of SEQ ID NO:9, 19, 97, 98, 99, 103, 104, and 105, or a sequence at least 80% identical to any one of the aforementioned sequences; and / or (b) a light chain variable region amino acid sequence selected from the group consisting of SEQ ID NO:10, 20, 100, 101, 102, 106, 107, and 108, or a sequence at least 80% identical to any one of the aforementioned sequences.
- the ILT4 antibodies of the present invention comprise: (a) a heavy chain amino acid sequence as set forth in SEQ ID NO:25, 27, or a sequence at least 80% identical to either sequence; and / or (b) a light chain amino acid sequence as set forth in SEQ ID NO:26, 28, or a sequence at least 80% identical to either sequence.
- the sequences of the ILT4 antibodies or antigen binding fragments thereof can comprise the exact amino acid sequences as the antibodies described herein (e.g., antibodies 7A3 or 7B1).
- the antibodies comprise sequences of antibodies 7A3 or 7B1 which include conservative sequence modification, yet still retain the ability of to bind ILT4 effectively.
- sequence modifications may include one or more (e.g., 1, 2, 3, 4, 5, or 6) amino acid additions, deletions, or substitutions, e.g., conservative sequence modifications.
- the antibodies comprise sequences which share at least 80% sequence identity to the sequences of antibodies 7A3 or 7B1. Sequences substantially identical to the ILT4 antibodies or antigen binding fragments described herein (e.g., at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the aforementioned sequences), are also encompassed by the invention.
- the ILT4 antibody or antigen binding fragment thereof comprises a heavy chain variable region comprising SEQ ID NO:9, SEQ ID NO: 19, or a sequence at least 90% identical thereto (e.g., at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the aforementioned sequences).
- the ILT4 antibody or antigen binding fragment thereof comprises a light chain variable region comprising SEQ ID NO:10, SEQ ID NO:20, or a sequence at least 90% identical thereto (e.g., at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the aforementioned sequences).
- the ILT4 antibody or antigen binding fragment thereof comprises a heavy chain variable region comprising SEQ ID NO:9 and a light chain variable region comprising SEQ ID NO:10 or sequences at least 90% identical thereto (e.g., at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the aforementioned sequences).
- the ILT4 antibody or antigen binding fragment thereof comprises a heavy chain variable region comprising SEQ ID NO:19 and a light chain variable region comprising SEQ ID NO:20 or sequences at least 90% identical thereto (e.g., at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the aforementioned sequences).
- the ILT4 antibody or antigen binding fragment thereof comprises a heavy chain comprising SEQ ID NO:25, SEQ ID NO: 27, or a sequence at least 90% identical thereto (e.g., at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the aforementioned sequences).
- the ILT4 antibody or antigen binding fragment thereof comprises a light chain comprising SEQ ID NO:26, SEQ ID NO:28, or a sequence at least 90% identical thereto (e.g., at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the aforementioned sequences).
- the ILT4 antibody comprises a heavy chain comprising SEQ ID NO:25 and a light chain comprising SEQ ID NO:26 or sequences at least 90% identical thereto (e.g., at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the aforementioned sequences).
- the ILT4 antibody comprises a heavy chain comprising SEQ ID NO:27 and a light chain comprising SEQ ID NO:28 or sequences at least 90% identical thereto (e.g., at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the aforementioned sequences).
- ILT4 antibodies or antigen binding fragments thereof that compete for binding with any of the antibodies (or fragments) described herein, or that bind the same epitope as any of the antibodies (or fragments) described herein, are also encompassed by the present invention.
- the ILT4 antibody or antigen binding fragment thereof competes for binding to ILT4 with antibody 7A3 and/or antibody 7B1.
- the ILT4 antibodies or antigen binding fragments exhibit one or more of the following properties: a. blocking ILT4 ligand (e.g., HLA-G ligand) binding to human ILT4; b. enhancing or increasing cytokine or chemokine release by human macrophages; c. potentiating the activation effects of LPS and IFN ⁇ on macrophages; d. promoting M1 macrophage polarization; e. binding to human ILT4 with an equilibrium dissociation constant Kd of 10 -9 M or less, or alternatively, an equilibrium association constant Ka of 10 +9 M -1 or greater; f. lack of cross-reactivity with other ILT family members; g.
- ILT4 ligand e.g., HLA-G ligand
- the present invention also provides bispecific constructs (or multispecific constructs) comprising the ILT4 antibodies or antigen binding fragments thereof linked to at least one additional binding agent (e.g., a ligand or an antibody or antigen binding fragment thereof, e.g., a PD-L1 or PD-1 antibody or antigen binding fragment thereof).
- additional binding agent e.g., a ligand or an antibody or antigen binding fragment thereof, e.g., a PD-L1 or PD-1 antibody or antigen binding fragment thereof.
- the bispecific construct comprises a PD-L1 antibody or antigen binding fragment thereof which comprises heavy and light chain CDR1, CDR2, and CDR3 amino acid sequences selected from the group consisting of: (a) heavy chain variable region CDR1, CDR2 and CDR3 amino acid sequences as set forth in SEQ ID NOs: 59, 60, and 61, respectively, and light chain variable region CDR1, CDR2 and CDR3 amino acid sequences as set forth in SEQ ID NOs:62, 63, and 64, respectively; (b) heavy chain variable region CDR1, CDR2 and CDR3 amino acid sequences as set forth in SEQ ID NOs: 35, 36, and 37, respectively, and light chain variable region CDR1, CDR2 and CDR3 amino acid sequences as set forth in SEQ ID NOs:38, 39, and 40, respectively; (c) heavy chain variable region CDR1, CDR2 and CDR3 amino acid sequences as set forth in SEQ ID NOs: 41, 42, and 43, respectively, and light chain variable region
- the bispecific construct can be a chemical conjugate, which can be made by chemical conjugation of the ILT4 antibody and the second binding agent, e.g., a ligand or an antibody or antigen binding fragment thereof (such as a PD-L1 antibody or antigen binding fragment thereof).
- the PD-L1 antibody or antigen binding fragment thereof further comprises a human IgG1 constant domain.
- the ILT4 antibody or antigen binding fragment thereof is linked to the C-terminus of the heavy chain of the PD-L1 antibody or antigen binding fragment thereof.
- the ILT4 antigen binding fragment thereof is a scFv, e.g., a scFv further comprising disulfide stabilization modifications with Cys substitutions at VH44 and VL100.
- the ILT4 antibody or antigen binding fragment thereof further comprises a human IgG1 constant domain.
- the PD-L1 antibody or antigen binding fragment thereof is linked to the C-terminus of the heavy chain of the ILT4 antibody or antigen binding fragment thereof.
- the PD-L1 antigen binding fragment thereof is a scFv.
- the bispecific construct comprises a PD-L1 antibody linked to an ILT4 scFv, wherein: (a) the PD-L1 antibody, or antigen binding fragment thereof, comprises heavy chain variable region CDR1, CDR2 and CDR3 amino acid sequences as set forth in SEQ ID NOs: 59, 60, and 61, respectively, and light chain variable region CDR1, CDR2 and CDR3 amino acid sequences as set forth in SEQ ID NOs:62, 63, and 64, respectively; and (b) the ILT4 scFv comprises: (i) heavy chain variable region CDR1, CDR2 and CDR3 amino acid sequences as set forth in SEQ ID NOs:1, 3, and 5, respectively, and light chain variable region CDR1, CDR2 and CDR3 amino acid sequences as set forth in SEQ ID NOs:6, 7, and 8, respectively; or (ii) heavy chain variable region CDR1, CDR2 and CDR3 amino acid sequences as set forth in SEQ ID NOs:11, 13, and
- the ILT4 scFv of the bispecific (or multispecific) construct further comprises disulfide stabilization modifications with Cys substitutions at VH44 and VL100.
- the present invention also provides compositions comprising any of the bispecific constructs (multispecific constructs), antibodies, or antigen binding fragments thereof, described herein and a pharmaceutically acceptable carrier, as well as kits comprising any of the bispecific constructs (multispecific constructs), antibodies, or antigen binding fragments thereof, described herein and instructions for use.
- isolated nucleic acid molecules encoding the antibodies, or antigen binding fragments thereof, and bispecific or multispecific constructs described herein are also provided, as well as expression vectors comprising such nucleic acids and host cells comprising such expression vectors.
- nucleic acid molecule coding for any of the antibodies, or antigen binding fragments thereof, or bispecific constructs described herein is provided.
- nucleic acid molecule is in the form of an expression vector.
- nucleic acid molecule is in the form of an expression vector which expresses the antibody, or antigen binding fragment thereof, or bispecific construct when administered to a subject in vivo.
- the nucleic acid molecule comprises a nucleotide sequence encoding an antibody heavy and/or light chain variable region, wherein the antibody variable region comprises the amino acid sequence as set forth in SEQ ID NO:9, 10, 19, 20, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, or an amino acid sequence at least 90% identical thereto (e.g., at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to one or more of the aforementioned sequences).
- the nucleic acid molecule comprises a nucleotide sequence encoding an antibody heavy and/or light chain, wherein the antibody chain comprises the amino acid sequence as set forth in SEQ ID NO:25, 26, 27, 28, or an amino acid sequence at least 90% identical thereto (e.g., at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to one or more of the aforementioned sequences).
- the nucleic acid molecule comprises a nucleotide sequence encoding heavy and light chain variable regions of an antibody, wherein the heavy and light chain variable regions comprise the amino acid sequences as set forth in SEQ ID NOs:9 and 108 or SEQ ID NOs:19 and 20, respectively, or amino acids sequences at least 90% identical thereto (e.g., at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical the aforementioned sequences).
- the nucleic acid molecule comprises a nucleotide sequence encoding heavy and light chains of an antibody, wherein the heavy and light chains comprise the amino acid sequences as set forth in SEQ ID NOs:25 and 26 or SEQ ID NOs:27 and 28, respectively, or amino acids sequences at least 90% identical thereto (e.g., at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical the aforementioned sequences).
- methods for inducing or enhancing an immune response (e.g., against an antigen) in a subject comprising administering to the subject any one of the antibodies, or antigen binding fragments thereof, bispecific constructs, multispecific constructs, or the compositions described herein, in an amount effective to induce or enhance an immune response in the subject (e.g., against an antigen).
- methods of for treating a condition or disease in a subject e.g., cancer
- the method comprising administering to the subject any one of the antibodies, or antigen binding fragments thereof, bispecific constructs, multispecific constructs, or the compositions described herein, in an amount effective to treat the condition or disease.
- methods for treating a tumor e.g., a tumor expressing ILT4, HLA-G, HLA class I, angiopoietin like 2, Nogo, or an ILT4 ligand
- a tumor e.g., a tumor expressing ILT4, HLA-G, HLA class I, angiopoietin like 2, Nogo, or an ILT4 ligand
- the method comprising administering to the subject any one of the antibodies, or antigen binding fragments thereof, bispecific constructs, multispecific constructs, or the compositions described herein, in an amount effective to treat the tumor.
- the subject can be, for example, one who suffers from a condition or disease in which stimulation of an immune response is desired.
- the condition or disease in which stimulation of an immune response is desired is cancer.
- the method of inducing or enhancing an immune response (e.g., against an antigen) in a subject can further comprise administering the antigen to the subject.
- Preferred antigens to be co-administered with the antibodies, or antigen binding fragments thereof, bispecific constructs, multispecific constructs, or the compositions of described herein are tumor antigens.
- Figures 2A, 2B, and 2C are graphs showing representative traces of the antigen binding kinetic data for antibody 7A3 ( Figure 2A), antibody 7B1 ( Figure 2B), and control antibody ( Figure 2C).
- Figures 3A and 3B are graphs showing binding of chimeric and humanized monoclonal antibodies to human ILT4 using ELISA; antibody 7A3 ( Figure 3A) and antibody 7B1 ( Figure 3B).
- Figures 4A and 4B are graphs showing binding to HEK293 cells expressing human ILT4 for antibody 7A3 and its constructs ( Figure 4A) and antibody 7B1 and its constructs ( Figure 4B).
- Figures 5A and 5B are graphs showing macrophage TNF- ⁇ production for antibody 7A3 and its constructs ( Figure 5A) and antibody 7B1 and its constructs ( Figure 5B).
- Figures 6A-6F are graphs showing the induction of TNF- ⁇ and MIP1- ⁇ production by humanized antibodies 7A3 VH6-L17 and 7B1 VH10-L21 in macrophages; untreated ( Figures 6A and 6D), with LPS ( Figures 6B and E), and with IFN- ⁇ ( Figures 6C and 6F).
- Figures 7A, 7B, and 7C are graphs showing relative gene expression in humanized antibodies 7A3 VH6-L17 and 7B1 VH10-L21; Figure 7A (CD86), Figure 7B (CD54), and Figure 7C (iNOS).
- Figures 8A (antibody 7A3) and 8B (antibody 7B1) are graphs showing cross- reactivity of humanized monoclonal antibodies 7A3 VH6-L17 and 7B1 VH10-L21 to cells expressing ILT family members.
- Figures 9A (monocytes), 9B (macrophages), and 9C (dendritic cells) are graphs showing binding of humanized monoclonal antibodies 7A3 VH6-L17 and 7B1 VH10-L21 to myeloid cells.
- Figures 10A (PD-L1 x ILT4) and 10B (PD-1 x ILT4) are schematics showing the depiction of the bispecific constructs.
- Figure 11 is a table showing the antigen binding kinetics to human ILT4 for the bispecific antibody constructs.
- Figures 12A (9H9-7A3 HL and 9H9-7A3 LH) and 12B (9H9-7B1 HL and 9H9-7B1 LH) are graphs showing humanized bispecific antibody binding characteristics to human PD- L1 with ELISA.
- Figures 13A (9H9-7A3 HL and 9H9-7A3 LH) and 13B (9H9-7B1 HL and 9H9-7B1 LH) are graphs showing humanized bispecific antibody binding characteristics to HEK293 cells expressing human PD-L1.
- Figures 14A (9H9-7A3 HL and 9H9-7A3 LH) and 14B (9H9-7B1 HL and 9H9-7B1 LH) are graphs showing humanized bispecific antibody binding characteristics to HEK293 cells expressing human ILT4.
- Figures 15A (9H9-7A3 HL and 9H9-7A3 LH) and 15B (9H9-7B1 HL and 9H9-7B1 LH) are graphs showing bifunctional binding characteristics of humanized antibodies to HEK293 cells expressing human ILT4 and PD-L1.
- Figures 16A (9H9-7A3 HL and 9H9-7A3 LH) and 16B (9H9-7B1 HL and 9H9-7B1 LH) are graphs showing T cell PD-1/PD-L1 blockade by humanized bispecific antibodies.
- Figures 17A (9H9-7A3 HL and 9H9-7A3 LH) and 17B (9H9-7B1 HL and 9H9-7B1 LH) are graphs showing induction of TNF- ⁇ production by humanized bispecific antibodies in macrophages.
- Figures 18A (9H9-7A3 HL and 9H9-7A3 LH) and 18B (9H9-7B1 HL and 9H9-7B1 LH) are graphs showing inhibition of HLA-G binding to ILT4 by humanized bispecific antibodies.
- IV Detailed Description of the Invention
- immunoglobulin-like transcript 4 or “ILT4” as used herein refers to an inhibitory immune checkpoint receptor and a member of the non-catalytic tyrosine- phosphorylated receptor family.
- ILT4 is also referred to as leukocyte immunoglobulin like receptor B2 (LILRB2), LIR2, MIR10, and CD85d. ILT4 is expressed on immune cells where it binds to MHC class I molecules on antigen-presenting cells and transduces a negative signal that inhibits stimulation of an immune response, e.g., by controlling inflammatory responses and cytotoxicity to focus the immune response and limit autoreactivity. Multiple isoforms of human ILT4 have been identified. Isoform 1 (Accession No. Q8N423-1; SEQ ID NO: 89) represents the canonical sequence, consisting of 598 amino acid residues.
- ILT4 antibodies (or antigen binding fragments thereof) of the invention may cross-react with ILT4 from species other than human.
- the ILT4 antibodies or antigen binding fragments thereof may be specific for human ILT4 and may not exhibit any cross-reactivity with other species.
- ILT4 or any variants and isoforms thereof may either be isolated from cells or tissues which naturally express them or be recombinantly produced using well-known techniques in the art and/or those described herein.
- Ligands which bind ILT4 are known in the art and include, among others, HLA-G, HLA class I, angiopoietin like 2, b-amyloid, SEMA4A, CD1c/d, CSPs, and myelin inhibitors such as Nogo66, MAG, OMgp.
- HLA-G human leukocyte antigen G
- HLA-G also known as “histocompatibility antigen, class I, G”
- HLA-G belongs to the HLA nonclassical class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin).
- the heavy chain is anchored in the membrane. HLA-G is expressed on fetal derived placental cells. The heavy chain is approximately 45 kDa and its gene contains 8 exons.
- the terms “Programmed cell death 1 ligand 1”, “PD-L1”, “PDCD1 ligand 1”, “Programmed death ligand 1”, “B7 homolog 1”, “B7-H1” and “ILT44” are used interchangeably, and include variants, isoforms, species homologs of human PD-L1, and analogs having at least one common epitope with PD-L1.
- the complete PD-L1 sequence can be found under GenBank Accession No. NP_001254635 as set forth in SEQ ID NO:176.
- Programmed death-ligand 1 is a 40kDa type 1 transmembrane protein that has been speculated to play a major role in suppressing the immune system during particular events such as pregnancy, tissue allografts, autoimmune disease, and other disease states such as hepatitis. Normally the immune system reacts to foreign antigens that are associated with exogenous or endogenous danger signals, which triggers a proliferation of antigen-specific CD8+ T cells and/or CD4+ helper cells. The binding of PD-L1 to PD-1 transmits an inhibitory signal that reduces the proliferation of these T cells and can also induce apoptosis, which is further mediated by a lower regulation of the gene Bcl-2.
- the terms “Programmed Death 1,” “Programmed Cell Death 1,” “Protein PD-1,” “PD-1,” PD1,” “PDCD1,” “hPD-1” and “hPD-I” are used interchangeably, and include variants, isoforms, species homologs of human PD-1, and analogs having at least one common epitope with PD- 1.
- the complete PD-1 sequence can be found under GenBank Accession No. NP_005009 as set forth in SEQ ID NO:175.
- PD-L1 is abundant in a variety of human cancers (Dong et al. (2002) Nat. Med. 8:787-9).
- the term “subject” includes any human or non-human animal.
- the methods and compositions of the present invention can be used to treat a subject with an immune disorder.
- non-human animal includes all vertebrates, e.g., mammals and non-mammals, such as non-human primates, sheep, dog, cow, chickens, amphibians, reptiles, etc.
- antibody as referred to herein refers to a glycoprotein comprising at least two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds, or an antigen binding fragment thereof.
- Each heavy chain is comprised of a heavy chain variable region (abbreviated herein as VH) and a heavy chain constant region.
- the heavy chain constant region is comprised of three domains, CH1, CH2 and CH3.
- Each light chain is comprised of a light chain variable region (abbreviated herein as VL) and a light chain constant region.
- the light chain constant region is comprised of one domain, CL.
- the V H and VL regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR).
- CDR complementarity determining regions
- Each VH and VL is composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
- the variable regions of the heavy and light chains contain a binding domain that interacts with an antigen.
- the constant regions of the antibodies may mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component (Clq) of the classical complement system.
- antibody fragment refers to one or more fragments or portions of an antibody that retain the ability to specifically bind to an antigen (e.g., human ILT4).
- fragments are, for example between about 8 and about 1500 amino acids in length, suitably between about 8 and about 745 amino acids in length, suitably about 8 to about 300, for example about 8 to about 200 amino acids, or about 10 to about 50 or 100 amino acids in length. It has been shown that the antigen binding function of an antibody can be performed by fragments of a full- length antibody.
- binding fragments encompassed within the term “antigen binding fragment” of an antibody include (i) a Fab fragment, a monovalent fragment consisting of the V L , V H , CL and CH1 domains; (ii) a F(ab') 2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the VH and CH1 domains; (iv) a Fv fragment consisting of the VL and V H domains of a single arm of an antibody, (v) a dAb fragment (Ward et al., (1989) Nature 341:544-546), which consists of a VH domain; and (vi) an isolated complementarity determining region (CDR) or (vii) a combination of two or more isolated CDRs which may optionally be joined by a synthetic linker.
- a Fab fragment a monovalent fragment consisting of the V L , V H , CL and CH
- the two domains of the Fv fragment, VL and VH are coded for by separate genes, they can be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the V L and V H regions pair to form monovalent molecules (known as single chain Fv (sFv); see e.g., Bird et al. (1988) Science 242:423-426; and Huston et al. (1988) Proc. Natl. Acad. Sci. USA 85:5879-5883).
- single chain Fv single chain Fv
- Such single chain antibodies are also intended to be encompassed within the term “antigen binding fragment” of an antibody.
- binding domain refers to the portion of a protein or antibody which comprises the amino acid residues that interact with an antigen. Binding domains include, but are not limited to, antibodies (e.g., full length antibodies), as well as antigen binding fragments thereof. The binding domain confers on the binding agent its specificity and affinity for the antigen.
- the term also covers any protein having a binding domain which is homologous or largely homologous to an immunoglobulin-binding domain. Such proteins may be derived from natural sources, or partly or wholly synthetically produced.
- the term “monoclonal antibody,” as used herein, refers to an antibody that displays a single binding specificity and affinity for a particular epitope. Accordingly, the term “human monoclonal antibody” refers to an antibody which displays a single binding specificity and which has variable and optional constant regions derived from human germline immunoglobulin sequences.
- human monoclonal antibodies are produced by a hybridoma that includes a B cell obtained from a transgenic non-human animal, e.g., a transgenic mouse, having a genome comprising a human heavy chain transgene and a light chain transgene fused to an immortalized cell.
- recombinant human antibody includes all human antibodies that are prepared, expressed, created or isolated by recombinant means, such as (a) antibodies isolated from an animal (e.g., a mouse) that is transgenic or transchromosomal for human immunoglobulin genes or a hybridoma prepared therefrom, (b) antibodies isolated from a host cell transformed to express the antibody, e.g., from a transfectoma, (c) antibodies isolated from a recombinant, combinatorial human antibody library, and (d) antibodies prepared, expressed, created or isolated by any other means that involve splicing of human immunoglobulin gene sequences to other DNA sequences.
- variable and constant regions that utilize particular human germline immunoglobulin sequences are encoded by the germline genes, but include subsequent rearrangements and mutations which occur, for example, during antibody maturation.
- the variable region contains the antigen binding domain, which is encoded by various genes that rearrange to form an antibody specific for a foreign antigen.
- the variable region can be further modified by multiple single amino acid changes (referred to as somatic mutation or hypermutation) to increase the affinity of the antibody to the foreign antigen.
- the constant region will change in further response to an antigen (i.e., isotype switch).
- the rearranged and somatically mutated nucleic acid molecules that encode the light chain and heavy chain immunoglobulin polypeptides in response to an antigen may not have sequence identity with the original nucleic acid molecules, but instead will be substantially identical or similar (i.e., have at least 80% identity).
- the term “human antibody” includes antibodies having variable and constant regions (if present) of human germline immunoglobulin sequences. Human antibodies of the invention can include amino acid residues not encoded by human germline immunoglobulin sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo) (see, Lonberg, N. et al.
- human antibody does not include antibodies in which CDR sequences derived from the germline of another mammalian species, such as a mouse, have been grafted onto human framework sequences (i.e., chimeric and humanized antibodies).
- a “humanized” antibody refers to an antibody in which some, most, or all of the amino acids outside the CDR domains of a non-human antibody are replaced with corresponding amino acids derived from human immunoglobulins. In one embodiment of a humanized form of an antibody, some, most or all of the amino acids outside the CDR domains have been replaced with amino acids from human immunoglobulins, whereas some, most or all amino acids within one or more CDR regions are unchanged. Small additions, deletions, insertions, substitutions or modifications of amino acids are permissible as long as they do not abrogate the ability of the antibody to bind to a particular antigen.
- a "humanized” antibody retains an antigenic specificity similar to that of the original antibody.
- an “isolated antibody,” as used herein, is intended to refer to an antibody which is substantially free of other antibodies having different antigenic specificities (e.g., an isolated antibody that specifically binds to human ILT4 is substantially free of antibodies that specifically bind antigens other than human ILT4; an isolated antibody that specifically binds to human PD-L1 is substantially free of antibodies that specifically bind antigens other than human PD-L1).
- An isolated antibody that specifically binds to an epitope may, however, have cross-reactivity to the same antigen from different species.
- an isolated antibody is typically substantially free of other cellular material and/or chemicals.
- epitopes refers to a site on an antigen to which an immunoglobulin or antibody specifically binds.
- Epitopes can be formed both from contiguous amino acids or noncontiguous amino acids juxtaposed by tertiary folding of a protein. Epitopes formed from contiguous amino acids are typically retained on exposure to denaturing solvents, whereas epitopes formed by tertiary folding are typically lost on treatment with denaturing solvents.
- An epitope typically includes at least 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 or 15 amino acids in a unique spatial conformation.
- epitope mapping Methods for determining what epitopes are bound by a given antibody (i.e., epitope mapping) are well known in the art and include, for example, immunoblotting and immunoprecipitation assays, wherein overlapping or contiguous peptides from the antigen (e.g., ILT4 or PD-L1) are tested for reactivity with the given antibody (e.g., an ILT4 or PD-L1 antibody.
- Methods of determining spatial conformation of epitopes include techniques in the art and those described herein, for example, x-ray crystallography and 2-dimensional nuclear magnetic resonance (see, e.g., Epitope Mapping Protocols in Methods in Molecular Biology, Vol.66, G. E. Morris, Ed. (1996)).
- antibody that binds the same epitope is intended to encompass antibodies that interact with, i.e., bind to, the same structural region on human ILT4 as a reference ILT4 antibody.
- the “same epitope” to which the antibodies bind may be a linear epitope or a conformational epitope formed by tertiary folding of the antigen.
- the term “competing antibody” refers to an antibody that competes for binding to human ILT4 with a reference ILT4 antibody, i.e., competitively inhibits binding of the reference ILT4 antibody to ILT4.
- a “competing antibody” may bind the same epitope on ILT4 as the reference ILT4 antibody, may bind to an overlapping epitope or may sterically hinder the binding of the reference ILT4 antibody to ILT4.
- Antibodies that recognize the same epitope or compete for binding can be identified using routine techniques. Such techniques include, for example, an immunoassay, which shows the ability of one antibody to block the binding of another antibody to a target antigen, i.e., a competitive binding assay.
- Competitive binding is determined in an assay in which the immunoglobulin under test inhibits specific binding of a reference antibody to a common antigen, such as ILT4.
- RIA solid phase direct or indirect radioimmunoassay
- EIA solid phase direct or indirect enzyme immunoassay
- sandwich competition assay see Stahli et al., Methods in Enzymology 9:242 (1983)
- solid phase direct biotin-avidin EIA see Kirkland et al., J. Immunol.137:3614 (1986)
- solid phase direct labeled assay solid phase direct labeled sandwich assay
- solid phase direct labeled sandwich assay see Harlow and Lane, Antibodies: A Laboratory Manual, Cold Spring Harbor Press (1988)
- solid phase direct label RIA using I-125 label see Morel et al., Mol.
- a competing antibody when it is present in excess, it will inhibit specific binding of a reference antibody to a common antigen by at least 50-55%, 55-60%, 60-65%, 65-70% 70-75% or more.
- Other techniques include, for example, epitope mapping methods, such as, x-ray analyses of crystals of antigen:antibody complexes which provides atomic resolution of the epitope.
- Other methods monitor the binding of the antibody to antigen fragments or mutated variations of the antigen where loss of binding due to a modification of an amino acid residue within the antigen sequence is often considered an indication of an epitope component.
- computational combinatorial methods for epitope mapping can also be used.
- the antibody binds with an equilibrium dissociation constant (K D ) of approximately less than 10 -7 M, such as approximately less than 10 -8 M, 10 -9 M or 10 -10 M or even lower when determined by surface plasmon resonance (SPR) technology in a BIACORE 2000 instrument (e.g., using recombinant human ILT4 as the analyte and the antibody as the ligand) and binds to the predetermined antigen with an affinity that is at least two-fold greater than its affinity for binding to a non-specific antigen (e.g., BSA, casein) other than the predetermined antigen or a closely-related antigen.
- K D equilibrium dissociation constant
- an antibody recognizing an antigen and “an antibody specific for an antigen” are used interchangeably herein with the term “an antibody which binds specifically to an antigen.”
- KD is intended to refer to the dissociation equilibrium constant of a particular antibody-antigen interaction.
- the human antibodies of the invention bind to ILT4 with a dissociation equilibrium constant (K D ) of approximately 10 -8 M or less, such as less than 10 -9 M or 10 -10 M or even lower when determined by surface plasmon resonance (SPR) technology in a BIACORE 2000 instrument (e.g., using recombinant human ILT4 as the analyte and the antibody as the ligand).
- SPR surface plasmon resonance
- the term “kd” as used herein, is intended to refer to the off rate constant for the dissociation of an antibody from the antibody/antigen complex.
- the term “ka” as used herein, is intended to refer to the on rate constant for the association of an antibody with the antigen.
- the term “EC50,” as used herein, refers to the concentration of an antibody or an antigen binding fragment thereof, which induces a response, either in an in vitro or an in vivo assay, which is 50% of the maximal response, i.e., halfway between the maximal response and the baseline.
- isotype refers to the antibody class (e.g., IgM or IgGl) that is encoded by heavy chain constant region genes.
- a human monoclonal antibody of the invention is of the IgG1 isotype. In another embodiment, a human monoclonal antibody of the invention is of the IgG2 isotype.
- the terms “inhibits” or “blocks” are used interchangeably and encompass both partial and complete inhibition/blocking. The inhibition/blocking preferably reduces or alters the normal level or type of activity that occurs when binding occurs without inhibition or blocking.
- Inhibition and blocking are also intended to include any measurable decrease in the binding affinity of HLA-G when in contact with an ILT4 antibody as compared to HLA-G not in contact with an ILT4 antibody, e.g., inhibits binding of HLA-G by at least about 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75% , 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%.
- the ILT4 antibody inhibits binding of HLA-G by at least about 70%.
- the ILT4 antibody inhibits binding of HLA-G by at least 80%.
- Inhibition and blocking are also intended to include any measurable decrease in the binding affinity of PD1 when in contact with an PD-L1 antibody as compared to PD1 not in contact with an PD-L1 antibody, e.g., inhibits binding of PD1 by at least about 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75% , 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%.
- the PD-L1 antibody inhibits binding of PD1 by at least about 70%.
- the PD-L1 antibody inhibits binding of PD1 by at least 80%.
- cross-reacts refers to the ability of an ILT4 antibody or antigen binding fragment thereof or a PD-L1 antibody or antigen binding fragment thereof of the invention to bind to ILT4 or PD-L1, respectively, from a different species.
- a ILT4 antibody or antigen binding fragment thereof of the invention that binds human ILT4 may also bind another species of ILT4.
- an PD-L1 antibody or antigen binding fragment thereof of the invention that binds human PD-L1 may also bind another species of PD-L1.
- cross-reactivity is measured by detecting a specific reactivity with purified antigen in binding assays (e.g., SPR, ELISA) or binding to, or otherwise functionally interacting with, cells physiologically expressing ILT4.
- binding assays e.g., SPR, ELISA
- Methods for determining cross- reactivity include standard binding assays as described herein, for example, by Biacore TM surface plasmon resonance (SPR) analysis using a Biacore TM 2000 SPR instrument (Biacore AB, Uppsala, Sweden), or flow cytometric techniques.
- SPR Biacore TM surface plasmon resonance
- nucleic acid molecule is intended to include DNA molecules and RNA molecules.
- a nucleic acid molecule may be single-stranded or double- stranded, but preferably is double-stranded DNA.
- isolated nucleic acid molecule as used herein in reference to nucleic acids encoding binding domains, antibodies, or antibody portions (e.g., V H , V L , CDR3) that bind to ILT4 and/or PD-L1, is intended to refer to a nucleic acid molecule in which the nucleotide sequences encoding the antibodies, or antibody portions are free of other nucleotide sequences encoding the antibodies, or antibody portions that bind antigens other than ILT4 and/or PD-L1, which other sequences may naturally flank the nucleic acid in human genomic DNA.
- the nucleic acids may be present in whole cells, in a cell lysate, or in a partially purified or substantially pure form.
- a nucleic acid is “isolated” or “rendered substantially pure” when purified away from other cellular components or other contaminants, e.g., other cellular nucleic acids or proteins, by standard techniques, including alkaline/SDS treatment, CsCl banding, column chromatography, agarose gel electrophoresis and others well known in the art. See, F. Ausubel, et al., ed. Current Protocols in Molecular Biology, Greene Publishing and Wiley Interscience, New York (1987).
- the nucleic acid molecules of the present invention while often in a native sequence (except for modified restriction sites and the like), from either cDNA, genomic or mixtures thereof may be mutated, in accordance with standard techniques to provide gene sequences.
- coding sequences these mutations, may affect amino acid sequence as desired.
- DNA sequences substantially identical to or derived from native V, D, J, constant, switches and other such sequences described herein are contemplated (where "derived” indicates that a sequence is identical or modified from another sequence).
- a nucleic acid is “operably linked” or “operatively linked” when it is placed into a functional relationship with another nucleic acid sequence.
- a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of the sequence.
- operably linked means that the DNA sequences being linked are contiguous and, where necessary to join two protein coding regions, contiguous and in reading frame.
- operably linked indicates that the sequences are capable of effecting switch recombination.
- the present invention also encompasses “conservative sequence modifications” of any of the sequences described herein, i.e., nucleotide and amino acid sequence modifications which do not abrogate the binding of the VH and VL sequences encoded by the nucleotide sequence or containing the amino acid sequence, to the antigen.
- conservative sequence modifications include conservative nucleotide and amino acid substitutions, as well as, nucleotide and amino acid additions and deletions.
- modifications can be introduced into the sequences by standard techniques known in the art, such as site-directed mutagenesis and PCR-mediated mutagenesis.
- Conservative amino acid substitutions include ones in which the amino acid residue is replaced with an amino acid residue having a similar side chain.
- Families of amino acid residues having similar side chains have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine, tryptophan), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
- basic side chains
- a predicted nonessential amino acid residue in an ILT4 antibody is preferably replaced with another amino acid residue from the same side chain family.
- Methods of identifying nucleotide and amino acid conservative substitutions which do not eliminate antigen binding are well-known in the art (see, e.g., Brummell et al., Biochem.32:1180-1187 (1993); Kobayashi et al. Protein Eng. 12(10):879-884 (1999); and Burks et al. Proc. Natl. Acad. Sci. USA 94:412-417 (1997)).
- conservative amino acid sequence modifications refer to at most 1, 2, 3, 4 or 5 conservative amino acid substitutions to the CDR sequences described herein.
- each such CDR may contain up to 5 conservative amino acid substitutions, e.g., up to (i.e., not more than) 4 conservative amino acid substitutions, e.g.,up to (i.e., not more than) 3 conservative amino acid substitutions, e.g., up to (i.e., not more than) 2 conservative amino acid substitutions, or no more than 1 conservative amino acid substitution.
- mutations can be introduced randomly along all or part of an ILT4 or PD-L1 or PD-1 antibody or antigen binding fragment thereof coding sequence, such as by saturation mutagenesis, and the resulting modified ILT4 or PD-L1 or PD-1 antibodies can be screened for binding activity.
- nucleic acids For nucleic acids, the term “substantial homology” indicates that two nucleic acids, or designated sequences thereof, when optimally aligned and compared, are identical, with appropriate nucleotide insertions or deletions, in at least about 80% of the nucleotides, usually at least about 90% to 95%, and more preferably at least about 98% to 99.5% of the nucleotides. Alternatively, substantial homology exists when the segments will hybridize under selective hybridization conditions, to the complement of the strand.
- the term “substantial homology” indicates that two amino acid sequences, or designated sequences thereof, when optimally aligned and compared, are identical, with appropriate amino acid insertions or deletions, in at least about 80% of the amino acids, usually at least about 90% to 95%, and more preferably at least about 98% to 99% or 99.5% of the amino acids.
- the comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm, as described in the non-limiting examples below.
- the percent identity between two nucleotide sequences can be determined using the GAP program in the GCG software package (available at http://www.gcg.com), using a NWSgapdna.CMP matrix and a gap weight of 40, 50, 60, 70, or 80 and a length weight of 1, 2, 3, 4, 5, or 6.
- the percent identity between two nucleotide or amino acid sequences can also be determined using the algorithm of E. Meyers and W.
- the percent identity between two amino acid sequences can be determined using the Needleman and Wunsch (J. Mol. Biol. (48):444-453 (1970)) algorithm which has been incorporated into the GAP program in the GCG software package (available at http://www.gcg.com), using either a Blossum 62 matrix or a PAM250 matrix, and a gap weight of 16, 14, 12, 10, 8, 6, or 4 and a length weight of 1, 2, 3, 4, 5, or 6.
- the nucleic acid and protein sequences of the present invention can further be used as a “query sequence” to perform a search against public databases to, for example, identify related sequences.
- Such searches can be performed using the NBLAST and XBLAST programs (version 2.0) of Altschul, et al. (1990) J. Mol. Biol.215:403-10.
- Gapped BLAST can be utilized as described in Altschul et al., (1997) Nucleic Acids Res.25(17):3389-3402.
- the default parameters of the respective programs e.g., XBLAST and NBLAST
- ILT4 Antibodies and Antigen Binding Fragments Thereof Provided herein are novel ILT4 antibodies (or antigen binding fragments thereof), e.g., humanized antibodies, which are characterized by particular functional features or properties.
- antibodies (or fragments) of the present invention exhibit one or more of the following properties: a. blocking ILT4 ligand (e.g., HLA-G ligand) binding to human ILT4; b. enhancing or increasing cytokine or chemokine release by human macrophages; c. potentiating the activation effects of LPS and IFN ⁇ on macrophages; d. promoting M1 macrophage polarization; e. binding to human ILT4 with an equilibrium dissociation constant Kd of 10 -9 M or less, or alternatively, an equilibrium association constant Ka of 10 +9 M -1 or greater; f. lack of cross-reactivity with other ILT family members; g.
- ILT4 ligand e.g., HLA-G ligand
- an exemplary ILT4 antibody is antibody 7A3 as described herein.
- the ILT4 antibody or antigen binding fragment thereof comprises the heavy and light chain CDRs or variable regions of antibody 7A3.
- the antibody or antigen binding fragment comprises the CDR1, CDR2, and CDR3 domains of the heavy chain variable region of antibody 7A3 having the sequence set forth in SEQ ID NO:9, and the CDR1, CDR2 and CDR3 domains of the light chain variable region of antibody 7A3 having the sequence set forth in SEQ ID NO:10.
- the antibody or antigen binding fragment thereof comprises heavy chain CDR1, CDR2 and CDR3 domains having the sequences set forth in SEQ ID NOs:1, 3, and 5, respectively, or conservative sequence modifications thereof, and light chain CDR1, CDR2 and CDR3 domains having the sequences set forth in SEQ ID NOs:6, 7, and 8, respectively, or conservative sequence modifications thereof.
- the antibody or antigen binding fragment thereof comprises heavy chain CDR1, CDR2 and CDR3 domains having the sequences set forth in SEQ ID NOs:2, 4, and 5, respectively, or conservative sequence modifications thereof, and light chain CDR1, CDR2 and CDR3 domains having the sequences set forth in SEQ ID NOs:6, 7, and 8, respectively, or conservative sequence modifications thereof.
- the antibody or antigen binding fragment thereof comprises a heavy chain variable region having the amino acid sequence set forth in SEQ ID NO:9.
- the antibody or antigen binding fragment comprises a heavy chain variable region having the amino acid sequence set forth in SEQ ID NO:97, 98, or 99.
- the antibody or antigen binding fragment thereof comprises a light chain variable region having the amino acid sequence set forth in SEQ ID NO:10.
- the antibody or antigen binding fragment comprises a light chain variable region having the amino acid sequence set forth in SEQ ID NO:100, 101, or 102.
- the antibody or antigen binding fragment thereof comprises a heavy chain variable region and a light chain variable region, wherein: (a) the heavy chain variable region comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 9, 97, 98, and 99, and (b) the light chain variable region comprises an amino acid sequence selected from the group consisting of SEQ ID NOs:10, 100, 101, and 102.
- the antibody or antigen binding fragment comprises heavy and light chain variable regions having the amino acid sequences set forth in SEQ ID NO:9 and 10.
- Another exemplary ILT4 antibody is antibody 7B1 as described herein.
- the ILT4 antibody or antigen binding fragment thereof comprises the heavy and light chain CDRs or variable regions of antibody 7B1.
- the antibody or antigen binding fragment comprises the CDR1, CDR2, and CDR3 domains of the heavy chain variable region of antibody 7B1 having the sequence set forth in SEQ ID NO:19, and the CDR1, CDR2 and CDR3 domains of the light chain variable region of antibody 7B1 having the sequence set forth in SEQ ID NO:20.
- the antibody or antigen binding fragment thereof comprises heavy chain CDR1, CDR2 and CDR3 domains having the sequences set forth in SEQ ID NOs:11, 13, and 15, respectively, or conservative sequence modifications thereof, and light chain CDR1, CDR2 and CDR3 domains having the sequences set forth in SEQ ID NOs:16, 17, and 18, respectively, or conservative sequence modifications thereof.
- the antibody or antigen binding fragment thereof comprises heavy chain CDR1, CDR2 and CDR3 domains having the sequences set forth in SEQ ID NOs:12, 14, and 15, respectively, or conservative sequence modifications thereof, and light chain CDR1, CDR2 and CDR3 domains having the sequences set forth in SEQ ID NOs:16, 17, and 18, respectively, or conservative sequence modifications thereof.
- the antibody or antigen binding fragment thereof comprises a heavy chain variable region having the amino acid sequence set forth in SEQ ID NO:19.
- the antibody or antigen binding fragment comprises a heavy chain variable region having the amino acid sequence set forth in SEQ ID NO:103, 104, or 105.
- the antibody or antigen binding fragment thereof comprises a light chain variable region having the amino acid sequence set forth in SEQ ID NO:20.
- the antibody or antigen binding fragment comprises a light chain variable region having the amino acid sequence set forth in SEQ ID NO:106, 107, or 108.
- the antibody or antigen binding fragment thereof comprises a heavy chain variable region and a light chain variable region, wherein: (a) the heavy chain variable region comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 19, 103, 104, and 105, and (b) the light chain variable region comprises an amino acid sequence selected from the group consisting of SEQ ID NOs:20, 106, 107, and 108.
- the antibody or antigen binding fragment comprises heavy and light chain variable regions having the amino acid sequences set forth in SEQ ID NO:19 and 20.
- the antibody sequences can also be consensus sequences of several antibodies.
- the ILT4 antibody or antigen binding fragment comprises a heavy chain variable region CDR1 comprising an amino acid sequence selected from the consensus sequence: G Y T (I,M) H (SEQ ID NO: 21).
- the ILT4 antibody or antigen binding fragment comprises a heavy chain variable region CDR2 comprising SEQ ID NO:3.
- the ILT4 antibody or antigen binding fragment comprises a heavy chain variable region CDR3 comprising an amino acid sequence selected from the consensus sequence: E R P G G S Q F I Y Y Y (P,A) (M,L) D Y (SEQ ID NO:22).
- the ILT4 antigen binding fragment comprises a light chain variable region CDR1 comprising an amino acid sequence selected from the consensus sequence: R A S (A,E) N I Y S Y L A (SEQ ID NO: 23).
- the ILT4 antibody or antigen binding fragment comprises a light chain variable region CDR2 comprising an amino acid sequence selected from the consensus sequence: N A (I,D) T L A E (SEQ ID NO: 24).
- the ILT4 antibody or antigen binding fragment comprises a light chain variable region CDR3 comprising SEQ ID NO:8.
- VH and VL sequences described herein can be “mixed and matched” to create various ILT4 antibodies or antigen binding fragments thereof.
- the binding of such “mixed and matched” antibodies to human ILT4 can be tested using the binding assays known in the art and described in the Examples (e.g., ELISAs).
- ILT4 antibodies and antigen binding fragments thereof of the present invention include combinations of heavy and light chain variable region sequences as set forth in Table 1.
- VH and VL Sequence Combinations (SEQ ID NOs) Sequences substantially identical to the ILT4 antibodies and antigen binding fragments thereof described herein (e.g., sequences at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the aforementioned sequences) are also provided.
- the ILT4 antibody or antigen binding fragment thereof comprises a heavy chain variable region comprising SEQ ID NO:9, 97, 98, 99, 19, 103, 104, 105, or a sequence at least 80% identical thereto (e.g., at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95% 96%, 97%, 98%, or 99% identical to the aforementioned sequences).
- the ILT4 antibody or antigen binding fragment thereof comprises a light chain variable region comprising SEQ ID NO:10, 100, 101, 102, 20, 106, 107, 108, or a sequence at least 80% identical thereto (e.g., at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the aforementioned sequences).
- the ILT4 antibody (or antigen binding fragment thereof) comprises a (a) heavy chain variable region comprising SEQ ID NO:9, 97, 98, 99, 19, 103, 104, 105, or a sequence at least 80% identical thereto (e.g., at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the aforementioned sequences) and (b) light chain variable region comprising SEQ ID NO: 10, 100, 101, 102, 20, 106, 107, or 108, or a sequence at least 80% identical thereto (e.g., at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the aforementioned sequence
- the ILT4 antibody or antigen binding fragment thereof comprises SEQ ID NO: 9, or a sequence at least 80% identical thereto (e.g., at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical thereto) and SEQ ID NO:19, or a sequence at least 80% identical thereto (e.g., at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical thereto).
- the ILT4 antibody or antigen binding fragment thereof comprises SEQ ID NO:10, or a sequence at least 80% identical thereto (e.g., at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical thereto) and SEQ ID NO:20, or a sequence at least 80% identical thereto (e.g., at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical thereto).
- SEQ ID NO:10 or a sequence at least 80% identical thereto (e.g., at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%,
- ILT4 antibodies and antigen binding fragments thereof that compete for binding with any of the ILT4 antibody or fragments thereof described herein, or that bind the same epitope as any of the ILT4 antibody or fragments thereof described herein.
- the ILT4 antibody or antigen binding fragment thereof competes for binding to ILT4 with antibody 7A3 (or an antibody having the heavy and light chain CDRs and/or heavy and light chain variable region sequences corresponding to antibody 7A3).
- the ILT4 antibody or antigen binding fragment thereof competes for binding to ILT4 with antibody 7B1 (or an antibody having the heavy and light chain CDRs and/or heavy and light chain variable region sequences corresponding to antibody 7B1).
- the ILT4 antibody or antigen binding fragment thereof binds to the same epitope on ILT4 as antibody 7A3 (or an antibody having the heavy and light chain CDRs and/or heavy and light chain variable region sequences corresponding to antibody 7A3). In another embodiment, the ILT4 antibody or antigen binding fragment thereof binds to the same epitope on ILT4 as antibody 7B1 (or an antibody having the heavy and light chain CDRs and/or heavy and light chain variable region sequences corresponding to antibody 7B1).
- the ILT4 antibody, or antigen binding fragment thereof comprises heavy chain variable region CDR1, CDR2 and CDR3 as set forth in SEQ ID NOs:1, 3, and 5, respectively, and light chain variable region CDR1, CDR2 and CDR3 as set forth in SEQ ID NOs:6, 7, and 8, respectively.
- the ILT4 antibody, or antigen binding fragment thereof comprises heavy chain variable region CDR1, CDR2 and CDR3 as set forth in SEQ ID NOs:2, 4, and 5, respectively, and light chain variable region CDR1, CDR2 and CDR3 as set forth in SEQ ID NOs:6, 7, and 8, respectively.
- the ILT4 antibody, or antigen binding fragment thereof comprises a heavy chain variable region comprising SEQ ID NO:9 and a light chain variable region comprising SEQ ID NO:19 or sequences at least 80% identical to te aforementioned sequences (e.g., at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical).
- the ILT4 antibody, or antigen binding fragment thereof comprises heavy chain variable region CDR1, CDR2 and CDR3 as set forth in SEQ ID NOs:11, 13, and 15, respectively, and light chain variable region CDR1, CDR2 and CDR3 as set forth in SEQ ID NOs:16, 17, and 18, respectively.
- the ILT4 antibody, or antigen binding fragment thereof comprises heavy chain variable region CDR1, CDR2 and CDR3 as set forth in SEQ ID NOs:12, 14, and 15, respectively, and light chain variable region CDR1, CDR2 and CDR3 as set forth in SEQ ID NOs:16, 17, and 18, respectively.
- the ILT4 antibody, or antigen binding fragment thereof comprises a heavy chain variable region comprising SEQ ID NO:10 and a light chain variable region comprising SEQ ID NO:20 or sequences at least 80% identical to the aforementioned sequences (e.g., at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical).
- a heavy chain variable region comprising SEQ ID NO:10
- a light chain variable region comprising SEQ ID NO:20 or sequences at least 80% identical to the aforementioned sequences (e.g., at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical).
- PD-L1 Antibodies and Antigen Binding Fragments Thereof Provided herein are PD-L1 antibodies and antigen binding fragments thereof for use with the ILT4 antibodies or antigen binding fragments of the present invention, e.g., in bispecific and multispecific constructs, as well as methods of treatment.
- An exemplary PD-L1 antibody is antibody 7H7 as described herein.
- the PD-L1 antibody or antigen binding fragment thereof comprises the heavy and light chain CDRs or variable regions of antibody 7H7.
- the antibody or antigen binding fragment thereof comprises the CDR1, CDR2, and CDR3 domains of the heavy chain variable region of antibody 7H7 having the sequence set forth in SEQ ID NO:77, and the CDR1, CDR2 and CDR3 domains of the light chain variable region of antibody 7H7 having the sequence set forth in SEQ ID NO:78.
- the antibody or antigen binding fragment thereof comprises heavy chain CDR1, CDR2 and CDR3 domains having the sequences set forth in SEQ ID NOs:29, 30, and 31, respectively, or conservative sequence modifications thereof, and light chain CDR1, CDR2 and CDR3 domains having the sequences set forth in SEQ ID NOs:32, 33, and 34, respectively, or conservative sequence modifications thereof.
- the antibody or antigen binding fragment thereof comprises a heavy chain variable region having the amino acid sequence set forth in SEQ ID NO:77. In another embodiment, the antibody or antigen binding fragment thereof comprises a heavy chain variable region having the amino acid sequence set forth in SEQ ID NO:77. In another embodiment, the antibody or antigen binding fragment thereof comprises heavy and light chain variable regions having the amino acid sequences set forth in SEQ ID NO:77 and SEQ ID NO:78, respectively.
- Another exemplary PD-L1 antibody is antibody 1B3 as described herein. In one embodiment, the PD-L1 antibody or antigen binding fragment thereof comprises the heavy and light chain CDRs or variable regions of antibody 1B3.
- the antibody or antigen binding fragment thereof comprises the CDR1, CDR2, and CDR3 domains of the heavy chain variable region of antibody 1B3 having the sequence set forth in SEQ ID NO:79, and the CDR1, CDR2 and CDR3 domains of the light chain variable region of antibody 1B3 having the sequence set forth in SEQ ID NO:80.
- the antibody or antigen binding fragment thereof comprises heavy chain CDR1, CDR2 and CDR3 domains having the sequences set forth in SEQ ID NOs:35, 36, and 37, respectively, or conservative sequence modifications thereof, and light chain CDR1, CDR2 and CDR3 domains having the sequences set forth in SEQ ID NOs:38, 39, and 40, respectively, or conservative sequence modifications thereof.
- the antibody or antigen binding fragment thereof comprises a heavy chain variable region having the amino acid sequences set forth in SEQ ID NO:79. In another embodiment, the antibody or antigen binding fragment thereof comprises a light chain variable region having the amino acid sequences set forth in SEQ ID NO:80. In another embodiment, the antibody or antigen binding fragment thereof comprises heavy and light chain variable regions having the amino acid sequences set forth in SEQ ID NO:79 and SEQ ID NO:80, respectively.
- Another exemplary PD-L1 antibody is antibody 3B6 as described herein. In one embodiment, the PD-L1 antibody or antigen binding fragment thereof comprises the heavy and light chain CDRs or variable regions of antibody 3B6.
- the antibody or antigen binding fragment thereof comprises the CDR1, CDR2, and CDR3 domains of the heavy chain variable region of antibody 3B6 having the sequence set forth in SEQ ID NO:81, and the CDR1, CDR2 and CDR3 domains of the light chain variable region of antibody 3B6 having the sequence set forth in SEQ ID NO:82.
- the antibody or antigen binding fragment thereof comprises heavy chain CDR1, CDR2 and CDR3 domains having the sequences set forth in SEQ ID NOs:41, 42, and 43, respectively, or conservative sequence modifications thereof, and light chain CDR1, CDR2 and CDR3 domains having the sequences set forth in SEQ ID NOs:44, 45, and 46, respectively, or conservative sequence modifications thereof.
- the antibody or antigen binding fragment thereof comprises a heavy chain variable region having the amino acid sequence set forth in SEQ ID NO:81. In another embodiment, the antibody or antigen binding fragment thereof comprises a light chain variable region having the amino acid sequence set forth in SEQ ID NO:82. In another embodiment, the antibody or antigen binding fragment n thereof comprises heavy and light chain variable regions having the amino acid sequences set forth in SEQ ID NO:81 and SEQ ID NO:82, respectively.
- Another exemplary PD-L1 antibody is antibody 8B1 as described herein. In one embodiment, the PD-L1 antibody or antigen binding fragment thereof comprises the heavy and light chain CDRs or variable regions of antibody 8B1.
- the antibody or antigen binding fragment thereof comprises the CDR1, CDR2, and CDR3 domains of the heavy chain variable region of antibody 8B1 having the sequence set forth in SEQ ID NO:83, and the CDR1, CDR2 and CDR3 domains of the light chain variable region of antibody 8B1 having the sequence set forth in SEQ ID NO:84.
- the antibody or antigen binding fragment thereof comprises heavy chain CDR1, CDR2 and CDR3 domains having the sequences set forth in SEQ ID NOs:47, 48, and 49, respectively, or conservative sequence modifications thereof, and light chain CDR1, CDR2 and CDR3 domains having the sequences set forth in SEQ ID NOs:50, 51, and 52, respectively, or conservative sequence modifications thereof.
- the antibody or antigen binding fragment thereof comprises a heavy chain variable region having the amino acid sequences set forth in SEQ ID NO:83. In another embodiment, the antibody or antigen binding fragment thereof comprises a light chain variable region having the amino acid sequences set forth in SEQ ID NO:84. In another embodiment, the antibody or antigen binding fragment thereof comprises heavy and light chain variable regions having the amino acid sequences set forth in SEQ ID NO:83 and SEQ ID NO:84, respectively.
- Another exemplary PD-L1 antibody is antibody 4A3 as described herein. In one embodiment, the PD-L1 antibody or antigen binding fragment thereof comprises the heavy and light chain CDRs or variable regions of antibody 4A3.
- the antibody or antigen binding fragment thereof comprises the CDR1, CDR2, and CDR3 domains of the heavy chain variable region of antibody 4A3 having the sequence set forth in SEQ ID NO:85, and the CDR1, CDR2 and CDR3 domains of the light chain variable region of antibody 4A3 having the sequence set forth in SEQ ID NO:86.
- the antibody or antigen binding fragment thereof comprises heavy chain CDR1, CDR2 and CDR3 domains having the sequences set forth in SEQ ID NOs:53, 54, and 55, respectively, or conservative sequence modifications thereof, and light chain CDR1, CDR2 and CDR3 domains having the sequences set forth in SEQ ID NOs:56, 57, and 58, respectively, or conservative sequence modifications thereof.
- the antibody or antigen binding fragment thereof comprises a heavy chain variable region having the amino acid sequence set forth in SEQ ID NO:85. In another embodiment, the antibody or antigen binding fragment thereof comprises a light chain variable region having the amino acid sequence set forth in SEQ ID NO:86. In another embodiment, the antibody or antigen binding fragment thereof comprises heavy and light chain variable regions having the amino acid sequences set forth in SEQ ID NO:85 and SEQ ID NO:86, respectively.
- Another exemplary PD-L1 antibody is antibody 9H9 as described herein. In one embodiment, the PD-L1 antibody or antigen binding fragment thereof comprises the heavy and light chain CDRs or variable regions of antibody 9H9.
- the antibody or antigen binding fragment thereof comprises the CDR1, CDR2, and CDR3 domains of the heavy chain variable region of antibody 9H9 having the sequence set forth in SEQ ID NO:87, and the CDR1, CDR2 and CDR3 domains of the light chain variable region of antibody 9H9 having the sequence set forth in SEQ ID NO:88.
- the antibody or antigen binding fragment thereof comprises heavy chain CDR1, CDR2 and CDR3 domains having the sequences set forth in SEQ ID NOs:59, 60, and 61, respectively, or conservative sequence modifications thereof, and light chain CDR1, CDR2 and CDR3 domains having the sequences set forth in SEQ ID NOs:62, 63, and 64, respectively, or conservative sequence modifications thereof.
- the antibody or antigen binding fragment thereof comprises a heavy chain variable region having the amino acid sequence set forth in SEQ ID NO:87. In another embodiment, the antibody or antigen binding fragment thereof comprises a light chain variable region having the amino acid sequence set forth in SEQ ID NO:88. In another embodiment, the antibody or antigen binding fragment thereof comprises heavy and light chain variable regions having the amino acid sequences set forth in SEQ ID NO:87 and SEQ ID NO:88, respectively.
- the antibody sequences can also be consensus sequences of several antibodies.
- the PD-L1 antigen binding fragment comprises a heavy chain variable region CDR1 comprising an amino acid sequence selected from the consensus sequence: (T,S)(S,Y,H)WMS (SEQ ID NO:167).
- the PD-L1 antigen binding fragment comprises a heavy chain variable region CDR2 comprising SEQ ID NO:168. In another embodiment, the PD-L1 antigen binding fragment comprises a heavy chain variable region CDR3 comprising SEQ ID NO:169. In another embodiment, the PD- L1 antigen binding fragment comprises a light chain variable region CDR1 comprising SEQ ID NO:170. In another embodiment, the PD-L1 antigen binding fragment comprises a light chain variable region CDR2 comprising SEQ ID NO:171. In another embodiment, the PD- L1 antigen binding fragment comprises a light chain variable region CDR3 comprising SEQ ID NO:172.
- Sequences substantially identical to the PD-L1 antibodies and antigen binding fragments thereof described herein are also encompassed by the invention.
- the PD-L1 antigen binding fragment comprises a heavy chain variable region comprising SEQ ID NO:77, SEQ ID NO:79, SEQ ID NO:81, SEQ ID NO:83, SEQ ID NO:85, SEQ ID NO:87, or a sequence at least 90% identical thereto (e.g., at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the aforementioned sequences).
- the PD-L1 antigen binding fragment comprises a light chain variable region comprising SEQ ID NO:78, SEQ ID NO:80, SEQ ID NO:82, SEQ ID NO:84, SEQ ID NO:86, SEQ ID NO:88 or a sequence at least 90% identical thereto (e.g., at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the aforementioned sequences).
- the PD-L1 antigen binding fragment comprises a heavy chain variable region comprising SEQ ID NO:77 and a light chain variable region comprising SEQ ID NO:78 or sequences at least 90% identical thereto (e.g., at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the aforementioned sequences).
- the PD-L1 antigen binding fragment comprises a heavy chain variable region comprising SEQ ID NO:79 and a light chain variable region comprising SEQ ID NO:80 or sequences at least 90% identical thereto (e.g., at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the aforementioned sequences).
- the PD-L1 antigen binding fragment comprises a heavy chain variable region comprising SEQ ID NO:81 and a light chain variable region comprising SEQ ID NO:82 or sequences at least 90% identical thereto (e.g., at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the aforementioned sequences).
- the PD-L1 antigen binding fragment comprises a heavy chain variable region comprising SEQ ID NO:83 and a light chain variable region comprising SEQ ID NO:84 or sequences at least 90% identical thereto (e.g., at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the aforementioned sequences).
- the PD-L1 antigen binding fragment comprises a heavy chain variable region comprising SEQ ID NO:85 and a light chain variable region comprising SEQ ID NO:86 or sequences at least 90% identical thereto (e.g., at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the aforementioned sequences).
- the PD-L1 antigen binding fragment comprises a heavy chain variable region comprising SEQ ID NO:87 and a light chain variable region comprising SEQ ID NO:88 or sequences at least 90% identical thereto (e.g., at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the aforementioned sequences).
- Other exemplary antibodies include PD-L1 antibodies and antigen binding fragments thereof that compete for binding with any of the PD-L1 antibodies or antigen binding fragments thereof as described herein, or that bind the same epitope as any of the PD-L1 antibodies or antigen binding fragments thereof as described herein.
- the PD-L1 antibody or antigen binding fragment thereof competes for binding to PD-L1 with antibody 7H7 (or an antibody having the heavy and light chain CDRs and/or heavy and light chain variable region sequences corresponding to antibody 7H7). In another embodiment, the PD-L1 antibody or antigen binding fragment thereof binds to the same epitope on PD-L1 as antibody 7H7 (or an antibody having the heavy and light chain CDRs and/or heavy and light chain variable region sequences corresponding to antibody 7H7).
- the PD-L1 antibody or antigen binding fragment thereof competes for binding to PD-L1 with antibody 1B3 (or an antibody having the heavy and light chain CDRs and/or heavy and light chain variable region sequences corresponding to antibody 1B3). In another embodiment, the PD-L1 antibody or antigen binding fragment thereof binds to the same epitope on PD-L1 as antibody 1B3 (or an antibody having the heavy and light chain CDRs and/or heavy and light chain variable region sequences corresponding to antibody 1B3).
- the PD-L1 antibody or antigen binding fragment thereof competes for binding to PD-L1 with antibody 3B6 (or an antibody having the heavy and light chain CDRs and/or heavy and light chain variable region sequences corresponding to antibody 3B6).
- the PD-L1 antibody or antigen binding fragment thereof binds to the same epitope on PD-L1 as antibody 3B6 (or an antibody having the heavy and light chain CDRs and/or heavy and light chain variable region sequences corresponding to antibody 3B6).
- the PD-L1 antibody or antigen binding fragment thereof competes for binding to PD-L1 with antibody 8B1 (or an antibody having the heavy and light chain CDRs and/or heavy and light chain variable region sequences corresponding to antibody 8B1). In another embodiment, the PD-L1 antibody or antigen binding fragment thereof binds to the same epitope on PD-L1 as antibody 8B1 (or an antibody having the heavy and light chain CDRs and/or heavy and light chain variable region sequences corresponding to antibody 8B1).
- the PD-L1 antibody or antigen binding fragment thereof competes for binding to PD-L1 with antibody 4A3 (or an antibody having the heavy and light chain CDRs and/or heavy and light chain variable region sequences corresponding to antibody 4A3).
- the PD-L1 antibody or antigen binding fragment thereof binds to the same epitope on PD-L1 as antibody 4A3 (or an antibody having the heavy and light chain CDRs and/or heavy and light chain variable region sequences corresponding to antibody 4A3).
- the PD-L1 antibody or antigen binding fragment thereof competes for binding to PD-L1 with antibody 9H9 (or an antibody having the heavy and light chain CDRs and/or heavy and light chain variable region sequences corresponding to antibody 9H9).
- the PD-L1 antibody or antigen binding fragment thereof binds to the same epitope on PD-L1 as antibody 9H9 (or an antibody having the heavy and light chain CDRs and/or heavy and light chain variable region sequences corresponding to antibody 9H9).
- the PD-L1 antigen binding fragment is an PD-L1 antibody, or antigen binding fragment thereof.
- the PD-L1 antibody, or antigen binding fragment thereof comprises heavy chain variable region CDR1, CDR2 and CDR3 as set forth in SEQ ID NOs:29, 30, and 31, respectively, and light chain variable region CDR1, CDR2 and CDR3 as set forth in SEQ ID NOs:32, 33, and 34, respectively.
- the PD-L1 antibody, or antigen binding fragment thereof comprises a heavy chain variable region comprising SEQ ID NO:77 and a light chain variable region comprising SEQ ID NO:78 or sequences at least 90% identical thereto (e.g., at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the aforementioned sequences).
- the PD-L1 antibody, or antigen binding fragment thereof comprises heavy chain variable region CDR1, CDR2 and CDR3 as set forth in SEQ ID NOs:35, 36, and 37, respectively, and light chain variable region CDR1, CDR2 and CDR3 as set forth in SEQ ID NOs:38, 39, and 40, respectively.
- the PD-L1 antibody, or antigen binding fragment thereof comprises a heavy chain variable region comprising SEQ ID NO:79 and a light chain variable region comprising SEQ ID NO:80 or sequences at least 90% identical thereto (e.g., at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the aforementioned sequences).
- the PD-L1 antibody, or antigen binding fragment thereof comprises heavy chain variable region CDR1, CDR2 and CDR3 as set forth in SEQ ID NOs:41, 42, and 43, respectively, and light chain variable region CDR1, CDR2 and CDR3 as set forth in SEQ ID NOs:44, 45, and 46, respectively.
- the PD-L1 antibody, or antigen binding fragment thereof comprises a heavy chain variable region comprising SEQ ID NO:81 and a light chain variable region comprising SEQ ID NO:82 or sequences at least 90% identical thereto (e.g., at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the aforementioned sequences).
- the PD-L1 antibody, or antigen binding fragment thereof comprises heavy chain variable region CDR1, CDR2 and CDR3 as set forth in SEQ ID NOs:47, 48, and 49, respectively, and light chain variable region CDR1, CDR2 and CDR3 as set forth in SEQ ID NOs:50, 51, and 52, respectively.
- the PD-L1 antibody, or antigen binding fragment thereof comprises a heavy chain variable region comprising SEQ ID NO:83 and a light chain variable region comprising SEQ ID NO:84 or sequences at least 90% identical thereto (e.g., at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the aforementioned sequences).
- the PD-L1 antibody, or antigen binding fragment thereof comprises heavy chain variable region CDR1, CDR2 and CDR3 as set forth in SEQ ID NOs:53, 54, and 55, respectively, and light chain variable region CDR1, CDR2 and CDR3 as set forth in SEQ ID NOs:56, 57, and 58, respectively.
- the PD-L1 antibody, or antigen binding fragment thereof comprises a heavy chain variable region comprising SEQ ID NO:85 and a light chain variable region comprising SEQ ID NO:86 or sequences at least 90% identical thereto (e.g., at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the aforementioned sequences).
- the PD-L1 antibody, or antigen binding fragment thereof comprises heavy chain variable region CDR1, CDR2 and CDR3 as set forth in SEQ ID NOs:59, 60, and 61, respectively, and light chain variable region CDR1, CDR2 and CDR3 as set forth in SEQ ID NOs:62, 63, and 64, respectively.
- the PD-L1 antibody, or antigen binding fragment thereof comprises a heavy chain variable region comprising SEQ ID NO:87 and a light chain variable region comprising SEQ ID NO:88 or sequences at least 90% identical thereto (e.g., at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the aforementioned sequences).
- the PD-L1 antibody, or antigen binding fragment thereof has one or more of the following functional features: (a) blocks binding of PD1 to PD-L1 (e.g., partially or completely), (b) induces NFAT pathway activation, and/or (c) induces a mixed lymphocyte reaction. D.
- binding agents for use with the ILT4 antibodies or antigen binding fragments of the present invention include, e.g., binding agents which bind to an immune checkpoint molecule (such as PD-1, PD-L1 CTLA-4, LAG-3, TIGIT, TIM-3, VISTA, AXL, ILT2, or ILT3), an immune costimulatory molecule (such as CD27, CD40, 4-1BB, OX40, or GITR), or a tumor antigen (such as HER2, EGFR, ErB3, or CD24).
- an immune checkpoint molecule such as PD-1, PD-L1 CTLA-4, LAG-3, TIGIT, TIM-3, VISTA, AXL, ILT2, or ILT3
- an immune costimulatory molecule such as CD27, CD40, 4-1BB, OX40, or GITR
- a tumor antigen such as HER2, EGFR, ErB3, or CD24.
- Exemplary binding agents include antibodies or antigen binding fragments thereof which bind to human PD-1, e.g., a PD-1 antagonist.
- An exemplary PD-1 antibody is nivolumab (referred to as 5C4 in WO 2006/121168; also known as BMS-936558, MDX-1106 or ONO-4538).
- Particular exemplary binding agents include PD-L1 and PD-1 antibodies (or antigen binding fragments thereof) such as durvalumab, pembrolizumab (Keytruda®), cemiplimab (Libtaylo®), avelumab (Bavencio®), durvalumab (Imfinzi®), and atezolizumab (Tecentriq®).
- bispecific and Multispecific Constructs comprising an ILT4 antibody or antigen binding fragment thereof linked to a second binding agent, e.g., a second binding agent that binds to an immune checkpoint molecule (such as PD-1, PD-L1 CTLA-4, LAG-3 TIGIT, TIM-3, VISTA, AXL, ILT2, or ILT3), an immune costimulatory molecule (such as CD27, CD40, 4-1BB, OX40, or GITR), or a tumor antigen (such as HER2, EGFR, ErB3, or CD24), for example, a bispecific construct comprising an ILT4 antibody (or antigen binding fragment thereof) linked to a PD-L1 or PD-1 antibody (or antigen binding fragment thereof).
- a second binding agent that binds to an immune checkpoint molecule (such as PD-1, PD-L1 CTLA-4, LAG-3 TIGIT, TIM-3, VISTA, AXL, ILT2, or ILT3), an
- bispecific constructs linked to one or more additional binding agent to form multispecific constructs are described.
- a “bispecific” or “bifunctional” construct is an artificial hybrid having two different binding domain (e.g., heavy/light chain) pairs and two different binding sites.
- Bispecific constructs can be produced by a variety of methods including fusion of hybridomas or linking of Fab' fragments. See, e.g., Songsivilai & Lachmann, Clin. Exp. Immunol.79:315-321 (1990); Kostelny et al., J. Immunol.
- the term “linked” refers to the association of two or more molecules. The linkage can be covalent or non-covalent.
- the linkage also can be genetic (i.e., recombinantly fused). Such linkages can be achieved using a wide variety of art recognized techniques, such as chemical conjugation and recombinant protein production.
- suitable reagents and methods are known in the art for coupling two or more moieties, in particular two or more antibodies, or fragments thereof, together.
- a variety of coupling or crosslinking agents are commercially available and can be used to conjugate the ILT4 antibody or antigen binding fragment thereof and PD-L1 or PD-1 antibody or antigen binding fragment thereof.
- Non-limiting examples include Sulfo-SMCC, protein A, carboiimide, dimaleimide, dithio-bis-nitrobenzoic acid (DTNB), and N- succinimidyl-3-(2-pyridyldithio) propionate (SPDP).
- Sulfo-SMCC, SPDP and DTNB are preferred agents, with Sulfo-SMCC being particularly preferred.
- Other suitable procedures for crosslinking components (e.g., antibodies or antigen binding fragments thereof) with cross-linking agents are known in the art. See e.g., Karpovsky, B. et al., (1984) J. Exp. Med. 160:1686; Liu, M. A. et al., (1985) Proc. Natl.
- nucleic acid molecules encoding the ILT4 antibody or antigen binding fragment thereof can be inserted into an appropriate expression vector using standard recombinant DNA techniques.
- a nucleic acid molecule(s) encoding the PD-L1 or PD-1 antibody or antigen binding fragment thereof also can be inserted into the same expression vector, such that it is operatively linked (e.g., in-frame cloning) to the ILT4 antibody or antigen binding fragment thereof, thereby resulting in an expression vector that encodes a fusion protein that is the bispecific construct.
- the PD-L1 or PD-1 antibody or antigen binding fragment thereof is operatively linked to the C-terminal region of the heavy chain of the ILT4 antibody or antigen binding fragment thereof.
- Other suitable expression vectors and cloning strategies for preparing the bispecific constructs described herein are known in the art.
- the coding regions of the antibodies or antigen binding fragments thereof are combined with cloned promoter, leader sequence, translation initiation, leader sequence, constant region, 3’ untranslated, polyadenylation, and transcription termination, sequences to form expression vector constructs.
- These constructs can be used to express, for example, full length human IgG 1 ⁇ or IgG4 ⁇ antibodies.
- Fully human, humanized and chimeric antibodies used in the bispecific constructs described herein also include IgG2, IgG3, IgE, IgA, IgM, and IgD antibodies. Similar plasmids can be constructed for expression of other heavy chain isotypes, or for expression of antibodies comprising lambda light chains.
- the bispecific construct can be expressed recombinantly in a host cell using standard transfection methods.
- nucleic acid encoding the bispecific construct can be ligated into an expression vector, such as a eukaryotic expression plasmid, such as used by GS gene expression system disclosed in WO 87/04462, WO 89/01036 and EP 338 841 or other expression systems well known in the art.
- the purified plasmid with the cloned bispecific construct gene can be introduced in eukaryotic host cells, such as CHO-cells or NSO-cells or alternatively other eukaryotic cells like a plant derived cells, fungi or yeast cells.
- the method used to introduce these genes could be methods described in the art, such as electroporation, lipofectin, lipofectamine or other.
- cells expressing the bispecific construct can be identified and selected. These cells represent the transfectomas that can then be amplified for their expression level and upscaled to produce bispecific constructs.
- these cloned bispecific constructs can be expressed in other expression systems, such as E. coli or in complete organisms or can be synthetically expressed.
- Recombinant bispecific constructs can be isolated and purified from these culture supernatants and/or cells.
- a bispecific construct of the invention can be isolated and purified using one or more methodologies for protein purification well established in the art.
- Preferred methods for isolation and purification include, but are not limited to, gel filtration chromatography, affinity chromatography, anion-exchange chromatography and the like.
- a particularly preferred method is gel filtration chromatography, e.g., using a Superdex 200 column.
- Isolated and purified bispecific constructs can be evaluated using standard methods such as SDS-PAGE analysis. Accordingly, in one embodiment, the ILT4 antibody or antigen binding fragment thereof is genetically fused to a PD-L1 or PD-1 antibody or antigen binding fragment thereof.
- the ILT4 antibody or antigen binding fragment thereof and the PD- L1 antibody or antigen binding fragment thereof are chemically conjugated.
- the PD-L1 or PD-1 antibody or antigen binding fragment thereof further comprises a human IgG1 constant domain.
- the ILT4 antibody or antigen binding fragment thereof is linked to the C-terminus of the heavy chain of the PD-L1 or PD-1 antibody or antigen binding fragment thereof.
- the ILT4 antigen binding fragment thereof is a scFv.
- the ILT4 antibody or antigen binding fragment thereof further comprises a human IgG1 constant domain.
- the PD-L1 or PD-1 antibody or antigen binding fragment thereof is linked to the C-terminus of the heavy chain of the ILT4 antibody or antigen binding fragment thereof.
- the PD-L1 or PD-1 antigen binding fragment thereof is a scFv.
- the bispecific and multispecific constructs of the present invention comprise a modified human Fc domain (e.g., a modified IgG1 Fc domain), for example, (a) a modified human IgG1 Fc domain which comprises non-naturally occurring amino acids 234A, 235Q and 322Q as numbered by the EU index as set forth in Kabat, (b) a modified human IgG1 Fc domain which comprises non-naturally occurring amino acids 252Y, 254T and 256E as numbered by the EU index as set forth in Kabat, and/or (c) a modified human IgG1 Fc domain which comprises non-naturally occurring amino acids 234A, 235Q and 322Q as numbered by the EU index as set forth in Kabat.
- Exemplary bispecific constructs are set forth below in Tables 2 and 3, wherein the antibody or antigen binding fragments thereof are defined by CDR sequences (Table 2) or variable region sequences (Table 3). Table 2: Exemplary Bispecific Constructs (CDRs)
- Bispecific and multispecific constructs comprising sequences substantially identical to the aforementioned ILT4 and PD-L1 sequences (i.e., CDR and variable region sequences) also are provided herein (e.g., sequences having conservative sequence modifications and/or sequences at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the aforementioned sequences).
- the bispecific and multispecific constructs exhibit one or more of the following properties: a.
- ILT4 ligand e.g., HLA-G ligand binding to human ILT4; b. enhancing or increasing cytokine or chemokine release by human macrophages; c. potentiating the activation effects of LPS and IFN ⁇ on macrophages; d. promoting M1 macrophage polarization; e. binding to human ILT4 with an equilibrium dissociation constant Kd of 10 -9 M or less, or alternatively, an equilibrium association constant Ka of 10 +9 M -1 or greater; f. lack of cross-reactivity with other ILT family members; g. cross-reactivity with cynomolgus ILT4; and / or h. inhibiting tumor cells that express ILT4.
- compositions e.g., a composition comprising one or a combination of any of the antibodies, or antigen binding fragments thereof, the bispecific constructs, or the multispecific constructs described herein, formulated together with a carrier (e.g., a pharmaceutically acceptable carrier).
- a carrier e.g., a pharmaceutically acceptable carrier
- the terms “carrier” and “pharmaceutically acceptable carrier” includes any and all solvents, salts, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible.
- the carrier is suitable for intravenous, intramuscular, subcutaneous, parenteral, spinal or epidermal administration (e.g., by injection or infusion).
- the active compound i.e., any of the antibodies, or antigen binding fragments thereof, the bispecific constructs, or the multispecific constructs described herein
- the active compound may be coated in a material to protect the compound from the action of acids and other natural conditions that may inactivate the compound.
- adjuvants which may be used with the antibodies, or antigen binding fragments thereof, the bispecific constructs, or the multispecific constructs described here include, but are not limited to : Freund's Incomplete Adjuvant and Complete Adjuvant (Difco Laboratories, Detroit, Mich.); Merck Adjuvant 65 (Merck and Company, Inc., Rahway, N.J.); AS-2 (SmithKline Beecham, Philadelphia, Pa.); aluminum salts such as aluminum hydroxide gel (alum) or aluminum phosphate; salts of calcium, iron or zinc; an insoluble suspension of acylated tyrosine; acylated sugars; cationically or anionically derivatised polysaccharides; polyphosphazenes; biodegradable microspheres; cytokines, such as GM-CSF, interleukin-2, - 7, -12, and other like factors; 3D-MPL; CpG oligonucleotide; and monophosphoryl lipid A, for example 3-de-O
- MPL adjuvants are available from Corixa Corporation (Seattle, Wash; see, for example, U.S. Pat. Nos.4,436,727; 4,877,611; 4,866,034 and 4,912,094).
- CpG-containing oligonucleotides in which the CpG dinucleotide is unmethylated
- Immunostimulatory DNA sequences are also described, for example, by Sato et al., Science 273:352, 1996.
- adjuvants include, for example, saponins, such as Quil A, or derivatives thereof, including QS21 and QS7 (Aquila Biopharmaceuticals Inc., Framingham, Mass.); Escin; Digitonin; or Gypsophila or Chenopodium quinoa saponins; Montanide ISA 720 (Seppic, France); SAF (Chiron, California, United States); ISCOMS (CSL), MF-59 (Chiron); the SBAS series of adjuvants (e.g., SBAS-2 or SBAS-4, available from SmithKline Beecham, Rixensart, Belgium); Detox (Enhanzyn TM ) (Corixa, Hamilton, Mont.); RC-529 (Corixa, Hamilton, Mont.) and other aminoalkyl glucosaminide 4-phosphates (AGPs); polyoxyethylene ether adjuvants such as those described in WO 99/52549A1; synthetic imidazoquinolines such as imiquimod [
- cytokine, chemokine and co-stimulatory molecules as either protein or peptide, including for example pro-inflammatory cytokines such as Interferon, GM-CSF, IL-1 alpha, IL-1 beta, TGF-alpha and TGF-beta, Th1 inducers such as interferon gamma, IL-2, IL-12, IL- 15, IL-18 and IL-21, Th2 inducers such as IL-4, IL-5, IL-6, IL-10 and IL-13 and other chemokine and co-stimulatory genes such as MCP-1, MIP-1 alpha, MIP-1 beta, RANTES, TCA-3, CD80, CD86 and CD40L; immunostimulatory agents targeting ligands such as CTLA-4 and L-selectin, apoptosis stimulating proteins and peptides such as Fas; synthetic lipid based adjuvants, such as vaxfectin, (
- a “pharmaceutically acceptable salt” refers to a salt that retains the desired biological activity of the parent compound and does not impart any undesired toxicological effects (see e.g., Berge, S.M., et al. (1977) J. Pharm. Sci.66:1-19). Examples of such salts include acid addition salts and base addition salts.
- Acid addition salts include those derived from nontoxic inorganic acids, such as hydrochloric, nitric, phosphoric, sulfuric, hydrobromic, hydroiodic, phosphorous and the like, as well as from nontoxic organic acids such as aliphatic mono- and dicarboxylic acids, phenyl-substituted alkanoic acids, hydroxy alkanoic acids, aromatic acids, aliphatic and aromatic sulfonic acids and the like.
- nontoxic inorganic acids such as hydrochloric, nitric, phosphoric, sulfuric, hydrobromic, hydroiodic, phosphorous and the like
- nontoxic organic acids such as aliphatic mono- and dicarboxylic acids, phenyl-substituted alkanoic acids, hydroxy alkanoic acids, aromatic acids, aliphatic and aromatic sulfonic acids and the like.
- Base addition salts include those derived from alkaline earth metals, such as sodium, potassium, magnesium, calcium and the like, as well as from nontoxic organic amines, such as N,N'-dibenzylethylenediamine, N- methylglucamine, chloroprocaine, choline, diethanolamine, ethylenediamine, procaine and the like.
- a composition of the present invention can be administered by a variety of methods known in the art. As will be appreciated by the skilled artisan, the route and/or mode of administration will vary depending upon the desired results.
- the active compounds can be prepared with carriers that will protect the compound against rapid release, such as a controlled release formulation, including implants, transdermal patches, and microencapsulated delivery systems.
- Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid. Many methods for the preparation of such formulations are patented or generally known to those skilled in the art. See, e.g., Sustained and Controlled Release Drug Delivery Systems, J.R. Robinson, ed., Marcel Dekker, Inc., New York, 1978.
- To administer a compound of the invention by certain routes of administration it may be necessary to coat the compound with, or co-administer the compound with, a material to prevent its inactivation.
- the compound may be administered to a subject in an appropriate carrier, for example, liposomes, or a diluent.
- Acceptable diluents include saline and aqueous buffer solutions.
- Liposomes include water-in-oil-in-water CGF emulsions as well as conventional liposomes (Strejan et al. (1984) J. Neuroimmunol.7:27).
- Carriers include sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion.
- the use of such media and agents for pharmaceutically active substances is known in the art. Except insofar as any conventional media or agent is incompatible with the active compound, use thereof in the pharmaceutical compositions of the invention is contemplated. Supplementary active compounds can also be incorporated into the compositions.
- compositions typically must be sterile and stable under the conditions of manufacture and storage.
- the composition can be formulated as a solution, microemulsion, liposome, or other ordered structure suitable to high drug concentration.
- the carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), and suitable mixtures thereof.
- the proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants.
- isotonic agents for example, sugars, polyalcohols such as mannitol, sorbitol, or sodium chloride in the composition.
- Prolonged absorption of the injectable compositions can be brought about by including in the composition an agent that delays absorption, for example, monostearate salts and gelatin.
- Sterile injectable solutions can be prepared by incorporating the active compound in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by sterilization microfiltration.
- dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above.
- the preferred methods of preparation are vacuum drying and freeze-drying (lyophilization) that yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
- Dosage regimens are adjusted to provide the optimum desired response (e.g., a therapeutic response). For example, a single bolus may be administered, several divided doses may be administered over time or the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation.
- the antibodies of the invention may be administered once or twice weekly by subcutaneous or intramuscular injection or once or twice monthly by subcutaneous or intramuscular injection.
- Dosage unit form refers to physically discrete units suited as unitary dosages for the subjects to be treated; each unit contains a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier.
- the specification for the dosage unit forms of the invention are dictated by and directly dependent on (a) the unique characteristics of the active compound and the particular therapeutic effect to be achieved, and (b) the limitations inherent in the art of compounding such an active compound for the treatment of sensitivity in individuals.
- antioxidants examples include: (1) water soluble antioxidants, such as ascorbic acid, cysteine hydrochloride, sodium bisulfate, sodium metabisulfite, sodium sulfite and the like; (2) oil-soluble antioxidants, such as ascorbyl palmitate, butylated hydroxyanisole (BHA), butylated hydroxytoluene (BHT), lecithin, propyl gallate, alpha-tocopherol, and the like; and (3) metal chelating agents, such as citric acid, ethylenediamine tetraacetic acid (EDTA), sorbitol, tartaric acid, phosphoric acid, and the like.
- water soluble antioxidants such as ascorbic acid, cysteine hydrochloride, sodium bisulfate, sodium metabisulfite, sodium sulfite and the like
- oil-soluble antioxidants such as ascorbyl palmitate, butylated hydroxyanisole (BHA), butylated hydroxytoluene (BHT), le
- formulations of the present invention include those suitable for oral, nasal, topical (including buccal and sublingual), rectal, vaginal and/or parenteral administration.
- the formulations may conveniently be presented in unit dosage form and may be prepared by any methods known in the art of pharmacy.
- the amount of active ingredient which can be combined with a carrier material to produce a single dosage form will vary depending upon the subject being treated, and the particular mode of administration.
- the amount of active ingredient which can be combined with a carrier material to produce a single dosage form will generally be that amount of the composition which produces a therapeutic effect.
- compositions of this invention which are suitable for vaginal administration also include pessaries, tampons, creams, gels, pastes, foams or spray formulations containing such carriers as are known in the art to be appropriate.
- Dosage forms for the topical or transdermal administration of compositions of this invention include powders, sprays, ointments, pastes, creams, lotions, gels, solutions, patches and inhalants.
- parenteral administration and “administered parenterally” as used herein means modes of administration other than enteral and topical administration, usually by injection, and includes, without limitation, intravenous, intramuscular, intraarterial, intrathecal, intracapsular, intraorbital, intracardiac, intradermal, intraperitoneal, transtracheal, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal, epidural and intrasternal injection and infusion.
- aqueous and nonaqueous carriers examples include water, ethanol, polyols (such as glycerol, propylene glycol, polyethylene glycol, and the like), and suitable mixtures thereof, vegetable oils, such as olive oil, and injectable organic esters, such as ethyl oleate.
- polyols such as glycerol, propylene glycol, polyethylene glycol, and the like
- vegetable oils such as olive oil
- injectable organic esters such as ethyl oleate.
- Proper fluidity can be maintained, for example, by the use of coating materials, such as lecithin, by the maintenance of the required particle size in the case of dispersions, and by the use of surfactants.
- These compositions may also contain adjuvants such as preservatives, wetting agents, emulsifying agents and dispersing agents.
- Prevention of presence of microorganisms may be ensured both by sterilization procedures, supra, and by the inclusion of various antibacterial and antifungal agents, for example, paraben, chlorobutanol, phenol sorbic acid, and the like. It may also be desirable to include isotonic agents, such as sugars, sodium chloride, and the like into the compositions. In addition, prolonged absorption of the injectable pharmaceutical form may be brought about by the inclusion of agents that delay absorption such as aluminum monostearate and gelatin.
- the compounds of the present invention When the compounds of the present invention are administered as pharmaceuticals, to humans and animals, they can be given alone or as a pharmaceutical composition containing, for example, 0.001 to 90% (more preferably, 0.005 to 70%, such as 0.01 to 30%) of active ingredient in combination with a pharmaceutically acceptable carrier. Regardless of the route of administration selected, the compounds of the present invention, which may be used in a suitable hydrated form, and/or the pharmaceutical compositions of the present invention, are formulated into pharmaceutically acceptable dosage forms by conventional methods known to those of skill in the art. Actual dosage levels of the active ingredients in the pharmaceutical compositions of the present invention may be varied so as to obtain an amount of the active ingredient that is effective to achieve the desired therapeutic response for a particular patient, composition, and mode of administration, without being toxic to the patient.
- the selected dosage level will depend upon a variety of pharmacokinetic factors including the activity of the particular compositions of the present invention employed, or the ester, salt or amide thereof, the route of administration, the time of administration, the rate of excretion of the particular compound being employed, the duration of the treatment, other drugs, compounds and/or materials used in combination with the particular compositions employed, the age, sex, weight, condition, general health and prior medical history of the patient being treated, and like factors well known in the medical arts.
- a physician or veterinarian having ordinary skill in the art can readily determine and prescribe the effective amount of the pharmaceutical composition required.
- a suitable daily dose of a composition of the invention will be that amount of the compound that is the lowest dose effective to produce a therapeutic effect.
- Such an effective dose will generally depend upon the factors described above. It is preferred that administration be intravenous, intramuscular, intraperitoneal, or subcutaneous, preferably administered proximal to the site of the target.
- the effective daily dose of a therapeutic composition may be administered as two, three, four, five, six or more sub- doses administered separately at appropriate intervals throughout the day, optionally, in unit dosage forms.
- compositions can be administered with medical devices known in the art.
- a therapeutic composition of the invention can be administered with a needleless hypodermic injection device, such as the devices disclosed in U.S. Patent Nos.5,399,163, 5,383,851, 5,312,335, 5,064,413, 4,941,880, 4,790,824, or 4,596,556.
- a needleless hypodermic injection device such as the devices disclosed in U.S. Patent Nos.5,399,163, 5,383,851, 5,312,335, 5,064,413, 4,941,880, 4,790,824, or 4,596,556.
- Examples of well-known implants and modules useful in the present invention include: U.S. Patent No.4,487,603, which discloses an implantable micro-infusion pump for dispensing medication at a controlled rate; U.S.
- Patent No.4,486,194 which discloses a therapeutic device for administering medicants through the skin
- U.S. Patent No.4,447,233 which discloses a medication infusion pump for delivering medication at a precise infusion rate
- U.S. Patent No.4,447,224 which discloses a variable flow implantable infusion apparatus for continuous drug delivery
- U.S. Patent No.4,439,196 which discloses an osmotic drug delivery system having multi-chamber compartments
- U.S. Patent No.4,475,196 which discloses an osmotic drug delivery system.
- Many other such implants, delivery systems, and modules are known to those skilled in the art.
- the antibodies of the invention can be formulated to ensure proper distribution in vivo.
- the blood-brain barrier excludes many highly hydrophilic compounds.
- the therapeutic compounds of the invention cross the BBB (if desired)
- they can be formulated, for example, in liposomes.
- liposomes For methods of manufacturing liposomes, see, e.g., U.S. Patents 4,522,811; 5,374,548; and 5,399,331.
- the liposomes may comprise one or more moieties that are selectively transported into specific cells or organs, thus enhance targeted drug delivery (see, e.g., V.V. Ranade (1989) J. Clin. Pharmacol.29:685).
- Exemplary targeting moieties include folate or biotin (see, e.g., U.S.
- Patent 5,416,016 to Low et al. mannosides (Umezawa et al., (1988) Biochem. Biophys. Res. Commun.153:1038); antibodies (P.G. Bloeman et al. (1995) FEBS Lett.357:140; M. Owais et al. (1995) Antimicrob. Agents Chemother.39:180); surfactant protein A receptor (Briscoe et al. (1995) Am. J. Physiol.1233:134), different species of which may comprise the formulations of the inventions, as well as components of the invented molecules; p120 (Schreier et al. (1994) J. Biol.
- the therapeutic compounds of the invention are formulated in liposomes; in a more preferred embodiment, the liposomes include a targeting moiety. In a most preferred embodiment, the therapeutic compounds in the liposomes are delivered by bolus injection to a site proximal to the tumor or infection.
- the composition must be fluid to the extent that easy syringability exists.
- a therapeutically effective amount of a therapeutic compound can decrease tumor size, or otherwise ameliorate symptoms in a subject.
- One of ordinary skill in the art would be able to determine such amounts based on such factors as the subject's size, the severity of the subject's symptoms, and the particular composition or route of administration selected.
- the composition must be sterile and fluid to the extent that the composition is deliverable by syringe.
- the carrier can be an isotonic buffered saline solution, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyetheylene glycol, and the like), and suitable mixtures thereof.
- Proper fluidity can be maintained, for example, by use of coating such as lecithin, by maintenance of required particle size in the case of dispersion and by use of surfactants.
- isotonic agents for example, sugars, polyalcohols such as mannitol or sorbitol, and sodium chloride in the composition.
- nucleic Acids Also provided herein are isolated nucleic acid molecules encoding the antibodies, or antigen binding fragments thereof, bispecific constructs, and multispecific constructs, as well as expression vectors comprising such nucleic acids and host cells comprising such expression vectors. In one embodiment, a nucleic acid molecule coding for any of the antibodies, or antigen fragments thereof, bispecific constructs, or multispecific constructs described herein is provided.
- nucleic acid molecule is in the form of an expression vector. In another embodiment, the nucleic acid molecule is in the form of an expression vector which expresses the antibody, or antigen fragment thereof, bispecific construct, or the multispecific construct when administered to a subject in vivo.
- the nucleic acid molecule comprises a nucleotide sequence encoding an antibody variable region, wherein the antibody variable region comprises the amino acid sequence depicted in SEQ ID NO:9, 10, 19, 20, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, or an amino acid sequence at least 90% identical thereto (e.g., at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to one or more of the aforementioned sequences).
- the nucleic acid molecule comprises a nucleotide sequence encoding an antibody chain, wherein the chain comprises the amino acid sequence depicted in SEQ ID NO:25, 26, 27, 28, or an amino acid sequence at least 90% identical thereto (e.g., at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to one or more of the aforementioned sequences).
- the nucleic acid molecule comprises a nucleotide sequence encoding heavy and light chain variable regions of an antibody, wherein the heavy and light chain variable regions respectively comprise the amino acid sequences depicted in SEQ ID NOs:9 and 10, SEQ ID NOs:19 and 20, or amino acids sequences at least 90% identical to the aforementioned sequences (e.g., at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical).
- the nucleic acid molecule comprises a nucleotide sequence encoding heavy and light chains of an antibody, wherein the heavy and light chains respectively comprise the amino acid sequences depicted in SEQ ID NOs:25 and 26, SEQ ID NOs:27 and 28, or amino acids sequences at least 90% identical to the aforementioned sequences (e.g., at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical).
- vector as used herein, is intended to refer to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked.
- vectors refers to a circular double stranded DNA loop into which additional DNA segments may be ligated.
- viral vector Another type of vector is a viral vector, wherein additional DNA segments may be ligated into the viral genome.
- Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors). Other vectors (e.g., non-episomal mammalian vectors) can be integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome.
- certain vectors are capable of directing the expression of genes to which they are operatively linked.
- recombinant expression vectors Such vectors are referred to herein as “recombinant expression vectors”(or simply, “expression vectors”).
- expression vectors of utility in recombinant DNA techniques are often in the form of plasmids.
- plasmid and “vector” may be used interchangeably as the plasmid is the most commonly used form of vector.
- the invention is intended to include such other forms of expression vectors, such as viral vectors (e.g., replication defective retroviruses, adenoviruses and adeno-associated viruses), which serve equivalent functions.
- the term “recombinant host cell” (or simply “host cell”), as used herein, is intended to refer to a cell into which a recombinant expression vector has been introduced.
- the term “coadministered” as used herein includes any or all of simultaneous, separate, or sequential administration of the antibodies, antigen binding fragments thereof, bispecific constructs, or multispecific constructs described herein with adjuvants and other agents, including administration as part of a dosing regimen.
- the combination therapy can include administering any of the antibodies, antigen binding fragments thereof, bispecific constructs, and/or multispecific constructs described herein with at least one or more additional therapeutic agents, such as anti-inflammatory agents, DMARDs (disease-modifying anti-rheumatic drugs), immunosuppressive agents, chemotherapeutics, radiation therapy, other antibodies, cytotoxins and/or drugs, as well as adjuvants, immunostimulatory agents and/or immunosuppressive agents.
- additional therapeutic agents such as anti-inflammatory agents, DMARDs (disease-modifying anti-rheumatic drugs), immunosuppressive agents, chemotherapeutics, radiation therapy, other antibodies, cytotoxins and/or drugs, as well as adjuvant
- Chemotherapeutic agents suitable for coadministration with the antibodies, antigen binding fragments thereof, bispecific constructs, and/or multispecific constructs described herein in the treatment of tumors include, for example: taxol, cytochalasin B, gramicidin D, ethidium bromide, emetine, mitomycin, etoposide, tenoposide, vincristine, vinblastine, colchicin, doxorubicin, daunorubicin, dihydroxy anthracin dione, mitoxantrone, mithramycin, actinomycin D, 1-dehydrotestosterone, glucocorticoids, procaine, tetracaine, lidocaine, propranolol, and puromycin and analogs or homologs thereof.
- Further agents include, for example, antimetabolites (e.g., methotrexate, 6-mercaptopurine, 6-thioguanine, cytarabine, 5-fluorouracil decarbazine), alkylating agents (e.g., mechlorethamine, thioepa chlorambucil, melphalan, carmustine (BSNU) and lomustine (CCNU), cyclothosphamide, busulfan, dibromomannitol, streptozotocin, mitomycin C, and cis-dichlorodiamine platinum (II) (DDP) cisplatin), anthracyclines (e.g., daunorubicin (formerly daunomycin) and doxorubicin), antibiotics (e.g., dactinomycin (formerly actinomycin), bleomycin, mithramycin, and anthramycin (AMC)), and anti-mitotic agents (e.g., vincri
- agents that delete or inhibit immunosuppressive activities for example, by immune cells (for example regulatory T-cells, NKT cells, macrophages, myeloid-derived suppressor cells, immature or suppressive dendritic cells) or suppressive factors produced by the tumor or host cells in the local microenvironment of the tumor (for example, TGF ⁇ , indoleamine 2,3 dioxygenase – IDO), may also be administered with the binding domains, antibodies, antigen binding fragments thereof, bispecific constructs, and/or multispecific constructs described herein.
- agents include antibodies and small molecule drugs such as IDO inhibitors such as 1 methyl tryptophan or derivatives.
- Suitable agents for coadministration with the antibodies, antigen binding fragments thereof, bispecific constructs, and/or multispecific constructs described herein for treatment of such immune disorders include for example, immunosuppressive agents such as rapamycin, cyclosporin and FK506; anti-TNF agents such as etanercept, adalimumab and infliximab; and steroids.
- Examples of specific natural and synthetic steroids include, for example: aldosterone, beclomethasone, betamethasone, budesonide, cloprednol, cortisone, cortivazol, deoxycortone, desonide, desoximetasone, dexamethasone, difluorocortolone, fluclorolone, flumethasone, flunisolide, fluocinolone, fluocinonide, fluocortin butyl, fluorocortisone, fluorocortolone, fluorometholone, flurandrenolone, fluticasone, halcinonide, hydrocortisone, icomethasone, meprednisone, methylprednisolone, paramethasone, prednisolone, prednisone, tixocortol and triamcinolone.
- Suitable agents for coadministration with the antibodies, antigen binding fragments thereof, bispecific constructs, and/or multispecific constructs described herein for inducement or enhancement of an immune response include, for example, adjuvants and/or immunostimulatory agents, non-limiting examples of which have been disclosed hereinbefore.
- the immunostimulatory agent is a TLR3 agonist, such as Poly IC.
- the term “immunostimulatory agent” includes, but is not limited to, compounds capable of stimulating antigen presenting cells (APCs), such as dendritic cells (DCs) and macrophages.
- suitable immunostimulatory agents for use in the present invention are capable of stimulating APCs, so that the maturation process of the APCs is accelerated, the proliferation of APCs is increased, and/or the recruitment or release of co-stimulatory molecules (e.g., CD80, CD86, ICAM-1, MHC molecules and CCR7) and pro-inflammatory cytokines (e.g., IL-1 ⁇ , IL-6, IL-12, IL-15, and IFN- ⁇ ) is upregulated.
- co-stimulatory molecules e.g., CD80, CD86, ICAM-1, MHC molecules and CCR7
- pro-inflammatory cytokines e.g., IL-1 ⁇ , IL-6, IL-12, IL-15, and IFN- ⁇
- Suitable immunostimulatory agents are also capable of increasing T cell proliferation.
- Such immunostimulatory agents include, but are not be limited to, CD40 ligand; FLT 3 ligand; cytokines, such as IFN- ⁇ , IFN- ⁇ , IFN- ⁇ and IL-2; colony-stimulating factors, such as G-CSF (granulocyte colony-stimulating factor) and GM-CSF (granulocyte-macrophage colony- stimulating factor); an CTLA-4 antibody, PD-1 antibody, 41BB antibody, or OX-40 antibody; LPS (endotoxin); ssRNA; dsRNA; Bacille Calmette-Guerin (BCG); Levamisole hydrochloride; and intravenous immune globulins.
- CD40 ligand such as CD40 ligand
- FLT 3 ligand such as cytokines, such as IFN- ⁇ , IFN- ⁇ , IFN- ⁇ and IL-2
- colony-stimulating factors such as G-CSF (granulocyte colony-stimulating factor) and GM
- an immunostimulatory agant may be a Toll-like Receptor (TLR) agonist.
- the immunostimulatory agent may be a TLR3 agonist such as double-stranded inosine:cytosine polynucleotide (Poly I:C, for example available as AmpligenTM from Hemispherx Bipharma, PA, US or Poly IC:LC from Oncovir) or Poly A:U; a TLR4 agonist such as monophosphoryl lipid A (MPL) or RC-529 (for example as available from GSK, UK); a TLR5 agonist such as flagellin; a TLR7 or TLR8 agonist such as an imidazoquinoline TLR7 or TLR 8 agonist, for example imiquimod (eg AldaraTM) or resiquimod and related imidazoquinoline agents (for example as available from 3M Corporation); or a TLR 9 agonist such as a deoxynucleotide with unmethylated CpG
- Such immunostimulatory agents may be administered simultaneously, separately or sequentially with the antibodies, antigen binding fragments thereof, bispecific constructs, and/or multispecific constructs described herein.
- methods of methods of inducing or enhancing an immune response and methods of treating cancer by administering the bispecific constructs, multispecific constructs, antibodies, or antigen binding fragments thereof, or compositions described herein to a patient in need thereof.
- inducing an immune response and “enhancing an immune response” are used interchangeably and refer the stimulation of an immune response (i.e., either passive or adaptive) to a particular antigen.
- the terms “treat,” “treating,” and “treatment,” as used herein, refer to therapeutic or preventative measures described herein.
- treatment employ administration to a subject, in need of such treatment, a bispecific construct, multispecific construct, antibody, antigen binding fragment thereof, or composition as described herein, for example, a subject in need of an enhanced immune response against a particular antigen or a subject who ultimately may acquire such a disorder, in order to prevent, cure, delay, reduce the severity of, or ameliorate one or more symptoms of the disorder or recurring disorder, or in order to prolong the survival of a subject beyond that expected in the absence of such treatment.
- effective dose or “effective dosage” is defined as an amount sufficient to achieve or at least partially achieve the desired effect.
- therapeutically effective dose is defined as an amount sufficient to cure or at least partially arrest the disease and its complications in a patient already suffering from the disease.
- Amounts effective for this use will depend upon the severity of the disorder being treated and the general state of the patient’s own immune system.
- the term “patient” includes human and other mammalian subjects that receive either prophylactic or therapeutic treatment.
- the term “inhibits growth” is intended to include any measurable decrease in the growth of a cell, e.g., the inhibition of growth of a cell by at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 99%, or 100%.
- methods for inducing or enhancing an immune response (e.g., against an antigen) in a subject comprising administering to the subject any one of the antibodies, or antigen binding fragments thereof, bispecific constructs, multispecific constructs, or the compositions described herein, in an amount effective to induce or enhance an immune response in the subject (e.g., against an antigen).
- methods of for treating cancer in a subject comprising administering to the subject any one of the antibodies, or antigen binding fragments thereof, bispecific constructs, multispecific constructs, or the compositions described herein, in an amount effective to treat the condition or disease.
- methods for treating cancer in a subject comprising administering to the subject any one of the ILT4 antibodies, or antigen binding fragments thereof, described herein in combination with another antibody or antigen binding fragment thereof, e.g., any one of the PD-L1 or PD-1 antibodies, or antigen binding fragments thereof, described herein.
- the ILT4 antibody, or antigen binding fragment thereof, and the PD-L1 or PD-1 antibody, or antigen binding fragment thereof are administered separately.
- the ILT4 antibody, or antigen binding fragment thereof, and the PD-L1 or PD-1 antibody, or antigen binding fragment thereof are administered sequentially.
- the ILT4 antibody, or antigen binding fragment thereof can be administered first followed by (e.g., immediately followed by) administration of the PD-L1 or PD-1 antibody, or antigen binding fragment thereof, or vice versa.
- the ILT4 antibody, or antigen binding fragment thereof, and the PD-L1 or PD-1 antibody, or antigen binding fragment thereof are administered together.
- the ILT4 antibody, or antigen binding fragment thereof, and the PD-L1 or PD-1 antibody, or antigen binding fragment thereof are administered simultaneously.
- the ILT4 antibody, or antigen binding fragment thereof, and the PD-L1 or PD-1 antibody, or antigen binding fragment thereof are simultaneously administered in a single formulation.
- the ILT4 antibody, or antigen binding fragment thereof, and the PD-L1 or PD- 1 antibody, or antigen binding fragment thereof are formulated for separate administration and are administered concurrently or sequentially. Such concurrent or sequential administration preferably results in both antibodies being simultaneously present in treated patients.
- administration of any of the ILT4 antibodies, or antigen binding fragment thereof, described herein in combination with any of the PD-L1 or PD-1 antibodies, or antigen binding fragments thereof, described herein results in synergistic effects (e.g., in enhancing immune responses in vivo) as compared to use of either antibody alone.
- the subject can be, for example, one who suffers from a condition or disease in which stimulation of an immune response is desired.
- the condition or disease is cancer.
- Types of cancers include, but are not limited to, leukemia, acute lymphocytic leukemia, acute myelocytic leukemia, myeloblasts promyelocyte myelomonocytic monocytic erythroleukemia, chronic leukemia, chronic myelocytic (granulocytic) leukemia, chronic lymphocytic leukemia, mantle cell lymphoma, primary central nervous system lymphoma, Burkitt’s lymphoma and marginal zone B cell lymphoma, Polycythemia vera Lymphoma, Hodgkin's disease, non-Hodgkin' s disease, multiple myeloma, Waldenstrom's macroglobulinemia, heavy chain disease, solid tumors, sarcomas, and carcinomas, fibrosarcoma, myxosarcoma, liposarcoma, chrondrosarcoma, osteogenic sarcoma, osteo
- Particular cancers include ILT4-expressing tumors selected from the group consisting of chronic lymphocytic leukemia, mantle cell lymphoma, primary central nervous system lymphoma, Burkitt’s lymphoma and marginal zone B cell lymphoma.
- Other disease indications include bacterial, fungal, viral and parasitic infectious diseases.
- the methods of inducing or enhancing an immune response (e.g., against an antigen) in a subject described herein can further comprise administering the antigen to the subject.
- the term “antigen” refers to any natural or synthetic immunogenic substance, such as a protein, peptide, hapten, polysaccharide and/or lipid.
- the bispecific construct, multispecific construct, antibody, antigen binding fragment thereof, or composition described herein and antigen can be administered at the same time or, alternatively, the bispecific construct, multispecific construct, antibody, antigen binding fragment thereof, or composition can be administered before or after the antigen is administered.
- a bispecific construct, multispecific construct, antibody, antigen binding fragment thereof, or composition described herein is administered in combination with a vaccine, to enhance the immune response against the vaccine antigen, for example a tumor antigen (to thereby enhance the immune response against the tumor) or an antigen from an infectious disease pathogen (to thereby enhance the immune response against the infectious disease pathogen).
- a vaccine antigen can comprise, for example, an antigen or antigenic composition capable of eliciting an immune response against a tumor or against an infectious disease pathogen such as a virus, a bacteria, a parasite or a fungus.
- the antigen or antigens be derived from tumors, such as the various tumor antigens previously disclosed herein.
- the antigen or antigens can be derived from pathogens such as viruses, bacteria, parasites and/or fungi.
- Preferred antigens to be co-administered with the antibodies, or antigen binding fragments thereof, bispecific constructs, multispecific constructs, or the compositions of described herein include tumor antigens and vaccine antigens (e.g., bacterial, viral or other pathogen antigens against which protective immunity is desired to be raised in a subject for purposes of vaccination).
- vaccine antigens e.g., bacterial, viral or other pathogen antigens against which protective immunity is desired to be raised in a subject for purposes of vaccination.
- suitable pathogen antigens include tumor- associated antigens (TAAs), including but not limited to, sequences comprising all or part of the sequences of EGFR, EGFRvIII, gp100 or Pmel17, HER2/neu, mesothelin, CEA, MART1, MAGE-A1, MAGE-A2, MAGE-A3, MAGE-A4, MUC-1, GPNMB, HMW-MAA, TIM1, ROR1, CD19 and germ cell derived tumor antigens.
- TAAs tumor- associated antigens
- suitable antigens include viral antigens for the prevention or treatment of viral diseases.
- viral antigens include, but are not limited to, HIV-1 env, HBsAg, HPV, FAS, HSV-1, HSV-2, p17, ORF2 and ORF3 antigens.
- viral antigens or antigenic determinants can be derived from, for example,: Cytomegalovirus (especially Human, such as gB or derivatives thereof); Epstein Barr virus (such as gp350); flaviviruses (e.g.
- hepatitis virus such as hepatitis B virus (for example Hepatitis B Surface antigen such as the PreSl, PreS2 and S antigens described in EP-A-414374; EP-A-0304578, and EP-A- 198474), hepatitis A virus, hepatitis C virus and hepatitis E virus; HIV-1, (such as tat, nef, gpl20 or gpl60); human herpes viruses, such as gD or derivatives thereof or Immediate Early protein such as ICP27 from HSV1 or HSV2; human papilloma viruses (for example HPV6, 11, 16, 18); Influenza virus (whole live or inactivated virus, split influenza virus, grown in eggs or MDCK cells, or Vero cells or whole flu virosomes (as described by Gluck, Vaccine, 1992,10, 915
- bacterial antigens include, but are not limited to, Toxoplasma gondii or Treponema pallidum.
- the bacterial antigens can be in the treatment or prevention of various bacterial diseases such as Anthrax, Botulism, Tetanus, Chlamydia, Cholera, Diphtheria, Lyme Disease, Syphilis and Tuberculosis.
- Bacterial antigens or antigenic determinants can be derived from, for example: Bacillus spp., including B. anthracis (e.g., botulinum toxin); Bordetella spp, including B.
- pertussis for example pertactin, pertussis toxin, filamenteous hemagglutinin, adenylate cyclase, fimbriae
- Borrelia spp. including B. burgdorferi (eg OspA, OspC, DbpA, DbpB), B. garinii (eg OspA, OspC, DbpA, DbpB), B. afzelii (eg OspA, OspC, DbpA, DbpB), B. andersonii (eg OspA, OspC, DbpA, DbpB), B.
- B. burgdorferi eg OspA, OspC, DbpA, DbpB
- B. garinii eg OspA, OspC, DbpA, DbpB
- B. afzelii eg Osp
- C. jejuni for example toxins, adhesins and invasins
- C. coli Chlamydia spp., including C. trachomatis (eg MOMP, heparin-binding proteins), C. pneumonie (eg MOMP, heparin-binding proteins), C. psittaci; Clostridium spp., including C. tetani (such as tetanus toxin), C. botulinum (for example botulinum toxin), C. difficile (eg clostridium toxins A or B); Corynebacterium spp., including C.
- C. trachomatis eg MOMP, heparin-binding proteins
- C. pneumonie eg MOMP, heparin-binding proteins
- C. psittaci Clostridium spp., including C. tetani (such as tetanus toxin), C. bot
- diphtheriae eg diphtheria toxin
- Ehrlichia spp. including E. equi and the agent of the Human Granulocytic Ehrlichiosis
- Rickettsia spp including R.rickettsii
- Enterococcus spp. including E. faecalis, E. faecium
- Escherichia spp including enterotoxic E. coli (for example colonization factors, heat-labile toxin or derivatives thereof, or heat-stable toxin), enterohemorragic E. coli, enteropathogenic E. coli (for example shiga toxin-like toxin); Haemophilus spp., including H.
- influenzae type B eg PRP
- non-typable H. influenzae for example OMP26, high molecular weight adhesins, P5, P6, protein D and lipoprotein D, and fimbrin and fimbrin derived peptides (see for example US 5,843,464)
- Helicobacter spp including H. pylori (for example urease, catalase, vacuolating toxin); Pseudomonas spp, including P. aeruginosa; Legionella spp, including L. pneumophila ; Leptospira spp., including L. interrogans; Listeria spp., including L.
- Moraxella spp including M catarrhalis, also known as Branhamella catarrhalis (for example high and low molecular weight adhesins and invasins); Morexella Catarrhalis (including outer membrane vesicles thereof, and OMP106 (see for example W097/41731)); Mycobacterium spp., including M. tuberculosis (for example ESAT6, Antigen 85A, -B or -C), M. bovis, M. leprae, M. avium, M. paratuberculosis, M. smegmatis; Neisseria spp, including N. gonorrhea and N.
- M catarrhalis also known as Branhamella catarrhalis (for example high and low molecular weight adhesins and invasins); Morexella Catarrhalis (including outer membrane vesicles thereof, and OMP106 (see for example W097/41731)
- meningitidis for example capsular polysaccharides and conjugates thereof, transferrin-binding proteins, lactoferrin binding proteins, PilC, adhesins
- Neisseria mengitidis B including outer membrane vesicles thereof, and NspA (see for example WO 96/29412); Salmonella spp, including S. typhi, S. paratyphi, S. choleraesuis, S. enteritidis; Shigella spp, including S. sonnei, S. dysenteriae, S. flexnerii; Staphylococcus spp., including S. aureus, S. epidermidis; Streptococcus spp, including S.
- pneumonie e.g., capsular polysaccharides and conjugates thereof, PsaA, PspA, streptolysin, choline-binding proteins
- PsaA capsular polysaccharides and conjugates thereof
- PspA protein antigen Pneumolysin
- mutant detoxified derivatives thereof see for example WO 90/06951; WO 99/03884
- Treponema spp. including T. pallidum (eg the outer membrane proteins), T. denticola, T. hyodysenteriae
- Vibrio spp including V.
- cholera for example cholera toxin
- Yersinia spp including Y. enterocolitica (for example a Yop protein), Y. pestis, Y. pseudotuberculosis.
- Parasitic/fungal antigens or antigenic determinants can be derived from, for example,: Babesia spp., including B. microti; Candida spp., including C. albicans; Cryptococcus spp., including C. neoformans; Entamoeba spp., including E. histolytica; Giardia spp., including ;G. lamblia; Leshmania spp., including L. major; Plasmodium.
- antigens and antigenic determinants can be used in many different forms.
- antigens or antigenic determinants can be present as isolated proteins or peptides (for example in so-called "subunit vaccines") or, for example, as cell-associated or virus- associated antigens or antigenic determinants (for example in either live or killed pathogen strains). Live pathogens will preferably be attenuated in known manner.
- antigens or antigenic determinants may be generated in situ in the subject by use of a polynucleotide coding for an antigen or antigenic determinant (as in so-called "DNA vaccination"), although it will be appreciated that the polynucleotides which can be used with this approach are not limited to DNA, and may also include RNA and modified polynucleotides as discussed above.
- a vaccine antigen can also be targeted, for example to particular cell types or to particular tissues.
- the vaccine antigen can be targeted to Antigen Presenting Cells (APCs), for example by use of agents such as antibodies targeted to APC-surface receptors such as DEC-205, for example as discussed in WO 2009/061996 (Celldex Therapeutics, Inc), or the Mannose Receptor (CD206) for example as discussed in WO 03040169 (Medarex, Inc.).
- kits e.g., diagnostic kits
- Kits comprising one or more ILT4 antibody or antigen binding fragment thereof, bispecific constructs, multispecific constructs, or compositions as described herein, optionally with instructions for use.
- Kits may also include informative pamphlets, for example, pamphlets informing one how to use reagents to practice a method disclosed herein.
- the antigen i.e., 5-20 micrograms soluble recombinant ILT4 antigen in PBS
- the antigen was mixed at 1:1 ratio with MPL plus TDM adjuvant system (Sigma®). Mice were injected with 200 microliters of the prepared antigen into the peritoneal cavity approximately every 14 days. Animals that developed anti-ILT4 titers were given an intravenous injection of 1-10 micrograms soluble recombinant ILT4 antigen three to four days prior to fusion. Mouse spleens were harvested, and the isolated splenocytes used for hybridoma preparation.
- the P3x63Ag8.653 murine myeloma cell line (ATCC CRL 1580) was used for fusions which was cultured in RPMI 1640 (Invitrogen®) containing 10% FBS. Additional media supplements were added to the hybridoma growth media, which included: up to 10% Hybridoma Cloning Supplement (Sigma), 10% FBS (Sigma), L-glutamine (Gibco®) 0.1% gentamycin (Gibco), 2-mercaptoethanol (Gibco), with HAT (Sigma; 1.0 x 10 4 M hypoxanthine, 4.0 x 10 -7 M aminopterin, 1.6 x 10 -5 M thymidine media.
- Spleen cells were mixed with the P3x63Ag8.653 myeloma cells in a 6:1 ratio and pelleted by centrifugation. Polyethylene glycol was added dropwise with careful mixing to facilitate fusion. Hybridomas were cultured for two to three weeks until visible colonies become established. Supernatant was harvested and used for initial screening for mouse IgG via ELISA using a human soluble ILT4 fusion protein and a mouse Fc specific detection. IgG positive supernatants were then assayed for ILT4 specificity via flow cytometry. The hybridomas were also screened for cross-reactivity with cynomolgus macaque ILT4 and all were positive for binding.
- Hybridoma cells were expanded and cell pellets were frozen for RNA isolation and sequencing.
- the V H and V L coding regions of human monoclonal antibodies were identified using RNA from the corresponding hybridomas.
- RNA was reverse transcribed to cDNA, the V coding regions were amplified by PCR and the PCR product was sequenced, inserted into human IgG4 vector, transiently expressed as IgG4 chimeric antibodies and purified by protein A column chromatography which led to the isolation of two antibodies of particular interest, the variable region sequences of which were designated 7A3 (SEQ ID NOs: 9 and 10) and 7B1 (SEQ ID NOs: 19 and 20)).
- Example 2 Generation of Humanized Antibodies
- VH and VL domains parental heavy and light chain variable region domains
- VH and VL domains parental heavy and light chain variable region domains
- the original mouse variable sequences of antibodies 7A3 and 7B1 were aligned to all human germline sequences.
- the original mouse and closest matching germline sequences were analyzed for sequence liabilities and the most appropriate germline frameworks selected.
- Complementarity determining regions (CDRs) from the parent antibody were grafted onto an appropriate number of human frameworks and back mutations were introduced as necessary.
- Four heavy chain and four light chain humanized variants were designed for antibody 7A3.
- the 7A3 heavy chain variants were designated: 7A3-H1 (SEQ ID NO:97), 7A3-H2 (SEQ ID NO:9), 7A3-H3 (SEQ ID NO:98) and 7A3-H4 (SEQ ID NO: 99).
- the 7A3 light chain variants were designated: 7A3-L1 (SEQ ID NO:10), 7A3-L2 (SEQ ID NO:100), 7A3- L3 (SEQ ID NO:101) and 7A3-L4 (SEQ ID NO:102).
- Four heavy chain and four light chain humanized variants were designed for antibody 7B1.
- the 7B1 heavy chain variants were designated: 7B1-H1 (SEQ ID NO:103), 7B1-H2 (SEQ ID NO:19), 7B1-H3 (SEQ ID NO:104) and 7B1-H4 (SEQ ID NO:105).
- the 7B1 light chain variants were designated: 7B1-L1 (SEQ ID NO:20), 7B1-L2 (SEQ ID NO:106), 7B1- L3 (SEQ ID NO:107) and 7B1-L4 (SEQ ID NO:108). Pairing of these variable domain sequences is shown in Table 4.
- Antibodies 7A3 VH6-L17 and 7B1 VH10-L21 were protein A purified, their Fc domains were mutated (AQQ), and selected for further investigation as described below.
- Table 4 Heavy and Light Chain Pairings
- Example 3 Determination of affinity and rate constants of humanized monoclonal antibodies by bio-layer interferometry (BLI) Binding affinity and binding kinetics of various humanized ILT4 antibodies were examined by bio-layer interferometry (BLI) using an OctetTM QK e instrument (ForteBio Sartorius®, Fremont, CA) according to the manufacturer’s guidelines.
- Purified chimeric antibodies (7A3-huG4 and 7B1-huG4) and humanized antibodies (7A3 VH6-L17, 7A3 VH6-L18, 7A3 VH6-L20, 7B1 VH10-L21, 7B1 VH10-L22 and 7B1 VH10-L24) were captured on Anti-Human Fc Capture (AHC) biosensors (Fortebio Product No.18-5060).
- Each antibody was prepared in dilution buffer (10mMPO4+150mM NaCl+1mg/mL BSA+ 0.05%Tween 20, pH 7.2) to 0.5 ⁇ g/mL and loaded on freshly hydrated and pre-conditioned AHC biosensors for 300 seconds at 30 o C and 1000rpm plate shake speed.
- dilution buffer 10mMPO4+150mM NaCl+1mg/mL BSA+ 0.05%Tween 20, pH 7.2
- Binding was determined by exposing seven of the antibody loaded biosensors to analyte: soluble human ILT4-HIS (His-tagged ILT4 extracellular domain).
- Affinity measurements were determined using 2-fold serial dilutions of analyte ranging from 25 to 0.4nM in dilution buffer at 30 o C and 1000rpm plate shake speed.
- association and dissociation curves were fitted to a 1:1 binding model using the data analysis software according to the manufacturer’s guidelines.
- Example 4 Binding of chimeric and humanized monoclonal antibodies to human ILT4 using ELISA Microtiter plates were coated with recombinant human ILT4-kappa in PBS, and then blocked with 5% bovine serum albumin in PBS.
- Example 5 Binding of chimeric and humanized monoclonal antibodies to cells expressing human ILT4 Antibodies were tested for binding to human HEK293 cell lines expressing human ILT4 on their surface.
- Protein A purified chimeric monoclonal antibodies (7A3-huG4, 7B1- huG4), various humanized versions (7A3 VH6-L17, 7A3 VH6-L18, 7A3 VH6-L20, 7B1 VH10-L21, 7B1 VH10-L22 and 7B1 VH10-L24) and isotype controls were incubated with HEK293 cells expressing human ILT4 at room temperature on a plate shaker. After 20 minutes, the cells were washed with PBS containing 0.1% BSA and 0.05% NaN3 (PBA) and the bound antibodies were detected by incubating the cells with a PE labeled goat anti-human IgG Fc-specific probe.
- Example 6 Induction of TNF- ⁇ production by chimeric and humanized monoclonal antibodies in macrophages Macrophages were derived from human monocytes as follows: PBMCs were added to T175cm 2 flasks and monocytes allowed to adhere for approximately 2 hours at 37 o C, 6%CO 2 .
- the non-adherent cells were removed and the monocytes cultured for 7 days in RPMI containing 10% FBS and 50 ng/mL M-CSF (R&D Systems®). The cells were then incubated in the presence of protein A purified chimeric monoclonal antibodies (7A3-huG4, 7B1-huG4), their humanized versions (7A3 VH6-L17, 7A3 VH6-L18, 7A3 VH6-L20, 7B1 VH10-L21, 7B1 VH10-L22 and 7B1 VH10-L24) and isotype controls and of 50ng/mL LPS (Invivogen) at 37oC, 6% CO 2 .
- protein A purified chimeric monoclonal antibodies (7A3-huG4, 7B1-huG4), their humanized versions (7A3 VH6-L17, 7A3 VH6-L18, 7A3 VH6-L20, 7B1 VH10-L
- FIGs.5A and 5B show the increase in TNF- ⁇ production with the various ILT4 antibodies.
- Example 7 Induction of TNF- ⁇ and MIP1- ⁇ production by humanized monoclonal antibodies in macrophages Human PBMCs were differentiated with MCSF (100 ng/mL) for 7 days. Following differentiation, human macrophages were plated at 1.5x10 6 cells/well and allowed to adhere overnight.
- Example 8 Gene expression analysis of humanized monoclonal antibodies in macrophages Human PBMCs were differentiated with MCSF (100 ng/mL) for 7 days. After differentiation human macrophages were plated at 1.5x10 6 cells/well and allowed to adhere overnight.
- Example 9 Cross-reactivity of humanized monoclonal antibodies: binding to cells expressing ILT family members Protein A purified humanized monoclonal antibodies 7A3 VH6-L17 and 7B1 VH10- L21 and isotype controls were incubated with CHO cells expressing human ILT family members with highest homology to ILT4, e.g., LILRA1, LILRA2 (ILT1), LILRA4 (ILT7), LILRA5 (ILT11), LILRB1 (ILT2) and LILRB2 at room temperature on a plate shaker.
- LILRA1, LILRA2 (ILT1)
- LILRA4 LILRA4
- LILRA5 LILRB1
- LILRB2 LILRB2
- Dendritic cells were prepared as follows: PBMC’s were added to T175cm 2 flasks and monocytes allowed to adhere for approximately 2 hours at 37oC, 6%CO 2 . The non-adherent cells were removed and the monocytes cultured for 7 days in RPMI containing 10% FBS, 100 ng/mL GM-CSF (R&D Systems) and 10 ng/mL IL-4 (R&D Systems). Protein A purified monoclonal antibodies 7A3 VH6-L17 and 7B1 VH10-L21 and isotype controls were incubated with human monocytes, macrophages and dendritic cells at room temperature on a plate shaker.
- the cells were washed with PBS containing 0.1% BSA and 0.05% NaN 3 (PBA) and the bound antibodies were detected by incubating the cells with a PE labeled goat anti-human IgG Fc-specific probe.
- PBA PBS containing 0.1% BSA and 0.05% NaN 3
- the excess probe was washed from the cells with PBA and the cell associated fluorescence was determined by analysis using a FACSCanto II TM instrument (BD Biosciences, NJ, USA) according to the manufacturer’s directions. Representative binding is shown in FIGs. 9A, 9B, and 9C.
- Example 11 Construction and production of bispecific antibodies Tetravalent bispecific antibody constructs were developed using a mutated fully human IgG1 backbone for a PD-L1 monoclonal antibody sequence (9H9; see SEQ ID NOs: 87 and 88 of WO2019204462 for heavy and light chain sequences) and the scFv of the ILT4 monoclonal antibody genetically linked to the C-terminus of the 9H9 heavy chain through a linker.
- Such bispecific antibodies were created with scFv versions of both 7A3 and 7B1 antibodies.
- the humanized antibody scFv sequences used in the bispecifics were taken from 7A3 VH6-L17 and 7B1 VH10-L21, respectively.
- the Fc domain was mutated (AQQ) and certain other amino acid residues were also modified. These constructs are denoted 9H9-7A3 HL and 9H9-7B1 HL, respectively, in which the scFv is in the VH-VL orientation.
- Alternative bispecific antibody constructs were created with the heavy and light chains of the anti-ILT4 scFv in the reverse orientation, in which the scFv is in the VL-VH orientation.
- 9H9-7A3 LH and 9H9-7B1 LH respectively. The same 9H9 light chain was used in all four cases.
- tetravalent bispecific antibodies include the following: Key: Bold double underlined: 9H9 Variable region Bold single underlined: Constant domains (including embedded dotted underline) Italic: anti-ILT4 scFv Italic underlined: linkers Dotted underlined: modified amino acid residues 9H9-7A3 HL EVQLVESGGGLVQPGGSLRLSCAASGGIISTYWMSWVRQAPGKGLEWVANIKQ DGSEKYYVDSVKGRFTISRDNAKNSLYLQMNSLRVEDTAMYYCARDRPVAGAS ALWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSW NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDK KVEPKSCDKTHTCPPCPAPEAQGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVS HEDPEVKFN
- FIG.10A shows a schematic depiction of the bispecific constructs.
- FIG.10B shows an alternative bispecific construct with an anti-PD-1 antibody in place of the anti-PD-L1 antibody.
- Example 12 Determination of affinity and rate constants of humanized bispecific antibodies by bio-layer interferometry (BLI) Binding affinity and binding kinetics of various human ILT4 bispecific antibodies were examined by bio-layer interferometry (BLI) using an Octet TM QK e instrument (ForteBio Sartorius, Fremont, CA) according to the manufacturer’s guidelines.
- BBI bio-layer interferometry
- Binding was determined by exposing six of the antibody loaded biosensors to analyte: soluble human ILT4-HIS (Celldex in-house reagent). Affinity measurements were determined using 2-fold serial dilutions of analyte ranging from 25 to 0.4nM in dilution buffer at 30 o C and 1000rpm plate shake speed. Association of the antibody loaded biosensors in analyte wells was carried out for 300 seconds, the biosensors were then moved to dilution buffer wells for 1500sec for dissociation measurements. Corresponding controls were conducted in each case by keeping the remaining biosensor with captured antibody in dilution buffer wells for association and dissociation steps.
- the data for the control biosensor was used to subtract background and account for biosensor drift and antibody dissociation from the biosensors.
- Fortebio’s Data Analysis Software version 8.2.0.7 (ForteBio Sartorius, Fremont, CA) was used in each case to derive kinetic parameters from the concentration series of analyte in dilution buffer binding to captured antibody.
- the association and dissociation curves were fitted to a 1:1 binding model using the data analysis software according to the manufacturer’s guidelines.
- Example 13 Binding of humanized bispecific antibodies to human PD-L1 using ELISA Microtiter plates were coated with recombinant human PD-L1-msFc in PBS, and then blocked with 5% bovine serum albumin in PBS. Protein A purified anti-PD-L1 monoclonal antibody 9H9, bispecific antibodies 9H9-7A3 HL, 9H9-7A3 LH, 9H9-7B1 HL, 9H9-7B1 LH (as described in Example 11) and isotype controls were added at various concentrations and incubated at 37oC.
- the plates were washed with PBS/Tween and then incubated with a goat- anti-human IgG Fc-specific polyclonal reagent conjugated to horseradish peroxidase at 37oC. After washing, the plates were developed with HRP substrate, and analyzed at OD 450 using a microtiter plate reader. Representative binding curves are shown in FIGs.12A and 12B.
- Example 14 Binding of humanized bispecific antibodies to cells expressing human PD- L1 Protein A purified monoclonal antibodies, bispecific antibodies (9H9-7A3 HL, 9H9- 7A3 LH, 9H9-7B1 HL, 9H9-7B1 LH, as described in Example 11) and isotype controls were incubated with HEK293 cells expressing human PD-L1 at room temperature on a plate shaker. After 20 minutes, the cells were washed with PBS containing 0.1% BSA and 0.05% NaN3 (PBA) and the bound antibodies were detected by incubating the cells with a PE labeled goat anti-human IgG Fc-specific probe.
- PBA PBS containing 0.1% BSA and 0.05% NaN3
- Example 15 Binding of humanized bispecific antibodies to cells expressing human ILT4 Protein A purified monoclonal antibodies, bispecific monoclonal antibodies (9H9- 7A3 HL, 9H9-7A3 LH, 9H9-7B1 HL, 9H9-7B1 LH, as described in Example 11) and isotype controls were incubated with HEK293 cells expressing human ILT4 at room temperature on a plate shaker.
- the cells were washed with PBS containing 0.1% BSA and 0.05% NaN3 (PBA) and the bound antibodies were detected by incubating the cells with a PE labeled goat anti-human IgG Fc-specific probe.
- PBA PBS containing 0.1% BSA and 0.05% NaN3
- the excess probe was washed from the cells with PBA and the cell associated fluorescence was determined by analysis using a FACSCanto II TM instrument (BD Biosciences, NJ, USA) according to the manufacturer’s directions. Representative binding curves are shown in FIGs.14A and 14B.
- Example 16 Bifunctional binding of humanized bispecific antibodies to cell-expressed human ILT4 and to human PD-L1 Binding of bispecific constructs to ILT4 and PD-L1 was assessed using HEK293 cells expressing human ILT4. In brief, dilutions of the bispecific constructs were allowed to bind to the ILT4 expressing cell before adding human PD-L1-msFc that was detected with PE labeled goat anti-mouse IgG Fc-specific probe. Representative binding curves for four bispecific constructs (9H9-7A3 HL, 9H9-7A3 LH, 9H9-7B1 HL, and 9H9-7B1 LH, as described in Example 11) are shown in FIGs.15A and 15B.
- Example 17 T cell PD1/PD-L1 blockade of humanized bispecific antibodies
- the effect of the bispecific antibodies (9H9-7A3 HL, 9H9-7A3 LH, 9H9-7B1 HL, 9H9-7B1 LH, as described in Example 11) on blockade of the PD1/PD-L1 interaction was determined using the commercially available PD-1/PD-L1 Blockade Assay from Promega®. Two engineered cell lines, PD1 Effector cells and PD-L1 aAPC/CHO-K1 cells were co- cultured in the presence of the antibodies for 6 hours.
- Blocking of the PD1/PD-L1 interaction results in TCR activation and induces luminescence via the NFAT pathway.
- Luminescence was detected by the addition of Bio-Glo reagent and quantitated on a Perkin Elmer® Victor X4 luminometer.
- the anti-PD-L1 antibodies and bispecific antibodies effectively block the PD1/PD-L1 interaction between cells leading to activation of the NFAT pathway.
- Example 18 Induction of TNF- ⁇ production by humanized bispecific antibodies in macrophages
- Macrophages were derived from human monocytes as follows: PBMC’s were added to a T175cm 2 flasks and monocytes allowed to adhere for ⁇ 2 hours at 37 o C, 6%CO2. The non-adherent cells were removed and the monocytes cultured for 7 days in RPMI containing 10% FBS and 50 ng/mL M-CSF (R&D Systems).
- the cells were then incubated in the presence of the bispecific antibodies (9H9-7A3 HL, 9H9-7A3 LH, 9H9-7B1 HL, 9H9-7B1 LH, as described in Example 11) and the appropriate antibody controls with 50ng/mL LPS (Invivogen) at 37 o C, 6%CO2. After 24 hours, the cells were harvested and the supernatant was collected and stored for cytokine analysis. Induction of TNF- ⁇ was evaluated in the supernatants collected by ELISA (R&D Systems). FIGs.17A and 17B show the increase in TNF- ⁇ production with the bispecific antibodies.
- Example 19 Inhibition of HLA-G binding to ILT4 by humanized bispecific antibodies Dilutions of the bispecific antibodies (9H9-7A3 HL, 9H9-7A3 LH, 9H9-7B1 HL, 9H9-7B1 LH, as described in Example 11) and antibody controls were incubated on HEK293 cells expressing human ILT4 at room temperature on a plate shaker. After 30 minutes, the cells were washed and PE-labeled HLA-G tetramer (FredHutch) was added.
- FredHutch PE-labeled HLA-G tetramer
Abstract
L'invention concerne de nouveaux anticorps ILT4 et des fragments de liaison à l'antigène de ceux-ci, ainsi que des constructions bispécifiques et multispécifiques se liant à ILT4 et PD-L1, comprenant de tels anticorps liés à au moins un agent de liaison supplémentaire. Des procédés d'induction ou d'amélioration d'une réponse immunitaire, et des méthodes de traitement du cancer, par administration des anticorps (ou fragments), de constructions bispécifiques ou de compositions sont également décrits.
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US202163172997P | 2021-04-09 | 2021-04-09 | |
PCT/US2022/023961 WO2022217019A1 (fr) | 2021-04-09 | 2022-04-08 | Anticorps contre l'anticorps ilt4, anti-ilt4/pd-l1 bispécifique et ses utilisations |
Publications (1)
Publication Number | Publication Date |
---|---|
EP4320159A1 true EP4320159A1 (fr) | 2024-02-14 |
Family
ID=81449213
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
EP22720158.9A Pending EP4320159A1 (fr) | 2021-04-09 | 2022-04-08 | Anticorps contre l'anticorps ilt4, anti-ilt4/pd-l1 bispécifique et ses utilisations |
Country Status (9)
Country | Link |
---|---|
EP (1) | EP4320159A1 (fr) |
JP (1) | JP2024515560A (fr) |
KR (1) | KR20240006541A (fr) |
CN (1) | CN117545773A (fr) |
AU (1) | AU2022253269A1 (fr) |
BR (1) | BR112023020303A2 (fr) |
CA (1) | CA3214853A1 (fr) |
IL (1) | IL307519A (fr) |
WO (1) | WO2022217019A1 (fr) |
Families Citing this family (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2023077521A1 (fr) * | 2021-11-08 | 2023-05-11 | Celldex Therapeutics, Inc | Constructions bispécifiques anti-ilt4 et anti-pd-1 |
Family Cites Families (45)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US4475196A (en) | 1981-03-06 | 1984-10-02 | Zor Clair G | Instrument for locating faults in aircraft passenger reading light and attendant call control system |
US4447233A (en) | 1981-04-10 | 1984-05-08 | Parker-Hannifin Corporation | Medication infusion pump |
US4439196A (en) | 1982-03-18 | 1984-03-27 | Merck & Co., Inc. | Osmotic drug delivery system |
US4866034A (en) | 1982-05-26 | 1989-09-12 | Ribi Immunochem Research Inc. | Refined detoxified endotoxin |
US4436727A (en) | 1982-05-26 | 1984-03-13 | Ribi Immunochem Research, Inc. | Refined detoxified endotoxin product |
US4522811A (en) | 1982-07-08 | 1985-06-11 | Syntex (U.S.A.) Inc. | Serial injection of muramyldipeptides and liposomes enhances the anti-infective activity of muramyldipeptides |
US4447224A (en) | 1982-09-20 | 1984-05-08 | Infusaid Corporation | Variable flow implantable infusion apparatus |
US4487603A (en) | 1982-11-26 | 1984-12-11 | Cordis Corporation | Implantable microinfusion pump system |
US4486194A (en) | 1983-06-08 | 1984-12-04 | James Ferrara | Therapeutic device for administering medicaments through the skin |
US4596556A (en) | 1985-03-25 | 1986-06-24 | Bioject, Inc. | Hypodermic injection apparatus |
FI861417A0 (fi) | 1985-04-15 | 1986-04-01 | Endotronics Inc | Hepatitis b ytantigen framstaelld med rekombinant-dna-teknik, vaccin, diagnostiskt medel och cellinjer samt foerfaranden foer framstaellning daerav. |
US5374548A (en) | 1986-05-02 | 1994-12-20 | Genentech, Inc. | Methods and compositions for the attachment of proteins to liposomes using a glycophospholipid anchor |
MX9203291A (es) | 1985-06-26 | 1992-08-01 | Liposome Co Inc | Metodo para acoplamiento de liposomas. |
US4676980A (en) | 1985-09-23 | 1987-06-30 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Target specific cross-linked heteroantibodies |
GB8601597D0 (en) | 1986-01-23 | 1986-02-26 | Wilson R H | Nucleotide sequences |
US4877611A (en) | 1986-04-15 | 1989-10-31 | Ribi Immunochem Research Inc. | Vaccine containing tumor antigens and adjuvants |
US4790824A (en) | 1987-06-19 | 1988-12-13 | Bioject, Inc. | Non-invasive hypodermic injection device |
US4941880A (en) | 1987-06-19 | 1990-07-17 | Bioject, Inc. | Pre-filled ampule and non-invasive hypodermic injection device assembly |
EP1088830A3 (fr) | 1987-06-22 | 2004-04-07 | Medeva Holdings B.V. | Particules de l'antigène de surface de l'hépatitie B |
GB8717430D0 (en) | 1987-07-23 | 1987-08-26 | Celltech Ltd | Recombinant dna product |
GB8809129D0 (en) | 1988-04-18 | 1988-05-18 | Celltech Ltd | Recombinant dna methods vectors and host cells |
US4912094B1 (en) | 1988-06-29 | 1994-02-15 | Ribi Immunochem Research Inc. | Modified lipopolysaccharides and process of preparation |
JP3237842B2 (ja) | 1988-12-16 | 2001-12-10 | オランダ国 | ニューモリシンミュータント及びそれから製造されたニューモコッカルワクチン |
US5108921A (en) | 1989-04-03 | 1992-04-28 | Purdue Research Foundation | Method for enhanced transmembrane transport of exogenous molecules |
EP0414374B1 (fr) | 1989-07-25 | 1997-10-08 | Smithkline Biologicals S.A. | Antigènes ainsi que les méthodes pour leur préparation |
US5064413A (en) | 1989-11-09 | 1991-11-12 | Bioject, Inc. | Needleless hypodermic injection device |
US5312335A (en) | 1989-11-09 | 1994-05-17 | Bioject Inc. | Needleless hypodermic injection device |
US5383851A (en) | 1992-07-24 | 1995-01-24 | Bioject Inc. | Needleless hypodermic injection device |
CA2194761C (fr) | 1994-07-15 | 2006-12-19 | Arthur M. Krieg | Oligonucleotides immunomodulateurs |
WO1996026277A1 (fr) | 1995-02-24 | 1996-08-29 | Cantab Pharmaceuticals Research Limited | Polypeptides utiles comme agents immunotherapeutiques et procedes de preparation de polypeptides |
IL117483A (en) | 1995-03-17 | 2008-03-20 | Bernard Brodeur | MENINGITIDIS NEISSERIA shell protein is resistant to proteinase K. |
US5843464A (en) | 1995-06-02 | 1998-12-01 | The Ohio State University | Synthetic chimeric fimbrin peptides |
US7341727B1 (en) | 1996-05-03 | 2008-03-11 | Emergent Product Development Gaithersburg Inc. | M. catarrhalis outer membrane protein-106 polypeptide, methods of eliciting an immune response comprising same |
US5856462A (en) | 1996-09-10 | 1999-01-05 | Hybridon Incorporated | Oligonucleotides having modified CpG dinucleosides |
KR100619350B1 (ko) | 1997-07-21 | 2006-09-05 | 박스터 헬쓰케어 에스.에이. | 변형 면역성 뉴멀리신 백신조성물 |
GB9727262D0 (en) | 1997-12-24 | 1998-02-25 | Smithkline Beecham Biolog | Vaccine |
WO1999052549A1 (fr) | 1998-04-09 | 1999-10-21 | Smithkline Beecham Biologicals S.A. | Compositions adjuvantes |
EP1303299B1 (fr) | 2000-03-29 | 2010-07-28 | The Trustees of The University of Pennsylvania | Utilisation des peptides prokaryotic pest-like pour augmenter l'immunogénicité des antigènes |
US7560534B2 (en) | 2000-05-08 | 2009-07-14 | Celldex Research Corporation | Molecular conjugates comprising human monoclonal antibodies to dendritic cells |
LT2439273T (lt) | 2005-05-09 | 2019-05-10 | Ono Pharmaceutical Co., Ltd. | Žmogaus monokloniniai antikūnai prieš programuotos mirties 1(pd-1) baltymą, ir vėžio gydymo būdai, naudojant vien tik anti-pd-1 antikūnus arba derinyje su kitais imunoterapiniais vaistais |
NZ585556A (en) | 2007-11-07 | 2012-07-27 | Celldex Therapeutics Inc | Antibodies that bind human dendritic and epithelial cell 205 (dec-205) |
WO2016111947A2 (fr) * | 2015-01-05 | 2016-07-14 | Jounce Therapeutics, Inc. | Anticorps inhibiteurs d'interactions de tim-3:lilrb2 et leurs utilisations |
TWI796329B (zh) * | 2017-04-07 | 2023-03-21 | 美商默沙東有限責任公司 | 抗-ilt4抗體及抗原結合片段 |
KR20210011919A (ko) | 2018-04-17 | 2021-02-02 | 셀덱스 쎄라퓨틱스, 인크. | 항-cd27 항체 및 항-pd-l1 항체 및 이중특이적 작제물 |
MA53381A (fr) * | 2018-07-24 | 2021-06-02 | Amgen Inc | Association d'inhibiteurs de la voie lilrb1/2 et d'inhibiteurs de la voie pd-1 |
-
2022
- 2022-04-08 BR BR112023020303A patent/BR112023020303A2/pt unknown
- 2022-04-08 IL IL307519A patent/IL307519A/en unknown
- 2022-04-08 KR KR1020237038398A patent/KR20240006541A/ko unknown
- 2022-04-08 CA CA3214853A patent/CA3214853A1/fr active Pending
- 2022-04-08 EP EP22720158.9A patent/EP4320159A1/fr active Pending
- 2022-04-08 JP JP2023561644A patent/JP2024515560A/ja active Pending
- 2022-04-08 CN CN202280027136.4A patent/CN117545773A/zh active Pending
- 2022-04-08 AU AU2022253269A patent/AU2022253269A1/en active Pending
- 2022-04-08 WO PCT/US2022/023961 patent/WO2022217019A1/fr active Application Filing
Also Published As
Publication number | Publication date |
---|---|
AU2022253269A1 (en) | 2023-11-23 |
CA3214853A1 (fr) | 2022-10-13 |
WO2022217019A1 (fr) | 2022-10-13 |
KR20240006541A (ko) | 2024-01-15 |
IL307519A (en) | 2023-12-01 |
JP2024515560A (ja) | 2024-04-10 |
CN117545773A (zh) | 2024-02-09 |
BR112023020303A2 (pt) | 2023-11-14 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
EP3268037B1 (fr) | Agonistes cd27 | |
US10941201B2 (en) | Methods of inducing or enhancing an immune response comprising administering agonistic anti-CD40 antibodies | |
US11332537B2 (en) | Anti-CD27 and anti-PD-L1 antibodies and bispecific constructs | |
US11180566B2 (en) | Antibodies that bind human CD27 and uses thereof | |
US20120213771A1 (en) | Antibodies that bind human cd27 and uses thereof | |
AU2018201621A1 (en) | Antibodies that bind human CD27 and uses thereof | |
EP4320159A1 (fr) | Anticorps contre l'anticorps ilt4, anti-ilt4/pd-l1 bispécifique et ses utilisations | |
WO2023077521A1 (fr) | Constructions bispécifiques anti-ilt4 et anti-pd-1 | |
JP2024056862A (ja) | 抗cd27および抗pd-l1抗体ならびに二重特異性構築物 | |
EA042934B1 (ru) | Агонистические антитела, которые связываются с cd40 человека, и варианты их применения |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: UNKNOWN |
|
STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE INTERNATIONAL PUBLICATION HAS BEEN MADE |
|
PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: REQUEST FOR EXAMINATION WAS MADE |
|
17P | Request for examination filed |
Effective date: 20231109 |
|
AK | Designated contracting states |
Kind code of ref document: A1 Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO RS SE SI SK SM TR |