EP3823618A1 - Méthodes d'utilisation de rayonnement à débit de dose ultra élevé et d'agents thérapeutiques - Google Patents

Méthodes d'utilisation de rayonnement à débit de dose ultra élevé et d'agents thérapeutiques

Info

Publication number
EP3823618A1
EP3823618A1 EP19749118.6A EP19749118A EP3823618A1 EP 3823618 A1 EP3823618 A1 EP 3823618A1 EP 19749118 A EP19749118 A EP 19749118A EP 3823618 A1 EP3823618 A1 EP 3823618A1
Authority
EP
European Patent Office
Prior art keywords
radiation
dose
tumor
flash
inhibitor
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Pending
Application number
EP19749118.6A
Other languages
German (de)
English (en)
Inventor
Renate Parry
Eric Abel
Swati GIRDHANI
Stanley Mansfield
Patrick Kupelian
Deepak Khuntia
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Varian Medical Systems Inc
Original Assignee
Varian Medical Systems Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Varian Medical Systems Inc filed Critical Varian Medical Systems Inc
Publication of EP3823618A1 publication Critical patent/EP3823618A1/fr
Pending legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61NELECTROTHERAPY; MAGNETOTHERAPY; RADIATION THERAPY; ULTRASOUND THERAPY
    • A61N5/00Radiation therapy
    • A61N5/10X-ray therapy; Gamma-ray therapy; Particle-irradiation therapy
    • A61N5/103Treatment planning systems
    • A61N5/1031Treatment planning systems using a specific method of dose optimization
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/574Immunoassay; Biospecific binding assay; Materials therefor for cancer
    • G01N33/57484Immunoassay; Biospecific binding assay; Materials therefor for cancer involving compounds serving as markers for tumor, cancer, neoplasia, e.g. cellular determinants, receptors, heat shock/stress proteins, A-protein, oligosaccharides, metabolites
    • GPHYSICS
    • G16INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR SPECIFIC APPLICATION FIELDS
    • G16HHEALTHCARE INFORMATICS, i.e. INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR THE HANDLING OR PROCESSING OF MEDICAL OR HEALTHCARE DATA
    • G16H20/00ICT specially adapted for therapies or health-improving plans, e.g. for handling prescriptions, for steering therapy or for monitoring patient compliance
    • G16H20/10ICT specially adapted for therapies or health-improving plans, e.g. for handling prescriptions, for steering therapy or for monitoring patient compliance relating to drugs or medications, e.g. for ensuring correct administration to patients
    • GPHYSICS
    • G16INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR SPECIFIC APPLICATION FIELDS
    • G16HHEALTHCARE INFORMATICS, i.e. INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR THE HANDLING OR PROCESSING OF MEDICAL OR HEALTHCARE DATA
    • G16H20/00ICT specially adapted for therapies or health-improving plans, e.g. for handling prescriptions, for steering therapy or for monitoring patient compliance
    • G16H20/40ICT specially adapted for therapies or health-improving plans, e.g. for handling prescriptions, for steering therapy or for monitoring patient compliance relating to mechanical, radiation or invasive therapies, e.g. surgery, laser therapy, dialysis or acupuncture
    • GPHYSICS
    • G16INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR SPECIFIC APPLICATION FIELDS
    • G16HHEALTHCARE INFORMATICS, i.e. INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR THE HANDLING OR PROCESSING OF MEDICAL OR HEALTHCARE DATA
    • G16H50/00ICT specially adapted for medical diagnosis, medical simulation or medical data mining; ICT specially adapted for detecting, monitoring or modelling epidemics or pandemics
    • G16H50/70ICT specially adapted for medical diagnosis, medical simulation or medical data mining; ICT specially adapted for detecting, monitoring or modelling epidemics or pandemics for mining of medical data, e.g. analysing previous cases of other patients
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61NELECTROTHERAPY; MAGNETOTHERAPY; RADIATION THERAPY; ULTRASOUND THERAPY
    • A61N5/00Radiation therapy
    • A61N5/10X-ray therapy; Gamma-ray therapy; Particle-irradiation therapy
    • A61N2005/1092Details
    • A61N2005/1098Enhancing the effect of the particle by an injected agent or implanted device
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61NELECTROTHERAPY; MAGNETOTHERAPY; RADIATION THERAPY; ULTRASOUND THERAPY
    • A61N5/00Radiation therapy
    • A61N5/10X-ray therapy; Gamma-ray therapy; Particle-irradiation therapy
    • A61N5/1077Beam delivery systems
    • A61N5/1084Beam delivery systems for delivering multiple intersecting beams at the same time, e.g. gamma knives
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2800/00Detection or diagnosis of diseases
    • G01N2800/52Predicting or monitoring the response to treatment, e.g. for selection of therapy based on assay results in personalised medicine; Prognosis
    • YGENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02ATECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A90/00Technologies having an indirect contribution to adaptation to climate change
    • Y02A90/10Information and communication technologies [ICT] supporting adaptation to climate change, e.g. for weather forecasting or climate simulation

Definitions

  • Radiation therapy is a key therapeutic modality for patients with cancer. Radiation can be delivered to the tumor with submillimeter precision while mostly sparing normal tissue, ultimately leading to tumor cell killing. However, the tumor cell’s ability to escape the cell killing effects of radiation and/or to develop resistance mechanisms can counteract the tumor cell killing action of radiotherapy, potentially limiting the therapeutic effect of radiotherapy to treat cancer. Furthermore, the potential for normal tissue toxicity can impact the therapeutic window of radiation therapy as a treatment paradigm.
  • Treating tumors with ultra-high-dose-rate radiation may improve the therapeutic window by decreasing the normal tissue side effects while maintaining tumor toxicity when compared to conventional RT. It is possible to decrease normal tissue side effects by either increasing the dose rate or by limiting the time normal tissue is exposed to radiation. It is possible to enforce the increased therapeutic window by means of multiple discrete fields or continuous rotational delivery of ionizing radiation. Reduced side effects to the normal tissue could also allow for dose escalation in the tumor leading to enhanced tumor kill and control.
  • the therapeutic agent is an immune modulator, a senolytic agent, a radiosentizer, and/or a nanoparticle.
  • TAMs and MDSCs modify the metabolic milieu of the tumor microenvironment by producing arginase and nitric oxide that depletes L-arginine, an essential nutrient for T-cell function.
  • CTLs cytotoxic lymphocytes
  • Suppressive myeloid cells generate reactive oxygen and nitrogen species that modify receptors on cytotoxic lymphocytes (CTLs) both in the lymphoid organs and in the tumor itself, impacting the ability of CTL’s to home to tumors and kill tumor cells.
  • CTLs cytotoxic lymphocytes
  • the immune-suppressive microenvironment When treating a patient with FLASH RT, the immune-suppressive microenvironment does not have an opportunity to fully develop. With a severely limited immune-suppressive tumor microenvironment, there will be an increased immunological response to the dying tumor cells that ultimately will improve tumor cell killing. [0008] Other factors that play roles in the immune-suppressive microenvironment include tumor-infiltrating macrophages that can develop an Ml -M2 phenotype switch that can impact the killing of tumor cells. These effects are not seen with FLASH RT. Another benefit of FLASH RT is that it spares circulating immune cells from radiation induced toxicity, leading to improved immune-related tumor cell killing effects.
  • the methods described herein provide the dual benefits of anti-tumor efficacy and normal tissue protection when combining a therapeutic agent with FLASH radiation to treat cancer patients.
  • Methods described herein can be used to treat local and metastatic cancers by FLASH radiation therapy to deliver a highly conformal dose to the tumor, and an immune modulator.
  • This combination therapy has the potential to improve both the efficacy of radiation therapy both locally and systemically, and the efficacy of the immune modulators while minimizing toxicity to normal tissues.
  • Protons deposit their energy most densely at the end of their path, a mechanism that has been used to its advantage in cancer radiotherapy (Jones et al., British Journal of Radiotherapy 2006, Jakel Radiat Protection Dosimetry 2009).
  • the characteristic plot of absorbed dose as a function of penetration depth has a maximum at the location just before the particle stops, enabling the therapeutic targeting of tumors at specific depths.
  • dose deposition for electron/photon beam radiotherapy is maximal near the entrance surface of the tissue, e.g., the skin, followed by an exponential decrease with tissue depth. Due to these physical
  • proton therapy allows for high dose deposition in deep seated tumors.
  • a method for treating a tumor in a subject with cancer comprising administering an effective amount of ultra-high-dose-rate (FLASH) radiation and a therapeutic agent to the tumor.
  • FLASH ultra-high-dose-rate
  • the method reduces damage to normal tissue when compared to administering conventional radiation (e.g., a dose of 0.5 Gy/sec) to the tumor.
  • conventional radiation e.g., a dose of 0.5 Gy/sec
  • dermatitis, lung fibrosis or lymphocyte apoptosis are decreased compare to administering conventional radiation.
  • the FLASH radiation is administered at a dose rate equal to or greater than 40 Gy/sec, or the dose is administered in 1 second or less. In some embodiments, the FLASH radiation is administered in a single pulse or in multiple pulses. In some
  • the FLASH radiation comprises or consists of protons. In some embodiments, the he FLASH radiation does not comprise electrons.
  • the therapeutic agent is an immune modulator, a radiosentizer, or a nanoparticle.
  • the therapeutic agent is a mitotic spindle inhibitor, a DNA damage repair and response inhibitor, a MAPK pathway inhibitor, an epithelial to mesenchymal (EMT) inhibitor, an activator of T helper type 1 (THl) lymphocytes, an activator of the PTEN pathway, and inhibitor of the TGF-beta pathway, an activator of the type-1 interferon signaling pathway, an activator of dendritic cell maturation, an inhibitor of CD47/SIRP-alpha, or an inhibitor of the Aryl Hydrocarbon Receptor (ahR).
  • EMT epithelial to mesenchymal
  • THl T helper type 1 lymphocytes
  • PTEN PTEN pathway
  • TGF-beta pathway an activator of the type-1 interferon signaling pathway
  • an activator of dendritic cell maturation an inhibitor of CD47/SIRP-alpha
  • ahR Aryl Hydrocarbon Receptor
  • the mitotic spindle inhibitor is selected from a CDK4/6 inhibitor, an AURKA inhibitor, a TPX2-AURKA complex inhibitor, or a taxane.
  • the DNA damage repair and response inhibitor is selected from a PARP inhibitor, a RADS 1 inhibitor, or an inhibitor of a DNA damage response kinase selected from CHCK1, ATM, or ATR.
  • the MAPK pathway inhibitor is an inhibitor of EGFR, MEK, BRAF, or ERK.
  • the EMT inhibitor is a TGFP-pathway inhibitor selected from a compound, small molecule, antibodies or fragments thereof that bind TGF-beta.
  • the activator of T helper type 1 (THl) lymphocytes is a cytokine, a toll-like receptor agonist, a STATS modulator, compounds derived from inactivated bacteria/ or parasites or their derivatives that trigger interferon gamma or IL-12 production, included but not limited to Listeria monocytogenes, Ieisbmania major and Toxoplasma gondii, Mycobacterium tuberculosis, staphylococcus enteroxin B and unmethylated CpG nucleotides that activate a Thl response in the body, or gene therapy systems including bacterial or virus based gene expression systems that lead to production of IL2, IL-12 and IFN-gamma when injected at the tumor site.
  • a cytokine included but not limited to Listeria monocytogenes, Ieisbmania major and Toxoplasma gondii, Mycobacterium tuberculosis, staphylococcus enteroxin B and unmethylated CpG nucleo
  • the activator of the PTEN pathway is selected from an mTOR inhibitor selected from rapamycin, temsirolimus, everolimus, sirolimus or AP-2357;
  • the inhibitor of the TGF-beta pathway is selected from a compound, small molecule, antibodies or fragments thereof that bind TGF-beta.
  • the activator of the type-1 interferon signaling pathway is a
  • STING agonist an Toll-like receptor (TLR) agonist, or a MAYS agonist.
  • TLR Toll-like receptor
  • the activator of dendritic cell maturation is a synthetic peptide vaccine.
  • the inhibitor of CD47/SIRP-alpha is selected from an antibody or fragment thereof, or a small molecule compound that inhibits the CD47/DSIRP-alpha interaction.
  • the nanoparticle has a high effective atomic number, or comprises gold or gadolinium.
  • the ahR inhibitor is SRI, CH-223191, UM729, or Galangin.
  • a method for treating a tumor in a subj ect with cancer comprising administering ionizing FLASH radiation and an immune modulator to the tumor, wherein the immune modulator is selected from the group consisting of an inhibitor to an inhibitory checkpoint molecule, an activator of a stimulatory checkpoint molecule, a chemokine inhibitor, an inhibitor of macrophage migration inhibitory factor (MIF), a growth factor, a cytokine, an interleukin, an interferon, an antibody that binds to an immune system cell, a cellular immune modulator, a vaccine, an oncolytic virus, and any combination thereof.
  • the immune modulator is selected from the group consisting of an inhibitor to an inhibitory checkpoint molecule, an activator of a stimulatory checkpoint molecule, a chemokine inhibitor, an inhibitor of macrophage migration inhibitory factor (MIF), a growth factor, a cytokine, an interleukin, an interferon, an antibody that binds to an immune system cell, a
  • the inhibitor to the inhibitory checkpoint molecule is a small molecule drug, or an antibody or a fragment thereof that specifically binds to the inhibitory checkpoint molecule and inhibits its activity, wherein the inhibitory checkpoint molecule is selected from the group consisting of PD-1, PD-L1, PD-L2, CTLA-4, BTLA, A2aR, B7-H2, B7- H3, B7-H4, B7-H6, CD47, CD48, CD160, CD244 (2B4), CHK1, CHK2, CGEN-15049, ILT-2, ILT-4, LAG-3, VISTA, gp49B, PIR-B, TIGIT, ⁇ M1, TIM2, TIM3, ⁇ M4, and KIR, and ligands thereof.
  • the activator of the stimulatory checkpoint molecule is a small molecule drug, polypeptide-based activator, or polynucleotide-based activator that specifically binds to the stimulatory checkpoint molecule and increases its activity, wherein the stimulatory checkpoint molecule is selected from the group consisting of B7-1 (CD80), B7-2 (CD86), 4-1BB (CD137), 0X40 (CD134), HVEM, inducible costimulator (ICOS), glucocorticoid-induced tumor necrosis factor receptor (GITR), CD27, CD28, CD40, and ligands thereof.
  • the chemokine inhibitor is a small molecule drug, or antibody or fragment thereof that specifically binds to the chemokine (or its receptor) and inhibits chemokine activity.
  • the chemokine is selected from the group consisting of CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL12, CCL13, CCL14, CCL15, CCL16, CCL17, CCL18, CCL19, CCL20, CCL21, CCL22, CCL23, CCL24, CCL5, CCL26, CCL27, CCL28, CXCL1, CXCL2, CXCL3, CXCL4, CXCL5, CXCL6, CXCL7, CXCL8, CXCL9, CXCL10, CXCL11, CXCL12, CXCL13, CXCL14, CXCL5, and CXCL16.
  • the chemokine inhibitor binds to a chemokine receptor selected from the group consisting of CCR1, CCR2, CCR3, CCR, 4, CCR5, CCR6, CCR7, CCR8, CCR9, CCR10, CXCR1, CXCR2, CXCR3,
  • the inhibitor of MIF is a small molecule drug, or antibody or fragment thereof that specifically binds to MIF and inhibits MIF activity.
  • a method for treating a tumor in a subject with cancer comprising administering FLASH radiation and an immune modulator to the tumor.
  • the immune modulator can be an antibody or antibody fragment targeting CD44, MMP9, ALDH1A1, Vimentin, hyaluronan, beta-catenin, MFG-E8, CD68, TORb, a TGFb-pathway related biomarker, or any combination thereof.
  • Also provided herein are improved methods for treating a tumor that include administering an immune modulator and FLASH radiation to the subject with cancer.
  • This combination therapy can elicit an increased anti-cancer response compared to immune modulator monotherapy or conventional radiation monotherapy.
  • Immumunomodulatory agents to be combined with FLASH include, but are not limited, to checkpoint inhibitors, co-stimulators, broad immune modulators modulating the adenosine pathway or STING (Stimulating Interferon Genes) pathways, bispecific antibodies targeting both immune cell antigens and cancer antigens, and cell therapy approaches (e.g., chimeric antigen receptor (CAR) therapies).
  • checkpoint inhibitors co-stimulators
  • bispecific antibodies targeting both immune cell antigens and cancer antigens e.g., chimeric antigen receptor (CAR) therapies.
  • CAR chimeric antigen receptor
  • the positive effects of FLASH RT are enhanced by combining FLASH RT with delivery of an immunotherapy agent as a concomitant, adjuvant, or neoadjuvant procedure.
  • an immunotherapy agent as a concomitant, adjuvant, or neoadjuvant procedure.
  • the immunomodulating properties of FLASH RT described herein can be enhanced and provide further benefit to a patient or subj ect in need of treatment when used in combination with immunomodulatory agents.
  • the combination of FLASH RT and immunotherapy can be incorporated into radiation treatment planning as well as in the treatments themselves.
  • the combination of FLASH RT and an immune modulator described herein can also be combined with personalized medicine treatment protocols.
  • the methods include detecting the expresssion of one or more biomarkers in the subject.
  • the one or more biomarkers are selected from CD44, MMP9, ALDH1 Al,
  • methods include radiomics information such as tumor phenotype.
  • methods include functional imaging information, including but not limited to PET, SPECT, and fMRI.
  • a method for treating a tumor in a subject with cancer comprising administering ionizing FLASH radiation and an immune modulator to the tumor.
  • the method comprises (a) determining an expression level of one or more biomarkers in a tumor sample from the subject, wherein the one or more biomarkers are selected from the group consisting of an immune cell markers), tumor cell markers), circulating markers), and any combination thereof; (b) comparing the expression level of the one or more biomarkers to an expression level of the one or more biomarkers in a normal tissue sample; and (c) administering to the tumor in the subject a treatment comprising ionizing FLASH radiation and an immune modulator if the expression level of the one or more biomarkers in the tumor sample is modified compared to the expression level in the normal tissue sample.
  • the biomarker can be CD44, MMP9, ALDH1A1, Vimentin, hyaluronan, beta-catenin, MFG-E8, CD68, TORb, a TORb- pathway related biomarker, or any combination thereof.
  • a method for example an in-vitro method, of identifying a subject with cancer as a candidate for treatment comprising ionizing FLASH radiation and an immune modulator.
  • the method includes: (a) determining an expression level of one or more biomarkers in a tumor sample from the subject, wherein the one or more biomarkers are selected from the group consisting of an immune cell markers), tumor cell markers), circulating markers), imaging markers), and any combination thereof; (b) comparing the expression level of the one or more biomarkers to an expression level of the one or more biomarkers in a normal tissue sample; and (c) classifying the subject as a candidate for treatment comprising ionizing FLASH radiation and the immune modulator if the expression level of the one or more biomarkers in the tumor sample is modified compared to the expression level in the normal tissue sample.
  • the biomarker can be CD44, MMP9, ALDH1 Al, Vimentin, hyaluronan, beta-catenin, MFG-E8, CD68, TORb, a TGFP-pathway related biomarker, or any combination thereof.
  • a method for example an in-vitro method, of selecting a treatment for a subject with cancer.
  • the method comprises: (a) determining an expression level of one or more biomarkers in a tumor sample from the subject, wherein the one or more biomarkers are selected from the group consisting of an immune cell markers), tumor cell markers), circulating markers), and any combination thereof; (b) comparing the expression level of the one or more biomarkers to an expression level of the one or more biomarkers in a normal tissue sample; and (c) selecting a treatment comprising ionizing FLASH radiation and an immune modulator if the expression level of the one or more biomarkers in the tumor sample is modified compared to the expression level in the normal tissue sample.
  • the biomarker can be CD44, MMP9, ALDH1A1, Vimentin, hyaluronan, beta-catenin, MFG-E8, CD68, TORb, a TGFP-pathway related biomarker, or any combination thereof.
  • the subject is administered ionizing FLASH radiation and/or combination therapy comprising ionizing FLASH radiation and an immune modulator if the expression level of CD44 is increased and/or the expression level of MFG-E8 is decreased relative to the expression level in a normal or control sample.
  • the amount of ionizing FLASH radiation and/or the amount of an immune modulator administered to the subject is increased if the expression level of CD44 is increased and/or the expression level of MFG-E8 is decreased relative to the expression level in a normal or control sample.
  • the amount of ionizing FLASH radiation and/or the amount of an immune modulator administered to the subject can be decreased if the expression level of CD44 is decreased and/or the expression level of MFG-E8 is increased relative to the expression level in a normal or control tissue sample.
  • treatment comprising ionizing FLASH radiation and an immune modulator is selected if the expression level of CD44 is increased and/or the expression level of MFG-E8 is decreased relative to the expression level in a normal or control sample; (b) the amount of ionizing FLASH radiation and/or the amount of an immune modulator selected is increased if the expression level of CD44 is increased and/or the expression level of MFG-E8 is decreased relative to the expression level in a normal or control sample; and (c) the amount of ionizing FLASH radiation and/or the amount of an immune modulator selected is decreased if the expression level of CD44 is decreased and/or the expression level of MFG-E8 is increased relative to the expression level in a normal or control tissue sample.
  • the subject is administered ionizing FLASH radiation and/or combination therapy comprising ionizing FLASH radiation and an immune modulator if the expression level of CD68 is increased relative to the expression level in a normal or control tissue sample.
  • the amount of ionizing FLASH radiation and/or the amount of an immune modulator administered to the subject is increased if the expression level of CD68 is increased relative to the expression level in a normal or control tissue sample.
  • the amount of ionizing FLASH radiation and/or the amount of an immune modulator administered to the subject can be decreased if the expression level of CD68 is decreased relative to the expression level in a normal or control tissue sample.
  • treatment comprising ionizing FLASH radiation and an immune modulator is selected if the expression level of CD68 is increased relative to the expression level in a normal or control tissue sample;
  • the amount of ionizing FLASH radiation and/or the amount of an immune modulator selected is increased if the expression level of CD68 is increased relative to the expression level in a normal or control tissue sample;
  • the amount of ionizing FLASH radiation and/or the amount of an immune modulator selected can be decreased if the expression level of CD68 is decreased relative to the expression level in a normal or control tissue sample.
  • the use comprises a combination of ionizing FLASH radiation and a therapeutic agent selected from an immune modulator described herein, a senolytic agent, and/or a radiosensitizer described herein.
  • the disclosure provides a therapeutic agent for use in a method of treating a tumor in a subject with cancer, characterized in that the method comprises
  • a therapeutic agent in combination with ultra-high dose rate (FLASH) radiation for use in the treatment of cancer or a tumor is provided.
  • FLASH ultra-high dose rate
  • the disclosure provides a therapeutic agent for use in a method of treating a tumor in a subject with cancer, characterized in that the therapeutic agent is administered in combination with FLASH radiation.
  • the disclosure provides a therapeutic agent for use in a method of treating a tumor in a subject with cancer, wherein the therapeutic agent is administered to a heightened immune competent tumor environment caused by said FLASH radiation.
  • the disclosure provides a hedgehog antagonist for use in a method of treating a tumor in a subject with cancer, characterized in that the hedgehog antagonist is administered in combination with FLASH radiation.
  • a therapeutic agent for use in a method of treating a tumor in a subject with cancer characterized in that the method comprises:
  • biomarkers are selected from the group consisting of an immune cell markers), tumor cell markers), circulating markers), and any combination thereof;
  • a method for treating a tumor in a subject comprising: i) detecting expression of a biomarker described herein in the tumor microenvironment or a tumor sample from a subject, and
  • the expression level of the biomarker(s) described herein is compared to the expression level detected in a normal or control (e.g., non-tumor) tissue in the subject.
  • a method for treating a tumor in a subject comprising: i) contacting a tumor sample from the subject with an antibody that binds to a biomarker described herein;
  • the modified biomarker expression comprises increased and/or decreased expression levels of the biomarker.
  • the biomarker is selected from the group consisting of CD44, MMP9, ALDH1 Al, Vimentin, hyaluronan, beta-catenin, MFG-E8 and CD68.
  • the expression level of biomarker CD68 is increased in the tumor environment or in the tumor sample.
  • the expression level of biomarker CD44 is increased in the tumor environment or in the tumor sample.
  • the expression level of biomarker CD44 is increased and the expression level of
  • MFG-E8 is decreased in the tumor environment or in the tumor sample.
  • the method further comprises detecting the expression level of a biomarker described herein in a normal tissue sample. In some embodiments, the expression level of the biomarker is detected with an antibody that binds to the biomarker(s).
  • a radiation treatment system is provided. In some embodiments, the radiation treatment system provides radiation treatment for a subject or patient in need thereof. In some embodiments, the radiation treatment system further comprises an immunotherapy system that treats the patient with a therapeutic agent in coordination with the radiation treatment. In some embodiments, the radiation treatment is FLASH RT. [0053] In another aspect, a radiation treatment planning system is described, the radiation treatment planning system operable for generating a radiation treatment plan that also includes immunotherapy performed in coordination with the radiation treatment. In some embodiments, the radiation treatment is FLASH RT.
  • a non-transitory computer-readable storage medium having computer-executable instructions for causing a computing system to perform a method of ultra- high-dose-rate (FLASH) radiation treatment planning for treating a tumor in combination with a therapeutic agent.
  • said method comprises adjusting beam parameters using information about treatment of the tumor with a therapeutic agent.
  • a non-transitory computer-readable storage medium having computer-executable instructions for causing a computing system to perform a method of ultra-high-dose-rate (FLASH) radiation treatment planning for treating a tumor in combination with a therapeutic agent, the method comprising: accessing values of parameters from memory of the computing system, wherein the parameters comprise directions of beams to be directed into sub-volumes in a target and beam energies for the beams;
  • FLASH ultra-high-dose-rate
  • accessing information that specifies limits for the radiation treatment plan, wherein the limits are based on a dose threshold and comprise a limit on irradiation time for each sub-volume outside the target;
  • the information that specifies limits comprises information about treatment of the tumor with a therapeutic agent
  • each portion of the beams that is in the target is represented as a respective set of longitudinal beam regions, and wherein the method further comprises:
  • said adjusting further comprises adjusting the parameters that affect the calculated amounts of dose to be delivered by the beam regions until differences between respective total values for the sub-volumes satisfy the threshold value.
  • said adjusting further comprises: determining whether a beam overlaps any other beams outside the target; and weighting beam intensities for beam segments of the beam according to how many other beams are overlapped by the beam outside the target.
  • the method further comprises performing a dose calculation for an outside-the-target sub-volume, wherein said performing a dose calculation comprises: accessing a value for a dose calculation factor for the outside-the-target subvolume, wherein the value for the dose calculation factor is determined according to how many beams reach the outside-the-target sub-volume; calculating a dose for the outside-the-target sub-volume; and
  • the dose calculation factor reduces the dose calculated for the outside-the-target sub-volume if only one beam reaches the outside-target sub-volume.
  • the limits are selected from the group consisting of: a limit on irradiation time for each sub-volume in the target; a limit on dose rate for each sub-volume in the target; and a limit on dose rate for each sub-volume outside the target.
  • the dose threshold is further dependent on tissue type.
  • the beams comprise a type of beam selected from the group consisting of: proton; electron; photon; atom nuclei; and ion.
  • a computer-implemented method of radiation treatment planning for treating a tumor in combination with a therapeutic agent comprises determining beam parameters for ultra-high-dose-rate (FLASH) radiation, the method using a prescribed dose based on response of the tumor to a therapeutic agent.
  • FLASH ultra-high-dose-rate
  • the computer-implemented method of radiation treatment planning comprises: determining a prescribed dose of ultra-high-dose-rate (FLASH) radiation to be delivered into and across a tumor target, wherein the prescribed dose is determined based on a response of the tumor to a therapeutic agent;
  • FLASH ultra-high-dose-rate
  • each of the beams comprises a plurality of beam segments
  • the method comprises:
  • each of the beams in the target as a respective set of longitudinal beam regions, wherein each beam region in the set has a value corresponding to a calculated amount of dose to be delivered by the beam region;
  • the method comprises: accessing a value for the dose calculation factor for an outside-the-target subvolume, wherein the value for the dose calculation factor is determined according to how many beams reach the outside-the-target sub-volume;
  • the method comprises using a dose threshold to specify limits for the radiation treatment plan, wherein the limits are selected from the group consisting of: a limit on irradiation time for each sub-volume in the target; a limit on irradiation time for each sub-volume outside the target; a limit on dose rate for each sub-volume in the target; and a limit on dose rate for each sub-volume outside the target.
  • the dose threshold is dependent on a plurality of biological factors including but not limited to tissue type and/or immunological profile.
  • the beams comprise a type of beam selected from the group consisting of: proton; electron; photon; atom nuclei; and ion.
  • ultra-high-dose-rate (FLASH) radiation in combination with a therapeutic agent for treating cancer or a tumor in a subject in need thereof is provided.
  • ultra-high-dose-rate (FLASH) radiation in combination with a therapeutic agent for use in the treatment of cancer or a tumor is provided.
  • the therapeutic agent can be an immune modulator, a senolytic agent, a radiosensitizer, and/or a nanoparticle.
  • a method for reducing activation of the hedgehog signaling pathway in a subject comprises administering a therapeutically effective amount of ultra-high-dose-rate (FLASH) radiation to the subject, where activation of the hedgehog signaling pathway is reduced compared to administering conventional proton radiation therapy to the subject.
  • the subject has cancer or a tumor.
  • the method comprises administering a therapeutically effective amount of ultra-high-dose-rate (FLASH) radiation to a tumor in the subject.
  • FLASH radiation is administered as proton therapy, or the FLASH radiation comprises or consists of protons.
  • the expression of genes activated by the hedgehog signaling pathway is decreased when FLASH radiation is administered to the subject compared to administering conventional proton radiation therapy.
  • the expression of one or more genes selected from CELSR1, TLE3, OPHN1, GPR56, PTCH1, TLE1, MYH9, RASA1, HEY1, ETS2, HEY2, LDB1, UNC5C, NF1, CDK6, VLDLR, NRP2, DPYSL2, and NRP1 is decreased when FLASH radiation is administered to the subject compared to
  • the expression of one or more proteins encoded by genes selected from CELSR1, TLE3, OPHN1, GPR56, PTCH1, TLE1, MYH9, RASA1, HEY1, ETS2, HEY2, LDB1, UNC5C, NF1, CDK6, VLDLR, NRP2, DPYSL2, and NRP1 is decreased when FLASH radiation is administered to the subject compared to administering conventional proton radiation therapy.
  • the expression of one or more genes encoding proteins having an amino acid sequence selected from SEQ ID Nos: 15-70 is decreased when FLASH radiation is administered to the subject compared to administering conventional proton radiation therapy.
  • the expression of one or more proteins having an amino acid sequence selected from SEQ ID Nos: 15-70 is decreased when FLASH radiation is administered to the subject compared to administering conventional proton radiation therapy.
  • the expression of one or more genes encoding a protein in Table 7 is decreased when FLASH radiation is administered to the subject compared to administering conventional proton radiation therapy.
  • the expression of one or more proteins in Table 7 is decreased when FLASH radiation is administered to the subject compared to administering conventional proton radiation therapy.
  • the method further comprises administering a therapeutically effective amount of a hedgehog antagonist to the subject.
  • the hedgehog antagonist is selected from a Smo antagonist, a PTCH1 inhibitor, Cyclopamine, Vismodegib, LDE 225, saridegib, BMS 833923, LEQ 506, PF- 04449913 , PF-5274857, GANT61, SANT-1, Glasdegib (PF-04449913), Taladegib (LY2940680) or TAK-441.
  • the subject has cancer or a tumor.
  • the method comprises administering a therapeutically effective amount of ultra-high-dose-rate (FLASH) radiation and a therapeutically effective amount of a hedgehog antagonist, to a tumor in the subject.
  • FLASH ultra-high-dose-rate
  • FIG. 1. illustrates a cross-sectional view of a sample beam geometry in an embodiment described herein.
  • FIG. 2. shows a representative dose surface plot as an example of the variables used to determine dose threshold in an embodiment described herein.
  • FIG. 3. is a block diagram of an example of a computing system upon which the embodiments described herein may be implemented.
  • FIG. 4. is a block diagram illustrating an example of an automated radiation treatment planning system in an embodiment described herein.
  • FIG. 5 shows the experimental design for normal tissue toxicty studies in control mice (sham treated) and mice treated with conventional, FLASH, and split-Flash radiation.
  • FIG. 6 shows improved lung function for FLASH when compared to Conventional radiation treatment.
  • FIG. 7 shows an improved median survival for FLASH over Conventional radiation treament groups: 20.0 Gy: 14% increase; 17.5 Gy: 18% increase.
  • FIG. 9 shows a reduction in average dermatitis for FLASH when compared to
  • FIG. 10 shows a 23% reduction in average lung fibrosis severity for FLASH over Conventional group at 17.5 Gy.
  • FIG. 11 shows an increased average lung weight for Conventional when compared to FLASH treatment - 0.46 g vs. 0.40 g (M); 0.37 g vs. 0.32 g (F)).
  • FIG. 12A-D shows Venn Diagrams of Differentially Expressed genes at each time point.
  • FIG. 13A-D shows overlap of GSEA Hallmark pathways between three treatment groups.
  • A) GSEA at 24 hours B) 8 weeks C) 16 weeks D) 24 weeks with FDR-q values ⁇ 0.25 and adjusted p-values ⁇ 0.05.
  • Underlined text denotes downregulated while italicized text denotes upregulated pathways relative to Sham treated samples.
  • FIG. 14A-D shows Hallmark Mitotic Spindle enrichment plots and core enrichment genes for Split Flash-Sham and Flash-Sham GSEA analysis.
  • FIG. 15A and 15B show Flash Specific DNA repair signature and core enrichment genes: A) (Top left): Enrichment plot of DNA repair signature (Bottom Left): Enrichment statistics for DNA Repair Signature. B) Gene expression heatmap of core Enrichment genes in the Hallmark DNA repair signature.
  • FIG. 16A-C shows Flash Specific KRAS Signaling Up 8 Weeks-24 Weeks: (Top):
  • FIG. 17A-C shows EMT Signature and Core enrichment gene analysis: EMT
  • FIG. 18 shows a pie chart representing various canonical pathways found to be regulated by different radiation regimens at 24 Hr. Analysis was done on filtered list of genes having p value of ⁇ 0.05. samples. Pathways presented here and listed in Table 6 have p value ⁇ 0.05, FDR ⁇ 0.1 and Z score of >1.5. Underlined text denotes downregulated while italicized text denotes upregulated pathways relative to Sham treated samples.
  • FIG. 19 shows a heat map of comparative analysis of major canonical pathways regulated by both Flash and Conventional radiation treatment as analyzed by IP A. P value 0.05 and Z score of >1.5. pathways found to be differentially regulated between these treatment regimens were mostly involved in inflammation and immune regulation.
  • FIG. 20 shows a pie chart representing various canonical pathways found to be regulated by different radiation regimens at 16 weeks. Analysis was done on filtered list of genes having p value of ⁇ 0.05. samples. Pathways presented here and listed in Table 4 have p value ⁇ 0.05, FDR ⁇ 0.1 and Z score of >1.5. Underlined text denotes downregulated while italicized text denotes upregulated pathways relative to Sham treated samples.)
  • FIG. 21 shows a heat map of comparative analysis of major canonical pathways regulated by both Flash and Conventional radiation treatment at 16 weeks as analyzed by IP A. P value 0.05 and Z score of >1.5. pathways found to be differentially regulated between these treatment regimens were mostly involved in inflammation and immune regulation.
  • FIG. 22 shows the result of QuPath cell detection applied to a DAPI image.
  • FIG. 23 A and B shows (A) the original FITC image, and (B) the segmented TUNEL positive cells.
  • the Fiji distribution of Image! was used to quantify the number of TUNEL positive cells in each field of view.
  • a gaussian blur was first applied to the image, and then thresholding was used to segment the objects.
  • FIG. 24 is a graph showing the TUNEL results. The graph shows the average number of counts per animal for the roughly 20 animals per group (males and females pooled). [0099] Fig. 25 shows differential gene expression and pathway analysis of FLASH versus
  • Fig. 25A shows a volcano plot of top differentially expressed genes. Red dots represents genes with FDR values less than 5%, for clarity labeled genes represent genes with greater than a 1.3 log fold change in expression.
  • Fig. 25B shows a table of the top GSEA Hallmarks enriched between FLASH and Conventional radiation.
  • Fig. 25C shows an enrichment plot and the top 50 leading edge genes for GSEA’s
  • FIG. 25D shows IPA result for the top enriched pathways in a microarray dataset between FLASH and Convectional radiation treated samples.
  • the term“treating” refers to administering a treatment to a tumor or the subject diagnosed with a tumor.
  • the treatment can be administered in an amount or therapeutic dose that is sufficient or effective to kill tumor cells (i.e., a therapeutically effective amount), slow the growth of the tumor, reduce the size of the tumor, or eliminate the tumor from the subject entirely.
  • treatments include ionizing radiation, such as FLASH radiation therapy, a therapeutic agent, an immune modulator agent, a senolytic agent, a radiosensitizer, a nanoparticle or combinations thereof.
  • the term also includes selecting a treatment or treatment plan, and providing treatment options to a healthcare provider or the subject.
  • the term“therapeutic agent” refers to an agent such as a small molecule drug or biologic drug that can be used to treat a tumor, and can include an immune modulator, a senolytic agent, a radiosensitizer, or a nanoparticle.
  • the therapeutic agent can be an agent approved by a regulatory agency for treating tumors or cancer, undergoing clinical trials prior to regulatory approval, or that is under investigation for treating tumors or cancer.
  • the therapeutic agent can be combined with radiation therapy, such as conventional or FLASH radiation therapy, to treat a tumor. In some embodiments, the therapeutic agent is combined with FLASH radiation therapy to treat a tumor.
  • ionizing radiation refers to radiation comprising particles having enough kinetic energy to discharge an electron from an atom or molecule, thereby producing an ion.
  • the term includes both directly ionizing radiation, such as that caused by atomic particles such as alpha particles (helium nuclei), beta particles (electrons), and protons, and indirectly ionizing radiation, such as photons, including gamma rays and x-rays.
  • directly ionizing radiation such as that caused by atomic particles such as alpha particles (helium nuclei), beta particles (electrons), and protons
  • indirectly ionizing radiation such as photons, including gamma rays and x-rays.
  • Examples of ionizing radiation used in radiation therapy include high energy x-rays, electron beams, ion beams, and proton beams.
  • the terms“FLASH”,“FLASH radiation” or“FLASH Radiation Therapy (FLASH RT)” refer to ultra-high-dose-rate radiation that is administered to a subj ect or patient as therapy.
  • the dose can be administered to a subject or patient in need of treatment in one to many short pulses at an ultra-high dose rate.
  • the entire radiaiton dose is delivered in a total“beam-on” time of no more than one second.
  • FLASH refers to a mode of administering ionizing radiation at a dose rate which ensures all normal tissue irradiation occurs in 1 second or less for the delivery of the entire dose prescription.
  • a dose prescription of 20 Gray (Gy) would require a dose rate of at least 20 Gy per second for a single irradiation direction, 10 Gy per second for 2 irradiation directions, 5 Gy per second for 4 irradiation directions, and so on.
  • the number of fields can reduce the dose rate to satisfy the FLASH irradiation conditions so long as either the fields do not overlap or overlapping fields are delivered in the 1 second or less time frame.
  • Pulsed FLASH is mode of administering ionizing radiation at a dose rate which results in the total active delivery time to normal tissue for a prescribed dose of ionizing radiation in 1 second or less, with allowance for repeated irradiation of the same normal tissue volume in a single treatment session or fraction.
  • a 20 Gy prescription would be delivered in 1 second or less of active irradiation time, but could be divided in to 5 pulses of 4 Gy spaced 1 second apart, each pulse delivered in 0.2 seconds, or 20 Gy per second per pulse.
  • Another example is 10 pulses of 2 Gy having a duration of 0.1 seconds spaced 2 seconds apart, or 20 Gy per second per pulse.
  • Pulsed FLASH allows for freedom of duty cycle selection for the delivery so long as the total active delivery time of 1 second or less is enforced for a single treatment session. Pulse separation can vary from an interval between pulses of less than a second to several minutes.
  • Fractionated FLASH is the delivery of FLASH or pulsed FLASH ionizing radiation over the course of a longer time interval. This time interval can be hours to days following the established clinical protocols for fractionated radiation therapy, with the actual treatment delivery being either FLASH or pulsed FLASH.
  • inventions refers to a dose of 0.5 Gy per second, for example 20 Gy in 40 seconds, 17.5 Gy in 35 seconds, or 15 Gy in 30 seconds (0.5 Gy/sec).
  • tumor environment or“tumor micro-environment” refers to the immediate small-scale environment of an organism or part of an organism, especially as a distinct part of a larger environment, for example, the immediate small-scale environment of the tumor.
  • the term includes not only the tumor cells themselves, but associated blood-vessels (including endothelial cells and smooth muscle cells), immune system cells and secreted cytokines, epithelial cells, fibroblasts, connective tissue, and/or extracellular matrix that is associated with or surrounds the tumor.
  • the term also refers to the cellular and extracellular environment in which the tumor is located.
  • the term“standard of care” or“standard radiation treatment protocol” in radiation therapy generally refers to the ionizing radiation dose and administration interval that is generally accepted in the medical field as appropriate treatment for a given tumor, based on the tumor type, size, tissue location, and various other biological parameters.
  • the standard of care or standard treatment protocol varies and is dependent on several factors. For example, for radiation therapy of lung cancer, the standard of care includes multiple fractions (e.g., approximately 30 fractions of low dose radiation, or approximately 60 Gy over 6 weeks) or a smaller number of fractions (e.g., 1-5 fractions) of biologically active doses (e.g., 54 GY in 3 fractions for peripheral tumors, or 48-60 Gy in 4-8 fractions for central tumors) administered to the tumor.
  • the term“similar dose of ionizing radiation” refers to a dose of ionizing radiation that is identical to, nearly the same, or substantially the same as the effective dose administered to a tumor in another subject, or administered to a tumor in the same subject undergoing an existing course of treatment.
  • the term encompasses the normal and expected variation in ionizing radiation doses delivered by a medical technician skilled in the art of administering ionizing radiation to a tumor in a subject.
  • the term encompasses variation in the effective dose administered to a tumor of less than 10%, less than 5%, or less than 1%.
  • the subject can be a human or non-human animal, such as a companion animal (e.g., cat, dog) or farm animal (e.g., cow, horse, etc.).
  • expression level refers to the amount or level and/or the presence or absence of a biomarker described herein.
  • small molecule drug refers to an organic compound having a molecular weight of less than about 50 kDa, less than about 10 kDa, less than about 1 kDa, less than about
  • the term includes drugs having desired
  • pharmacological properties and includes compounds that can be administered orally or by injection.
  • radiosensitizef refers to any substance that makes tumor cells easier to kill with radiation therapy.
  • exemplary radiosensitizers include hypoxia radiosensitizers such as misonidazole, metronidazole, and trans-sodium crocetinate, and DNA damage response inhibitors such as Poly (ADP) ribose polymerase (PARP) inhibitors.
  • hypoxia radiosensitizers such as misonidazole, metronidazole, and trans-sodium crocetinate
  • DNA damage response inhibitors such as Poly (ADP) ribose polymerase (PARP) inhibitors.
  • tissue damage refers to a decrease in tissue damage when administering FLASH radiation versus conventional radiation to a subject.
  • the decreased tissue damage can be determined by measuring or quantifying a cellular or tissue response to irradiation, such as but not limited to dermatitis, fibrosis, cell death, or respiratory disorder.
  • reduced tissue damage refers to a decrease in tissue damage of at least about 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50% or more in the cellular or tissue response to irradiation when administering FLASH versus conventional radiation to a subject.”
  • sample refers to bodily fluid, such as but not limited to blood, serum, plasma, or urine, and/or cells or tissues obtained from a subject or patient.
  • sample is a formalin-fixed and paraffin embedded tissue or tumor sample.
  • sample is a frozen tissue or tumor sample.
  • tumor sample can be a biopsy comprising tumor cells from the tumor.
  • subject or patient is an animal or mammal.
  • subject or patient is a human.
  • the term“about” refers to variation in measurements of any value described herein, or administered doses described herein, typically encountered by one of ordinary skill in the art.
  • the term“about” includes variation of plus or minus 0.1, 0.5, 1.0, 2.0, 3.0, 4.0 , 5.0, 6.0, 7.0, 8.0, 9.0, or 10.0 percent of any value described herein. Any value described herein is considered modified by the term“about” whether or not the term“about” is used. Any numerical range described herein includes the endpoints and all values in between the endpoints. For example, the range of about 1 to 10 includes about 1.0, about 1.1, about 1.2, . . . about 9.8, about 9.9, or about 10.0.
  • the methods described herein provide the advantages of anti-tumor efficacy and normal tissue protection when combining a therapeutic agent such as an immune modulator, senolytic agent, radiation sensitizer or nanoparticle with FLASH radiation to treat cancer patients.
  • the methods described herein provide the unexpected result that FLASH radiation in combination with a therapeutic agent (e.g., immune modulator therapy) can increase the antitumor response compared to treatment with FLASH radiation therapy or the therapeutic agent therapy alone (monotherapy).
  • the increase in the anti-tumor response can enhance or increase the inhibition of tumor growth that is provided by either monotherapy alone.
  • Methods described herein can be used to treat local and metastatic cancers by administering FLASH radiation therapy to deliver a highly conformal dose to the tumor, and a therapeutic agent.
  • the combination therapy described herein can improve both the efficacy of FLASH radiation therapy (locally and systemically) and the efficacy of the therapeutic agent therapy.
  • the therapeutic agent or immune modulator also enhances the anti-cancer response when administered in combination with FLASH radiation, compared to administration of either the therapeutic agent alone or FLASH radiation monotherapy.
  • the methods described herein can also increase the anti-tumor response compared to treatment with conventional radiation therapy or therapeutic agent therapy alone (monotherapy).
  • a method for treating a tumor in a subject with cancer comprising administering FLASH RT and an immune modulator to the tumor.
  • the immune modulator can be selected from the group consisting of an inhibitor to an inhibitory checkpoint molecule, an activator of a stimulatory checkpoint molecule, a chemokine inhibitor, an inhibitor of macrophage migration inhibitory factor (MIF), a growth factor, a cytokine, an interleukin, an interferon, an antibody that binds to an immune system cell, such as a bispecific antibody that binds to T-cells and a tumor antigen, a cellular immune modulator such as a CAR-T cell, a vaccine, an oncolytic virus, and any combination thereof.
  • MIF macrophage migration inhibitory factor
  • a growth factor such as a bispecific antibody that binds to T-cells and a tumor antigen
  • a cellular immune modulator such as a CAR-T cell, a vaccine, an oncolytic virus, and any combination thereof
  • the inhibitor to the inhibitory checkpoint molecule is a small molecule drug, or an antibody or a fragment thereof that specifically binds to the inhibitory checkpoint molecule and inhibits its activity, wherein the inhibitory checkpoint molecule is selected from the group consisting of PD-1, PD-L1, PD-L2, CTLA-4, BTLA, A2aR, B7-H2, B7-H3, B7-H4, B7-H6, CD47, CD48, CD160, CD244 (2B4), CHK1, CHK2, CGEN- 15049, ILT-2, ILT-4, LAG-3, VISTA, gp49B, PIR-B, TIGIT, TIM1, TIM2, TIMS, TIM4, and KIR, and ligands thereof.
  • the inhibitory checkpoint molecule is selected from the group consisting of PD-1, PD-L1, PD-L2, CTLA-4, BTLA, A2aR, B7-H2, B7-H3, B7-H4, B7-
  • the activator of the stimulatory checkpoint molecule is a small molecule drug, polypeptide-based activator, or polynucleotide-based activator that specifically binds to the stimulatory checkpoint molecule and increases its activity, wherein the stimulatory checkpoint molecule is selected from the group consisting of B7-1 (CD80), B7-2 (CD86), 4-1BB (CD137), OX-40 (CD134), HVEM, inducible costimulator (ICOS), glucocorticoid-induced tumor necrosis factor receptor (GITR), CD27, CD28, CD40, and ligands thereof.
  • the chemokine inhibitor is a small molecule drug, or antibody or fragment thereof that specifically binds to the chemokine (or its receptor) and inhibits chemokine activity.
  • the chemokine is selected from the group consisting of CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL12, CCL13, CCL14, CCL15, CCL16, CCL17, CCL18, CCL19, CCL20, CCL21, CCL22, CCL23, CCL24, CCL5, CCL26, CCL27, CCL28, CXCL1, CXCL2, CXCL3, CXCL4, CXCL5, CXCL6, CXCL7, CXCL8, CXCL9, CXCL10, CXCL11, CXCL12, CXCL13, CXCL14, CXCL5, and CXCL16.
  • the chemokine inhibitor binds to a chemokine receptor selected from the group consisting of CCR1, CCR2, CCR3, CCR, 4, CCR5, CCR6, CCR7, CCR8, CCR9, CCR10, CXCR1, CXCR2, CXCR3, CXCR4, CXCR5, CXCR6, and CXCR7.
  • the inhibitor of MIF can be a small molecule drug, or antibody or fragment thereof that specifically binds to MIF and inhibits MIF activity. Other inhibitors of macrophage migration can also be used.
  • the immune modulator is an inhibitor of indoleamine 2, 3-dioxygenase (IDO).
  • the method can further include: (a) detecting an expression level of one or more biomarkers in a tumor sample from the subject, wherein the one or more biomarkers, e.g., 1, 2, 3, 4, 5 or more biomarkers are selected from the group consisting of an immune cell markers), tumor cell markers), circulating markers), and any combination thereof; (b) comparing the expression level of the one or more biomarkers, e.g., 1, 2, 3, 4, 5 or more biomarkers to the expression level of the one or more biomarkers, e.g., 1, 2, 3, 4, 5 or more biomarkers in a normal tissue sample; and (c) treating the tumor with FLASH RT and an immune modulator if the expression level of the one or more biomarkers, e.g., 1, 2, 3, 4, 5 or more biomarkers is modified compared to the expression level in the normal tissue sample.
  • the one or more biomarkers e.g., 1, 2, 3, 4, 5 or more biomarkers are selected from the group consisting of an immune cell markers), tumor cell markers),
  • the expression level of the one or more biomarkers is modified if the expression level of at least one of the biomarkers is increased, or the expression level of at least one of the biomarkers is decreased, or the expression level of at least one of the biomarkers is increased and the expression level of at least one of the biomarkers is decreased compared to the expression level in a normal tissue sample.
  • the expression level of the one or more biomarkers e.g., 1, 2, 3, 4, 5 or more biomarkers can be ranked or weighted.
  • the immune cell biomarker(s) or the tumor cell biomarker(s) or the circulating biomarker(s) is a polynucleotide or a protein.
  • the step of detecting can be performed by using an assay selected from the group consisting of immunohistochemistry,
  • the tumor sample can be a biopsy comprising tumor cells.
  • the normal tissue sample can comprise non-tumor cells from the same tissue type as the tumor.
  • a method of treating a tumor in a subject with cancer comprising: (a) determining an expression level of one or more biomarkers, e.g., 1, 2, 3,
  • biomarkers e.g., 1, 2, 3, 4, 5 or more biomarkers are selected from the group consisting of an immune cell markers), tumor cell markers), circulating markers), and any combination thereof; (b) comparing the expression level of the one or more biomarkers, e.g., 1, 2, 3, 4, 5 or more biomarkers to an expression level of the one or more biomarkers, e.g., 1, 2, 3, 4, 5 or more biomarkers in a normal tissue sample; and (c) administering to the tumor in the subject a treatment comprising FLASH RT and a therapeutic agent if the expression level of the one or more biomarkers, e.g., 1, 2, 3, 4, 5 or more biomarkers in the tumor sample is modified compared to the expression level in the normal tissue sample.
  • a treatment comprising FLASH RT and a therapeutic agent if the expression level of the one or more biomarkers, e.g., 1, 2, 3, 4, 5 or more biomarkers in the tumor sample is modified compared to the expression level in the normal tissue sample.
  • the step of administering FLASH RT comprises contacting the tumor with a radiosensitizer.
  • the FLASH RT can be administered at a higher dose compared to a standard treatment protocol if the expression level of the one or more biomarkers, e.g., 1, 2, 3, 4, 5 or more biomarkers in the tumor sample is modified compared to the expression level in the normal tissue sample.
  • the FLASH RT can be administered as a hypofractionated radiation treatment if the expression level of the one or more biomarkers, e.g., 1, 2, 3, 4, 5 or more biomarkers in the tumor sample is modified compared to the expression level in the normal tissue sample.
  • the FLASH RT is administered as a hyperfractionated radiation treatment if the expression level of the one or more biomarkers, e.g., 1, 2, 3, 4, 5 or more biomarkers in the tumor sample is modified compared to the expression level in the normal tissue sample.
  • the expression level of the one or more biomarkers e.g., 1, 2, 3, 4, 5 or more biomarkers in the tumor sample is modified compared to the expression level in the normal tissue sample.
  • a method of identifying a subject with cancer as a candidate for treatment comprising FLASH RT and a therapeutic agent comprises (a) determining an expression level of one or more biomarkers, e.g., 1, 2, 3, 4, 5 or more biomarkers in a tumor sample from the subject, wherein the one or more biomarkers are selected from the group consisting of an immune cell markers), tumor cell markers), circulating markers), imaging markers), and any combination thereof; (b) comparing the expression level of the one or more biomarkers, e.g., 1, 2, 3, 4, 5 or more biomarkers to an expression level of the one or more biomarkers, e.g., 1, 2, 3, 4, 5 or more biomarkers in a normal tissue sample; and (c) classifying the subject as a candidate for treatment comprising FLASH RT and the therapeutic agent if the expression level of the one or more biomarkers, e.g., 1, 2, 3, 4, 5 or more biomarkers in the tumor sample is modified compared
  • the expression level of the one or more biomarkers is modified if the expression level of at least one of the biomarkers is increased, or the expression level of at least one of the biomarkers is decreased, or the expression level of at least one of the biomarkers is increased and the expression level of at least one of the biomarkers is decreased compared to the expression level in a normal tissue sample.
  • the expression level of the one or more biomarkers e.g., 1, 2, 3, 4, 5 or more biomarkers is ranked or weighted.
  • the method further comprises performing functional imaging of the tumor.
  • a method of selecting a treatment for a subject with cancer comprising (a) determining an expression level of one or more biomarkers, e.g., 1, 2, 3, 4, 5 or more biomarkers in a tumor sample from the subject, wherein the one or more biomarkers are selected from the group consisting of an immune cell markers), tumor cell markers), circulating markers), and any combination thereof; (b) comparing the expression level of the one or more biomarkers, e.g., 1, 2, 3, 4, 5 or more biomarkers to an expression level of the one or more biomarkers, e.g., 1, 2, 3, 4, 5 or more biomarkers in a normal tissue sample; and (c) selecting a treatment comprising FLASH RT and a therapeutic agent if the expression level of the one or more biomarkers, e.g., 1, 2, 3, 4, 5 or more biomarkers in the tumor sample is modified compared to the expression level in the normal tissue sample.
  • the method comprises performing functional imaging of the tumor; and selecting the treatment comprising FLASH RT and a therapeutic agent based on the functional imaging of the tumor.
  • the FLASH RT comprises contacting the tumor with a radiosensitizer.
  • the expression level of the one or more biomarkers e.g., 1, 2, 3, 4, 5 or more biomarkers is modified if the expression level of at least one of the biomarkers is increased, or the expression level of at least one of the biomarkers is decreased, or the expression level of at least one of the biomarkers is increased and the expression level of at least one of the biomarkers is decreased compared to the expression level in a normal tissue sample.
  • the expression level of the one or more biomarkers e.g., 1, 2, 3, 4, 5 or more biomarkers can be ranked or weighted.
  • the FLASH RT is administered at a higher dose compared to a standard treatment protocol if the expression level of the one or more biomarkers, e.g., 1, 2, 3, 4, 5 or more biomarkers in the tumor sample is modified compared to the expression level in the normal tissue sample.
  • the FLASH RT is administered as a hypofractionated radiation treatment if the expression level of the one or more biomarkers, e.g., 1, 2, 3, 4, 5 or more biomarkers in the tumor sample is modified compared to the expression level in the normal tissue sample.
  • the FLASH RT is administered as a hyperfractionated radiation treatment if the expression level of the one or more biomarkers, e.g., 1, 2, 3, 4, 5 or more biomarkers in the tumor sample is modified compared to the expression level in the normal tissue sample.
  • the expression level of the one or more biomarkers e.g., 1, 2, 3, 4, 5 or more biomarkers in the tumor sample is modified compared to the expression level in the normal tissue sample.
  • the therapeutic agent is an immune modulator selected from the group consisting of an inhibitor to an inhibitory checkpoint molecule, an activator of a stimulatory checkpoint molecule, a chemokine inhibitor, an inhibitor of macrophage migration inhibitory factor (MIF), a growth factor, a cytokine, an interleukin, an interferon, an antibody that binds to an immune system cell, a cellular immune modulator, a vaccine, an oncolytic virus, and any combination thereof.
  • an immune modulator selected from the group consisting of an inhibitor to an inhibitory checkpoint molecule, an activator of a stimulatory checkpoint molecule, a chemokine inhibitor, an inhibitor of macrophage migration inhibitory factor (MIF), a growth factor, a cytokine, an interleukin, an interferon, an antibody that binds to an immune system cell, a cellular immune modulator, a vaccine, an oncolytic virus, and any combination thereof.
  • the methods described herein can further comprise performing functional imaging of the tumor prior to administering the FLASH RT and/or the therapeutic agent.
  • kits comprising reagents capable of detecting expression of the biomarkers described herein.
  • the kit comprises reagents capable of detecting nucleic acid (e.g., RNA) expression of the biomarkers.
  • the kit can comprise oligonucleotide primers that are capable amplifying a nucleic acid expressed by the biomarker genes described herein.
  • the kit further comprises an oligonucleotide probe that hybridizes to a biomarker nucleic acid or an amplified biomarker nucleic acid, or a complement thereof.
  • Methods of amplifying and detecting nucleic acids are well known in the art, and can comprise PCR, RT-PCR real-time PCR, and quantitative real-time PCR, Northern analysis, sequencing of expressed nucleic acids, and hybridization of expressed and/or amplified nucleic acids to microarrays.
  • the kit comprises reagents that are capable of detecting proteins expression by the biomarkers described herein.
  • the reagents are antibodies that specifically bind to biomarker proteins.
  • the differences in the expression levels of each of the biomarkers in the tumor sample are increased or decreased by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or more compared to the expression level in normal tissue.
  • the expression levels of each of the biomarkers in the tumor sample are increased or decreased by at least 1-fold, 2-fold, 3 -fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10 fold or more relative to the expression level in normal tissue.
  • the average and/or ranked expression level of all the biomarkers in the tumor sample is increased or decreased relative to the expression level in normal tissue.
  • the average and/or ranked expression level of all the biomarkers in the tumor sample is increased or decreased by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or more compared to the expression level in normal tissue.
  • the expression levels in normal tissue are normalized to a control or baseline level. It will be understood that the expression level can also be compared to the expression level in the tumor sample before, after or during a treatment, course of treatment, or treatment plan.
  • the expression levels of each of the biomarkers in the tumor sample are increased or decreased by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or more compared to the expression level in the tumor sample before, during or after treatment.
  • the one or more biomarkers can comprise or consist of any combination of the biomarkers, for example, any of the biomarkers described herein, any combination of two or more biomarkers, any combination of three or more biomarkers, any combination of four or more biomarkers, any combination of five or more biomarkers, any combination of six or more biomarkers, and any combination of seven or more biomarkers.
  • the expression level of at least one, two, three, four or more of the biomarkers described herein is determined.
  • the combination of expression levels of two or more biomarkers, e.g., 2, 3, 4, 5, 6 or more biomarkers can indicate that the subject with cancer is more sensitive to radiation compared to a control subject. This subject may be administered a reduced or decreased dose of radiation compared to a standard dose.
  • the combination of expression levels of two or more biomarkers, e.g., 2, 3, 4, 5, 6 or more biomarkers can indicate that the subject with cancer is less sensitive to radiation compared to a control subject.
  • a subject who is less sensitive to radiation may be administered an increased dose, a hypofractionated dose or a hyperfractionated dose of radiation.
  • radiation therapy may be administered in combination with an immune modulator, such as but not limited to, an anti-TIM4 antibody, an anti-MFG-E8 antibody, an anti -Ml 99 antibody, and any combination thereof.
  • the biomarker is CD44, MFG-E8, CD68, TORb, or any combination thereof.
  • a first biomarker has a high level of expression and a second biomarker has a low level of expression in a sample obtained from a subject with cancer relative to a control sample, then it is predicted that radiation treatment monotherapy may result in local tumor control failure.
  • this biomarker profile can indicate that the subject should be administered radiation treatment in combination with an immune modulator.
  • this biomarker profile can indicate that the dose of radiation be increased (i.e., increased over a standard protocol dose). For instance, if the level of CD44 is high and the level of MFG-E8 is low in a subject’s tumor sample compared to a control sample, then it is predicted that radiation treatment alone will not lead to a clinical response. In other words, a tumor sample having a high level of CD44 and a low level of MFG-E8 is likely to be insensitive or have a low sensitivity to ionizing radiation or FLASH radiation therapy.
  • the biomarker profile described herein indicates that the subject should receive an increased dose of radiation and/or combination therapy comprising FLASH RT and an immune modulator, such as an anti- TIM4 antibody, anti-MFG-E8 antibody, anti-M199 antibody, and any combination thereof.
  • an immune modulator such as an anti- TIM4 antibody, anti-MFG-E8 antibody, anti-M199 antibody, and any combination thereof.
  • a subject’s tumor has a high level of CD68 compared to a control sample, the subject is predicted to have decreased survival after radiation monotherapy. As such, this subject can be administered a combination therapy comprising FLASH RT and an immune modulator.
  • this subject is likely to have a clinical response to radiation monotherapy. It is predicted that this subject is sensitive to radiation. In certain cases, it may be indicated that the subject be administered a low dose or reduced dose of radiation compared to a standard protocol dose.
  • FLASH radiation can be administered to tissue (e.g., tumor cells) in a single pulse, or any sequence of pulses, with an interval between pulses of less than a second to several minutes.
  • the dose of FLASH radiation can range from about 40 to greater than 500 Gy/sec.
  • FLASH radiation allows for dose deposition up to 200 centimeters in living tissue at FLASH rates.
  • the dose of FLASH radiation is sufficient to kill tumor cells located up to 200 centimeters deep in human or animal tissue, for example, from 1 Gy up to more than 500 Gy, with a total beam-on delivery time of not more than 1 second.
  • Each pulse within a FLASH sequence can be continuous or a sequence of shorter micro-pulses.
  • the dose per pulse is at least 0.1 Gy, and the dose rate per pulse is at least 40 Gy/sec (i.e. 0.1 Gy in 2.5 ms, 4 Gy in 10 ms, 20 Gy in 0.5 sec, etc.) and up to le7 Gy/sec as specified herein.
  • the pulse duty cycle i.e. temporal spacing
  • FLASH radiation is delivered using high-energy particles or waves, such as x-rays, gamma rays, electron beams, or protons.
  • FLASH radiation is delivered as proton therapy.
  • the FLASH radiation is not delivered using electrons.
  • the proton therapy is delivered according to the following schedule:
  • conventional proton radiation therapy can be delivered according to the following schedule:
  • FLASH irradiation using electrons delivered by a linear electron accelerator is described, for example, in V. Favaudon, L. Caplier, V. Monceau, F. Pouzoulet, M. Sayarath, C. Fouillade, M.-F. Poupon, I. Brito, P. Hupe, J. Bourhis, J. Hall, J.-J. Fontaine, M.-C. Vozenin, Ultrahigh dose-rate FLASH irradiation increases the differential response between normal and tumor tissue in mice. Sci. Transl. Med. 6, 245ra93 (2014). Systems for producing FLASH radiation are described in U.S. Patent Application No.
  • the radiation therapy or treatment system is a proton pencil beam scanning system that can be used for FLASH RT. More specifically, the system can include an accelerator and beam transport system and a nozzle that can be aimed toward an object.
  • the nozzle includes a beam energy adjuster configured to adjust the beam by, for example, placing different thicknesses of material in the path of the beam to affect the energies of the particles in the beam.
  • the nozzle is capable of quickly adjusting the particles in the beam to create a scanned beam (as opposed to a scattered beam) that delivers an entire, relatively high therapeutic radiation dose in the target volume. For example, a dose of four grays or more can be delivered along a specified beam direction (e.g., a given ray) in less than one second.
  • Each ray is a part of a scan pattern and irradiates tissue along a different line segment through the target volume (a“target line segment”).
  • a high dose that can be delivered in a short period of time along a target line segment may be referred to as a“shot.”
  • a shot can be adjusted in energy (intensity) or range and delivered to the target volume with a Spread Out Bragg Peak (SOBP) that provides a uniform and otherwise suitably modified dose to an entire target line segment.
  • SOBP Spread Out Bragg Peak
  • the radiation therapy or treatment system comprises an accelerator, a beam transport system, and a beam shaping system.
  • the accelerator may be radio frequency (RF) (linear accelerator, cyclotron, or synchrotron) or laser- based accelerator.
  • the accelerator may deliver the dose in a pulsed, continuous or quasi- continuous manner.
  • the beam transport may include magnetic elements (dipole, quadrupole, multipole), electrostatic elements, and slits or collimators.
  • the beam shaping can be performed by a combination of magnetic, electrostatic and mechanical elements with the purpose of maximizing the conformality of the dose to the tumor.
  • Embodiments include systems capable of delivering 3D conformal dose to the tumor in a single field or as a combination of multiple beamlets.
  • FLASH RT doses can be delivered as a single dose (a single fraction), or the total dose can be divided into multiple fractions that are delivered over time.
  • continuous monitoring of the tumor using, for example x-ray or magnetic resonance imaging (MRI) may be used by a medical technician to help determine when to turn on the beam when the target is in the defined target field, to further ensure optimal dose conformality.
  • FLASH RT can use very high energy charged particles (VHECPs) including, but not limited to, electrons, protons, and heavy ions, high energy photons (x-rays, gamma rays), or any high energy neutral particle, such as neutrons. High energy is defined as any energy which allows for dose deposition up to 200 centimeters in living tissue at FLASH rates.
  • Intensity modulated (IM) FLASH RT and modulated arc (MA) FLASH RT provide means for achieving optimal dose conformity.
  • IMRT intensity modulated radiation therapy
  • IMPT intensity modulated particle therapy
  • the patient is treated with a number of smaller beams (e.g., beam segments or beamlets), each of which can have its own energy and/or intensity value, and each of which can be delivered from a different direction or angle (which may be referred to as beam geometry).
  • beams e.g., beam segments or beamlets
  • each of which can have its own energy and/or intensity value, and each of which can be delivered from a different direction or angle (which may be referred to as beam geometry).
  • FIG. 1 shows a cross-sectional view of a possible beam geometry to a tumor (target 710) and the surrounding tumor microenvironment 720.
  • a prescribed dose to be delivered into and across the target is determined.
  • Each portion of the target can be represented by at least one 3D element known as a voxel; a portion may include more than one voxel.
  • a portion of a target or a voxel may also be referred to herein as a sub-volume; a sub-volume may include one or more portions or one or more voxels.
  • each portion or voxel may receive radiation from one or more beams delivered from different directions.
  • the prescribed dose defines, for example, a dose value, or a minimum dose value and a maximum dose value, for each portion or voxel of the target.
  • the prescribed dose is the same for all portions (sub-volumes or voxels) of the target, such that a uniform dose is prescribed for the entire target.
  • directions e.g., gantry angles relative to the patient or target, or nozzle directions relative to the patient or target
  • the beams can be proton beams, electron beams, photon beams, ion beams, or atom nuclei beams.
  • the operation of determining beam directions can include determining the number of beams (the number of directions from which beams are to be delivered).
  • the beams’ paths may or may not overlap within the target, and may or may not overlap outside the target.
  • one goal is to determine beam paths that minimize the irradiation dose of each sub-volume or voxel of the tissue outside the target.
  • organs deemed critical by the radiation oncologist may be required to receive less dose than other organs in the vicinity. Therefore, conventional treatment planning is driven by prescription thresholds of the calculated integral dose to the tumor and surrounding organs.
  • FIG. 2 contains a 3-dimensional surface plot of dose vs time and one other variable.
  • the dose delivered to a tumor will depend on more variables, but two are selected for the purposes of describing the embodiments without added complexity.
  • the dose surface can depend on any number of variables, and will in generally be n-dimensional with n being greater than or equal to 1.
  • the other parameters could be immune-sensitivity, response of the tumor to an immune modulator, or some other biological parameter. While in general the shape of this surface can vary, FIG. 2 shows an increasing dose threshold with decreasing irradiation time, and a slightly increasing dose threshold with increasing“immune-biological indicator”.
  • the time constraint can be met through geometrical construction of the beam configuration. Ideally, each sub-volume or voxel outside the target is intersected, at most, by only a single beam. If some overlap between beam paths is permitted, then ideally each sub-volume or voxel outside the target is intersected by not more than two beams, with most intersected by only a single beam. In an embodiment, as one means of achieving the
  • the beam directions are determined such that the total amount of overlap between the beams’ paths is minimized outside the target.
  • the directions are determined such that the paths of the beams overlap within the target and such that the total amount of overlap of the beams’ paths outside the target is less than the total amount of the overlap of the beams’ paths within the target.
  • the directions are determined so that the paths of the beams do not overlap at all outside the target.
  • the beams’ paths can lie within the same plane, or they can be in different planes.
  • the beams (705-707) are shown as passing through the patient, however this disclosure is not so limited.
  • the beams my also terminate within the target as would be the case for ion and proton beams.
  • beam energy determines the termination point within the target, which would need to be considered by the calculation engine and optimizer. Otherwise all other optimization parameters are the same.
  • FIG.1 While the operations in FIG.1 are presented as occurring in series and in a certain order, the present disclosure is not so limited. The operations may be performed in a different order and/or in parallel, and they may also be performed in an iterative manner, as the number of beams (and accordingly, the number of directions), the beam directions, and the beam energies or intensities (and/or beam segment energies or intensities) used to deliver the prescribed dose are interrelated.
  • the optimizer model 150 executing consistently on the computing system 106 (FIG. 3) for radiation treatment planning as disclosed herein is important.
  • the beam segments are delivered sequentially. For example, the beam segment 705 is delivered to the target (turned on) and then turned off, then the beam segment 706 is turned on then off, then the beam segment 707 is turned on then off, and so on. Each beam segment may be turned on for only a fraction of a second (on the order of milliseconds). In an embodiment, all beams 705-707 may be turned on simultaneously.
  • a sub-volume can be traversed by more than two beams, in which case the cumulative dose for the sub-volume is represented by adding the appropriate value for each beam that reaches the sub-volume.
  • Such sub-volumes are known as overlap regions 730. That is, a total value is determined for each sub-volume in the target 710 by adding together the values for each beam region of each beam that reaches the sub-volume. Dose in the overlap regions can also be optimized by the constraints defined by the surface in FIG. 2.
  • the optimizer model can adjust the parameters that affect the calculated doses delivered to the target 710 to achieve a satisfactorily uniform cumulative dose across the target 710.
  • a satisfactorily uniform cumulative dose is indicated when all the total values per sub- volume in the target 710 are the same or when the differences between the total values per subvolume satisfy a threshold value.
  • the threshold value can be, for example, a value that specifies the range of differences that is permitted or that specifies a maximum permitted difference.
  • Dose limits can include, but are not limited to: a limit on irradiation time for each sub- volume (voxel) in the target (e.g., for each voxel of target tissue, treatment time ⁇ 0.5 seconds); a limit on irradiation time for each sub-volume (voxel) outside the target (e.g., for each voxel of normal tissue, treatment time ⁇ 0.5 second2); a limit on dose rate for each sub-volume (voxel) in the target (e.g., for each voxel of target tissue, dose rate > 40 Gy/sec); and a limit on dose rate for each sub-volume (voxel) outside the target (e.g., f or each voxel of normal tissue, dose rate > 40 Gy/sec), a limit on dose and dose rate in the tumor micro-environment.
  • the limits are intended to minimize the amount of time that normal tissue is irradiated and maximize the immunological response.
  • embodiments described herein improve radiation treatment planning and the treatment itself by expanding FLASH RT to a wider variety of treatment platforms and target sites as well as optimizing delivery of FLASH RT to enhance the immune response.
  • Treatment plans generated as described herein are superior for sparing normal tissue from radiation in comparison to conventional techniques even for non-FLASH dose rates by reducing, if not minimizing, the magnitude (and the integral in some cases) of the dose to normal tissue (outside the target) by design.
  • management of patient motion is simplified.
  • Treatment planning while still a complex task of finding a balance between competing and related parameters, is simplified relative to conventional planning.
  • the techniques described herein may be useful for stereotactic radiosurgery as well as stereotactic body radiotherapy with single or multiple metastases.
  • the methods described herein can be used with other types of external beam radiotherapy such as, but not limited to, IMPT, intensity modulated radiation therapy (IMRT), image-guided radiotherapy (IGRT), RapidArcTM radiotherapy, stereotactic body radiotherapy (SBRT), and stereotactic ablative radiotherapy (SABR).
  • IMPT intensity modulated radiation therapy
  • IGRT image-guided radiotherapy
  • IGRT RapidArcTM radiotherapy
  • SBRT stereotactic body radiotherapy
  • SABR stereotactic ablative radiotherapy
  • FIG. 3 shows a block diagram of an example of a computing system 100 that can be used for radiation treatment planning.
  • the system 100 includes at least one processing unit 102 and memory 104. This most basic configuration is illustrated in FIG. 3 by dashed line 106.
  • the system 100 may also have additional features and/or
  • the system 100 may also include additional storage (removable and/or non-removable) including, but not limited to, magnetic or optical disks or tape. Such additional storage is illustrated in FIG. 3 by removable storage 108 and non-removable storage 120.
  • the system 100 may also contain communications connection ⁇ ) 122 that allow the device to communicate with other devices, e.g., in a networked environment using logical connections to one or more remote computers.
  • the system 100 also includes input device(s) 124 such as keyboard, mouse, pen, voice input device, touch input device, etc.
  • input device(s) 124 such as keyboard, mouse, pen, voice input device, touch input device, etc.
  • output device(s) 126 such as a display device, speakers, printer, etc., are also included.
  • the memory 104 includes computer-readable instructions, data structures, program modules, and the like associated with a treatment planning system 150.
  • the treatment planning system 150 may instead reside in any one of the computer storage media used by the system 100, or may be distributed over some combination of the computer storage media, or may be distributed over some combination of networked computers.
  • the treatment planning system 150 can be used to develop a radiation treatment plan for a particular patient by receiving patient-specific information (e.g., geometry information) that is input to and processed by the treatment planning system.
  • patient-specific information e.g., geometry information
  • the input patient-specific information may contain any combination of parameters that can practically affect the radiation treatment plan.
  • the patient-specific information may be organized as a vector or a data structure including feature elements for: size and shape of the target volume; location of the target volume; size and shape of an organ at risk; type of an organ at risk; a part of the target volume that overlaps an organ; and a part of an organ that overlaps the target volume.
  • the treatment planning system 150 may be used to predict dose parameters for a treatment plan corresponding to a particular patient.
  • the dose treatment planning system 150 may include a dose-volume histogram (DVH) estimation model, where the predicted quantity is a dose volume histogram.
  • the treatment planning system 150 also generates a prediction based on a distance to a target (DTH) histogram, which expresses the distance from a region of interest (ROI) to a radiation target.
  • DTH distance to a target
  • ROI region of interest
  • the treatment planning system 150 is implemented as any model suitable for predicting dosage (as a dose histogram or spatial 3D dose distribution) for a radiation treatment plan.
  • the radiation treatment planning system 150 can account for both the spatial domain and the time domain.
  • a time-dependent component can be included in treatment planning for IM or MA FLASH RT with VHECPs, for example.
  • the treatment planning system 150 considers the combination of FLASH RT and immunotherapy.
  • the treatment planning system 150 incorporates
  • treatment planning system 150 determines a final radiation treatment plan that integrates FLASH RT and immunotherapy.
  • the treatment planning system 150 can iteratively evaluate the FLASH aspects of radiation treatment and the immunotherapy/biological aspects of radiation treatment to generate a final radiation treatment plan that optimizes the combination of both aspects.
  • the planner defines a set of quality metrics. For planning, the metrics are defined such that a smaller value is preferred over a larger value. The planner also defines a relative priority or weight (wi) for each of the quality metrics.
  • the optimal plan is determined by minimizing the cost function C.
  • Another way to assist the planner is to use a multi-criteria optimization (MCO) approach for treatment planning.
  • MCO multi-criteria optimization
  • Pareto surface navigation is an MCO technique that facilitates exploration of the tradeoffs between clinical goals. For a given set of clinical goals, a treatment plan is considered to be Pareto optimal if it satisfies the goals and none of the metrics can be improved without worsening at least one of the other metrics.
  • the set of Pareto optimal plans define a Pareto surface related to the set of clinical goals. Movement along the Pareto surface results in tradeoffs between the clinical goals; some metrics will improve at the cost of worsening one or more other metrics.
  • the planner can navigate along the Pareto surface and choose a final (optimized) radiation treatment plan that seems to be the best according to the criteria applied by the planner, or a treatment plan can be selected automatically based on its proximity to the Pareto surface.
  • FIG. 4 is a block diagram illustrating an embodiment of an automated radiation therapy treatment planning system 150.
  • the system 150 includes an input interface 210 to receive patient-specific information (data) 201, and an output interface 230.
  • the system 150 in whole or in part may be implemented as a software program, hardware logic, or a combination thereof on/using the computing system 100 (FIG. 3).
  • the radiation therapy treatment planning system 150 also receives or accesses FLASH
  • FLASH RT parameters can include, for example, beam type, beam energy, the angle of the beam relative to the patient/target volume, beam shape, dose delivery schedule, total dose and irradiation time for any given normal tissue volume outside the tumor, as well as dose and irradiation time within the tumor microenvironment which optimizes the immunological response.
  • Immunotherapy parameters can include, for example, the type of drug or immune modulator administered to the subject, tumor antigen, neoantigen, or antibody administered, dosage, and delivery schedule (e.g., before, after, and/or during FLASH RT).
  • the treatment planning system 150 yields a prediction result, e.g., an achievable dose distribution prediction.
  • a treatment plan based on the prediction result can then be generated.
  • the prediction result is accompanied by parameters indicative of the quality of the prediction, such as reliability of the result, complexity of the predicted plan, and probability of the result.
  • the radiation treatment planning systems described herein will result in a prediction that a lower effective dose of radiation, e.g., FLASH radiation, can be administered to a subject based on a response of the subject to immunotherapy.
  • the radiation treatment planning system(s) will predict that a lower effective dose of radiation, e.g., FLASH radiation, can be administered to a subject if the tumor in the subject responds favorably to immunotherapy, e.g., the tumor is reduced in size following immunotherapy.
  • the radiation treatment planning systems described herein will result in a prediction to change the effective dose of radiation, e.g., FLASH radiation, based on parameters that enhance the immune response, e.g., increase the delivery or activity of an immune modulator to more effectively treat a tumor in a subject.
  • BIOMARKERS FOR RADIOTHERAPY SELECTION e.g., FLASH radiation
  • biomarkers described herein can be used to stratify patients to receive
  • the biomarkers can also be used to monitor the efficacy of immune modulator therapy on patients with cancer.
  • the biomarkers include, but are not limited to, one or more immune cell biomarkers, one or more tumor cell biomarkers, one or more circulating biomarkers, one or more imaging biomarkers, and any combination thereof.
  • an immune cell biomarker can provide information about the location and/or activity of a specific cell population, such as a T cell population.
  • An immune cell biomarker or tumor cell biomarker can be a genetic biomarker, polynucleotide biomarker, or a protein biomarker.
  • an immune cell biomarker is a specific polynucleotide (e.g., RNA and microRNA) or protein that is expressed at a higher level by a particular immune cell compared to a non- immune cell or a different type of immune cell.
  • a tumor cell biomarker can a specific polynucleotide (e.g., RNA and microRNA) or protein that is expressed at a higher level by a tumor cell compared to a non-tumor cell.
  • the tumor cell biomarker can be a protein or a polynucleotide encoding said protein that is associated with proliferation and/or metastasis of a tumor cell.
  • the protein can be involved in angiogenesis or other processes that are activated by a tumor cell.
  • the tumor biomarker can be an oncogene or a tumor suppressor.
  • a tumor cell biomarker is a gene variation, gene mutation, copy number variant (CNV), single nucleotide polymorphism (SNP), and the like that is present in a tumor cell, but not in a non-tumor cell.
  • a circulating biomarker is an exosome (i.e., a cell-derived vesicle that can be found in a body fluid). Examples of useful biomarkers includes those described in U.S. Patent Appl. Publ. No. 20160024594, the disclosure of which is hereby incorporated by reference for all purposes. ⁇ &£?$J
  • the biomarker set can include, but is not limited to, CD44, milk fat globule-EGF factor
  • CD44 is a cell-surface glycoprotein that plays a role in cell proliferation, cell-cell interactions, cell adhesion, and cell migration of various cell types including lymphocytes and cancer cells.
  • the human CD44 polypeptide sequence is set forth in, e.g., GenBank Accession No. NP 000601.
  • the human CD44 mRNA (coding) sequence is set forth in, e.g., GenBank Accession No. NM 000610.
  • Milk fat globule-EGF factor 8 protein (MFG-E8) is a macrophage-produced protein that promotes engulfinent and clearance of apoptotic cells in tumors.
  • the human MFG-E8 polypeptide sequence is set forth in, e.g., GenBank Accession No. NP 005919.
  • the human MFG-E8 mRNA (coding) sequence is set forth in, e.g., GenBank Accession No. NM 005928.
  • CD68 is a 110-kD transmembrane glycoprotein that is highly expressed by human monocytes and tissue macrophages. The protein primarily localizes to lysosomes and endosomes with a smaller fraction circulating to the cell surface. It is a type I integral membrane protein with a heavily glycosylated extracellular domain and binds to tissue- and organ-specific lectins or selectins.
  • CD68 is also a member of the scavenger receptor family.
  • the human CD68 polypeptide sequence is set forth in, e.g., GenBank Accession No. NP 001242.
  • the human CD68 mRNA (coding) sequence is set forth in, e.g., GenBank Accession No. NM 001251.
  • TORb is a cytokine that is involved in cell growth, cell proliferation, cell differentiation, apoptosis, homeostasis and many other cellular processes.
  • the human TORb polypeptide sequence is set forth in, e.g., GenBank Accession No. NP 000651.
  • the human TORb mRNA (coding) sequence is set forth in, e.g., GenBank Accession No.
  • the expression levels of each of the biomarkers described herein in the patient sample can increase or decrease relative to the expression level of the tumor biomarker in a normal or control tissue sample.
  • the expression level of one tumor biomarker can increase in the tumor sample compared to the expression level in a normal tissue
  • the expression level of a second biomarker can decrease in the tumor sample compared to the expression level in a normal tissue.
  • the expression level can also be based on the average, combination or sum of the all the tumor biomarker expression levels in the patient sample.
  • the expression level of each biomarker in the patient sample can be ranked or weighted to produce a ranked value that is higher or lower than the normal tissue value (which can be a normalized value, for example, set to 1).
  • biomarker expression is determined in a biological sample from the subject having a tumor.
  • the biological sample is a tumor sample.
  • the tumor sample can be a biopsy comprising tumor cells from the tumor.
  • the biological sample comprises a bodily fluid, such as but not limited to blood, serum, plasma, or urine, and/or cells or tissues from the subject.
  • the biological sample is a formalin-fixed and paraffin embedded tissue or tumor sample.
  • the biological sample is a frozen tissue or tumor sample.
  • biomarker expression is determined in vitro.
  • the normal tissue sample comprises non-tumor cells from the same tissue type as the tumor.
  • the normal tissue sample is obtained from the same subject diagnosed with the tumor.
  • a normal tissue sample can also be a control sample of the same tissue-type from a different subject.
  • the expression level of the normal tissue sample can also be an average or mean value obtained from a population of normal tissue samples.
  • the level of expression of the biomarkers described herein can be determined using any method known in the art.
  • the level of expression can be determined by detecting the expression of a nucleic acid (e.g., RNA, mRNA or microRNA) or the protein encoded by the nucleic acid.
  • a nucleic acid e.g., RNA, mRNA or microRNA
  • Exemplary methods for detecting expression levels of nucleic acids include, without limitation, Northern analysis, polymerase chain reaction (PCR), reverse transcription PCR (RT- PCR), real-time PCR, quantitative real-time PCR, and DNA microarrays.
  • Exemplary methods for detecting expression levels of proteins include, without limitation, immunohistochemistry, ELISA, Western analysis, HPLC, and proteomics assays.
  • the protein expression level is determined by immunohistochemistry using the Allred method to assign a score (see, e.g., Allred, D. C., Connection 9:4-5, 2005, which is incorporated by reference herein). For example, formalin- fixed, paraffin embedded tissues are contacted with an antibody that specifically binds a biomarker described herein.
  • the bound antibody is detected with a detectable label or secondary antibody coupled with a detectable label, such as a colorimetric label (e.g., an enzymatic substrate produce by HRP or AP).
  • a detectable label such as a colorimetric label (e.g., an enzymatic substrate produce by HRP or AP).
  • the antibody positive signal is scored by estimating the proportion of positive tumor cells and their average staining intensity. Both the proportion and intensity scores are combined into a total score that weighs both factors.
  • the protein expression level is determined by digital pathology.
  • Digital pathology methods include scanning images of tissues on a solid support, such as a glass slide.
  • the glass slides are scanned into whole slide images using a scanning device.
  • the scanned images are typically stored in an information management system for archival and retrieval.
  • Image analysis tools can be used to obtain objective quantitative measurements from the digital slides. For example, the area and intensity of immunohistochemical staining can be analyzed using the appropriate image analysis tools.
  • Digital pathology systems can include scanners, analytics (visualization software, information management systems and image analysis platforms), storage and communication (sharing services, software).
  • Digital pathology systems are available from numerous commercial suppliers, for example, Aperio Technologies, Inc. (a subsidiary of Leica Microsystems GmbH), and Ventana Medical Systems, Inc. (now part of Roche). Expression levels can be quantified by commercial service providers, including Flagship Biosciences (CO), Pathology, Inc. (CA), Quest Diagnostics (NJ), and Premier
  • imaging of the tumor is also used to identify or select a cancer patient who should receive the combination therapy described herein.
  • functional imaging include single-photon emission computed tomography, optical imaging, ultrasonography, positron emission tomography (PET), computed tomography (CT), perfusion computed tomography, magnetic resonance imaging (MRI), functional magnetic resonance imaging, magnetic resonance sectroscopic imaging, dynamic contrast-enhanced imaging, diffusion-weighted imaging, blood-oxygenation level dependent imaging, magnetic resonance spectroscopy, magnetic resonance lymphography, and any combination thereof.
  • Any type of functional imaging such as multimodality imaging can be performed to characterize the tumor, to determine the delineation of the tumor, the extent of the tumor, the tumor volume, and/or to assess the tumor microenvironment (e.g., the environment surrounding the tumor).
  • Functional imaging can aid in selecting the best treatment option and/or in monitoring response to the treatment.
  • the expression levels of the biomarkers can be used to determine or select a course of treatment in a subject diagnosed with a tumor.
  • the treatment comprises administering ionizing radiation, such as FLASH RT, to the tumor in the subject.
  • the ionizing radiation can also be administered to the entire subject or a portion thereof, especially if the tumor is dispersed or mobile.
  • the treatment further comprises contacting the tumor with a radiosensitizer.
  • the treatment further comprises administering a compound or biologic drug, such as an antibody, that inhibits an immune checkpoint pathway, to the subject.
  • the treatment comprises administering a FLASH radiation treatment protocol in combination with an immune modulator.
  • the course of treatment can be selected based on the expression levels of the biomarkers.
  • the expression levels can be used to determine if radiation therapy is appropriate for the subject (i.e., for making a go/no go decision on radiotherapy).
  • the effective radiation dose to the tumor can be increased, and/or the fractionation schedule modified accordingly.
  • the effective dose of FLASH RT to the tumor is increased.
  • the radiation dose to the blood vessels feeding the tumor can also be increased.
  • a hypofractionated radiation treatment is administered.
  • a hyperfractionated radiation treatment is administered.
  • FLASH radiation treatment is provided in combination with immune modulator treatment.
  • the treatment can comprise administering ionizing radiation, such as FLASH RT, to the tumor.
  • ionizing radiation such as FLASH RT
  • the treatment can comprise decreasing the amount of ionizing radiation or FLASH RT administered to the tumor.
  • the treatment can also comprise modifying an existing course of treatment.
  • the existing course of treatment is modified to increase the effective dose of the ionizing radiation, e.g., FLASH radiation, administered to the tumor.
  • the effective dose of ionizing radiation such as FLASH radiation
  • the existing course of treatment is modified to decrease the effective dose of the ionizing radiation administered to the tumor.
  • the treatment comprises modifying a standard radiation treatment protocol in combination with administering an immune modulator.
  • the effective dose of ionizing radiation, e.g., FLASH radiation, administered to the tumor is increased if the level of one or more biomarkers described herein is elevated in the tumor environment.
  • the effective dose of ionizing radiation is increased as compared to the standard of care for a subject that does not have elevated levels of the biomarker(s) in the tumor environment. This applies to subjects who are currently not undergoing radiation therapy as well as modifying an existing course of treatment for subjects undergoing radiation therapy.
  • the effective dose of ionizing radiation can be increased from the current effective dose if the subject is already undergoing radiation therapy for a tumor.
  • the radiation therapy can be modified to reduce the constraints on neighboring healthy tissue.
  • the treatment comprises a combination of radiation therapy and an immune modulator agent (including a radiosensitizer).
  • the treatment comprises a combination of FLASH radiation therapy and an immune modulator agent
  • the effective dose of ionizing radiation administered to the tumor is not changed (e.g., relative to the standard of care or relative to an existing course of treatment) when an immune modulator agent is administered to the subject.
  • the subject is administered an effective dose of ionizing radiation that is the same or similar to that administered to a subject that does not have elevated levels of one or more biomarkers described herein in the tumor environment, and the subject is further administered an immune modulator agent.
  • the effective dose of ionizing radiation administered to the tumor is based on the standard of care for a subject that does not have elevated levels of the biomarker(s) in the tumor environment, and the subject is further administered an immune modulator agent.
  • the effective dose of ionizing radiation is maintained at the current effective dose, and an anti-cancer agent is administered to the subject in combination with the ionizing radiation if the level of one or more biomarkers described herein is elevated in the tumor environment.
  • the treatment plan is developed and/or modified based on the expression levels of the biomarkers described herein.
  • the course of treatment can also be selected by using an algorithm, for example a computer-implemented algorithm, that analyses or determines the expression level of the biomarkers in the tumor sample relative to the level in the normal sample.
  • the algorithm can be a linear regression algorithm that includes the biomarker expression levels and coefficients (i.e., weights) for combining the expression levels.
  • the algorithm comprises a least squares fit to calculate the coefficients. If the algorithm determines that the expression level of the biomarkers in the tumor sample is increased or decreased relative to the normal sample, then the appropriate course of treatment can be assigned.
  • the algorithm is a nonpar ametric regression tree.
  • treatment comprising FLASH radiation and an immune modulator is selected in dependence on the algorithm determining that the expression level of the biomarkers in the tumor sample is increased or decreased relative to the normal sample.
  • standard statistical methods were used to analyze the data to determine which biomarkers were most predictive of clinical survival or local tumor control failure.
  • the method described herein is a computer implemented method.
  • the computer implemented method comprises a linear regression model that assigns a ranked or weighted value to the expression levels of the biomarkers described herein.
  • the disclosure provides a computer-readable medium, the medium providing instructions to cause a computer to perform a method described herein.
  • the medium can provide instructions to cause a computer to assign a ranked or weighted value to the expression levels of the biomarkers described herein.
  • the expression levels of the tumor biomarkers described herein can be used to optimize treatment of patients with radiotherapy, such as FLASH RT.
  • the therapeutic dose of the radiation administered to the tumor or subject can be adjusted based on the expression levels of the biomarkers.
  • the effective dose of ionizing radiation varies with the type of tumor and stage of cancer that needs to be treated.
  • the effective dose can also vary based on other treatment modalities being administered to the patient, for example chemotherapeutic treatments and surgical treatments, and whether the radiation is administered pre- or post-surgery.
  • a conventional curative therapeutic dose for a solid epithelial tumor ranges from about 60 to 80 gray (Gy)
  • a curative dose for a lymphoma is about 20 to 40 Gy.
  • preventative doses can be 45-60 Gy.
  • the curative therapeutic dose for a solid epithelial tumor can range from about 20 to 200 gray (Gy), whereas a curative dose for a lymphoma is about 10 to 200 Gy, with preventative doses from 5-500 Gy.
  • the therapeutic dose can be delivered in fractions. Fractionation refers to spreading out the total dose of radiation over time, for example, over days, weeks or months.
  • the dose delivered in each fraction can be about 1.5-2 Gy per day.
  • the treatment plan can include a fraction treatment one or more times per day, every other day, weekly, etc. depending on the treatment needs of each patient.
  • a hypofractionation schedule comprises dividing the total dose into several relatively large doses, and administering the doses at least one day apart.
  • Exemplary hypofraction doses are 3 Gy to 20 Gy per fraction.
  • CHART Continuous Hyperfractionated Accelerated Radiation therapy
  • FLASH RT includes contacting the tumor in the subject with a radiosensitizer.
  • radiosensitizers include hypoxia radiosensitizers such as
  • the radiosensitizer can also be a DNA damage response inhibitor interfering with base excision repair (BER), nucleotide excision repair (NER), mismatch repair (MMR), recombinational repair comprising homologous recombination (HR) and non-homologous end-joining (NHEJ), and direct repair mechanisms.
  • BER base excision repair
  • NER nucleotide excision repair
  • MMR mismatch repair
  • recombinational repair comprising homologous recombination (HR) and non-homologous end-joining
  • HR homologous recombination
  • NHEJ non-homologous end-joining
  • SSB repair mechanisms include BER, NER, or MMR pathways whilst DSB repair mechanisms consist of HR and NHEJ pathways. Radiation causes DNA breaks that if not repaired are lethal.
  • Radiosensitizer can include DNA damage response inhibitors such as Poly (ADP) ribose polymerase (PARP) inhibitors.
  • the biomarkers described herein are useful in developing and modifying treatment plans for patients diagnosed with a tumor or cancer.
  • the treatment plan can include visualizing or measuring the tumor volume that needs to be irradiated, the optimal or effective dose of radiation administered to the tumor, and the maximum dose to prevent damage to nearby healthy tissue or organs at risk.
  • Algorithms can used in treatment planning, and include dose calculation algorithms based on the particular radiotherapy technique parameters employed, e.g., gantry angle, MLC leaf positions, etc., and search algorithms which use various techniques to adjust system parameters between dose calculations to optimize the effectiveness of the treatment.
  • Exemplary dose calculation algorithms include various Monte Carlo (“MC”) techniques and pencil beam convolution (“PBC”).
  • Exemplary search algorithms include various simulated annealing (“SA”) techniques, algebraic inverse treatment planning (“AITP”), and simultaneous iterative inverse treatment planning (“SIITP”). Such techniques, and others, are included within the scope of this disclosure.
  • SA simulated annealing
  • AITP algebraic inverse treatment planning
  • SIITP simultaneous iterative inverse treatment planning
  • Treatment planning algorithms may be implemented as part of an integrated treatment planning software package which provides additional features and capabilities. For example, a dose calculation algorithm and search algorithm may be used to optimize a set of fluence maps at each gantry angle, with a separate leaf sequencer used to calculate the leaf movements needed to deliver them. Alternatively, a dose calculation algorithm and search algorithm may be used to directly optimize leaf movements and other machine parameters.
  • the EclipseTM Treatment Planning System offered by the assignee of the present application includes such an integrated software program.
  • the biomarkers described herein can be used to monitor the progress of tumor control after FLASH radiation therapy. For example, the expression levels of the biomarkers before and after ionizing FLASH radiation therapy can be compared. In some embodiments, if the expression levels of biomarkers increase after radiotherapy, this suggests that the tumor is continuing to grow in size. Thus, the radiation treatment can be modified based on monitoring tumor growth using the biomarkers described herein.
  • Radiotherapy techniques include external-beam radiotherapy (“EBRT”) and Intensity Modulated Radiotherapy (“IMRT”), which can be administered by a radiotherapy system, such as a linear accelerator, equipped with a multileaf collimator (“MLC”).
  • EBRT external-beam radiotherapy
  • IMRT Intensity Modulated Radiotherapy
  • MLC multileaf collimator
  • exemplary radiation therapy techniques include stereotactic body radiotherapy (SBRT), volumetric modulated arc therapy, three-dimensional conformal radiotherapy (“3D conformal” or“3DCRT”), image-guided radiotherapy (IGRT).
  • the radiation therapy techniques can also include Adaptive radiotherapy (ART), a form of IGRT that can revise the treatment during the course of radiotherapy in order to optimize the dose distribution depending on patient anatomy changes, and organ and tumor shape.
  • ART Adaptive radiotherapy
  • a radioactive source is implanted within the body of the subject, such that the radioactive source is near the tumor.
  • radiotherapy should be broadly construed and is intended to include various techniques used to irradiate a patient, including use of photons (such as high energy x-rays and gamma rays), particles (such as electron and proton beams), FLASH RT, and radiosurgical techniques.
  • photons such as high energy x-rays and gamma rays
  • particles such as electron and proton beams
  • FLASH RT FLASH RT
  • any method of providing conformal radiation to a target volume is intended to be within the scope of the present disclosure.
  • FLASH radiation therapy described herein can be administered in combination with one or more therapeutic agents.
  • therapeutic agents include immune modulators, senolytic agents, radiosentizers, and nanoparticles.
  • the therapeutic agent is a mitotic spindle inhibitor.
  • flash radiation therapy is combined with a mitotic spindle inhibitor such as a cyclin inhibitor, for example, a CDK4/6 inhibitor (e.g., Pablociclib), AURKA inhibitors such as the small molecules Alisertib and Tozasertib, compounds that block TPX2-AURKA complexes such as a complex disruptor (GSK1070916) (Asteriti et al., 2015; Janedek et al., 2016), and Taxanes (such as Docetaxel, Paclitaxel).
  • the therapeutic agent is a DNA repair and response pathway inhibitor.
  • flash radiation therapy is combined with a PARP inhibitor (e.g., Talazoparib, Rucaparib, Olaparib) (Lord and Ashworth, 2016; Murai et al., 2012), a RAD51 inhibitor (RI-1), or an inhibitor of DNA damage response kinases such as CHCK1 (AZD7762), ATM (KU-55933, KU-60019, NU7026, VE-821), and ATR (NU7026).
  • a PARP inhibitor e.g., Talazoparib, Rucaparib, Olaparib
  • RI-1 RAD51 inhibitor
  • CHCK1 RAD51 inhibitor
  • ATM KU-55933, KU-60019, NU7026, VE-821
  • ATR NU7026
  • the therapeutic agent is an inhibitor of the KRAS and/or MAPK pathway.
  • flash radiation therapy is combined with inhibitors upstream and/or downstream of KRAS.
  • Upstream inhibitors can target EGFR (Erlotinib, Gefitinib, Lapatinib, Afatinib) and/or SHP2 (RMC-4550). Downstream inhibitors include inhibitors of MEK (Trametinib, Selumetinib, PD0325901), BRAF (Dabrafenib, Vermurafenib, PLX-4720), or ERK (SCH772984, LY3214996, GDC-0994).
  • MEK Trametinib, Selumetinib, PD0325901
  • BRAF Dabrafenib, Vermurafenib, PLX-4720
  • ERK SCH772984, LY3214996, GDC-0994.
  • the therapeutic agent is an inhibitor of the Epithelial to
  • TGF-beta is a known driver of EMT.
  • flash radiation therapy is combined with an inhibitor of the EMT Transition, such as a small molecule inhibitor (e.g., SD-208, LY2109761, LY21157299) or an antibody or fragments thereof that binds TGF-beta.
  • a small molecule inhibitor e.g., SD-208, LY2109761, LY21157299
  • the therapeutic agent induces or is an activator of the TH1 Pathway.
  • T helper type 1 (Thl) cells are a subset of CD4 1 effector T cells and play a key role in immune response as well as cancer immunotherapy. Th 1 subtype cells are involved in activating antigen presenting cells (APCs) and also of recruitment of macrophages or mast cells to the tumor site [1] They are also involved in direct activation of cytokines in the tumor
  • flash radiation therapy is combined with an activator of the TH1 pathway, such as an adjuvant that induces Thl activity.
  • the adjuvants that can be used in combination with FLASH radiation include but are not limited to 1) cytokines associated with Thl activation such as IL-12, IFN- alpha, beta or gamma, IL-2, IL-18, IL-27, CD80 (drug target abatacept, beletacept, galaximab), ICAM1 and TNF-alpha [3]; 2) Toll-like receptor agonists for TLR4 and TLR9, such as monophosphoryl lipid A and Bacillus Calmette-Guerin, Agatolimod, ISS-1018, HYB2055, and MGN1703; 3) STAT3 modulators like danvatirsen and OPB-31121; and 4) Inactivated bacteria/parasites or their derivates that trigger interferon gamma or IL-12 production, included but not limited to Listeria monocytogenes , Leishmania major and Toxoplasma gondii, Mycobacterium
  • luberados is, staphylococcus enteroxin B and unmethylated CpG nucleotides that activate Thl response in the body
  • gene therapy systems including bacterial or virus based gene expression systems that lead to production of IL2, IL-12 and IFN-gamma when injected at the tumor site can be used to activate the Thl response.
  • the therapeutic agent is an activator of the Phosphatase and Tensin Homolog (PTEN) pathway, which is protective for carcinogenesis.
  • PTEN Phosphatase and Tensin Homolog
  • the PTEN pathway was activated in Flash irradiated tissues, and therefore Flash irradiation is predicted to have protective effects on tissue compared to conventional radiation.
  • the inventors also observed reduced lung fibrosis in Flash vs conventional irradiated mice, and therefore Flash irradiation could reduce lung fibrosis through activation of the PTEN pathway. Therefore, in some embodiments, flash radiation therapy is combined with an activator of the PTEN pathway.
  • Activators/agonists of the PTEN pathway are described in US 2011/0189169 Al, and include mTOR inhibitors such as rapamycin (Rapamune®, sirolimus, ATC code L04AA10 commercially available from Wyeth) and its chemical analogues such as CCI-779 (temsirolimus, Anatomical Therapeutic Chemical (ATC) code L01XE09, commercially available from Wyeth), RAD-001 (everolimus, ATC code L04AA18. commercially available from Novartis) and AP- 2357 (Granville et al., Clin. Cancer Res. 12:679, 2006), which are herein incorporated by reference.
  • mTOR inhibitors such as rapamycin (Rapamune®, sirolimus, ATC code L04AA10 commercially available from Wyeth) and its chemical analogues such as CCI-779 (temsirolimus, Anatomical Therapeutic Chemical (ATC) code L01XE09, commercially available from Wyeth),
  • Additional activators of PTEN activity include Src inhibitors, p38 MAPK modulators, NF-kB inhibitors, PPAR-gamma modulators, and IGF-1R modulators; Ublituximab, Rituximab, Sunitinib, (Induces PTEN), Trastuzumab and Pertuzumab (Increases PTEN through Src inhibition), Resistin (p38 MAPK modulator, increases PTEN), Simvastatin (NF-kB inhibitor), Lovastatin and Rosiglitazone (PPAR-gamma modulators), NVP-AEW541 (IGF-1R modulator that increases PTEN), and PP1 Herbimycin (Src inhibitors) (see Boosani et al Expert Opin Ther Pat. 2013 May; 23(5): 569-580.)
  • the therapeutic agent is an inhibitor of the TGF-beta pathway.
  • TGF-beta is a protein known to be involved in several normal tissue toxicity effects including lung fibrosis.
  • Bone morphogenic proteins (BMPs) are members of the TGF-beta superfamily, and the BMP pathway is downregulated following Flash treatment. Flash treated mice also exhibited reduced lung fibrosis compared to mice treated with conventional radiation.
  • flash radiation therapy is combined with an inhibitor of the TGF-beta pathway, such as a small molecule inhibitor (e.g., SD-208, LY2109761, LY21157299) or an antibody or fragment thereof that binds TGF -beta.
  • the therapeutic agent is an activator or inducer of Type 1 interferons (IFNs), which influence the development of innate and adaptive immune responses.
  • IFNs Type 1 interferons
  • the IFN signaling pathway was downregulated in FLASH treated animals when compared to conventional radiation treatment.
  • Type 1 interferons modulate innate immune responses in a balanced manner that promotes antigen presentation and natural killer cell functions while restraining pro-inflammatory pathways and cytokine production.
  • Type 1 interferons also activate the adaptive immune system, promoting the development of high-affinity antigen-specific T and B cell responses and immunological memory.
  • Type 1 interferons in the microenvironment promote the maturation and antigen presentation of DCs and boost endogenous NK or CD8+ T- cell mediated antitumor immune responses.
  • flash radiation therapy is combined with an activator or inducer of Type 1 interferons, which is expected to create an environment in which immune cells, including T-cells, can eradicate tumor cells.
  • the activator or inducer of Type 1 interferons is an activator of the STING/cGAS pathway.
  • Activators of the STING/cGAS pathway include, synthetic CDN STING agonists, small molecule STING agonists, small molecule STING pathway agonists, viruses encoding STING pathway agonists, bacteria encoding STING pathway agonists, or STING agonist encapsulated nanoparticles and liposomes.
  • the interferon activator includes compounds that bind and activate Toll-like receptors (TLR) such as TLR4 and TLR9, and compounds that active the MAYS pathway.
  • TLR Toll-like receptors
  • the therapeutic agent is an activator of Dendritic Cell (DC) maturation.
  • DC maturation is down-regulated following FLASH treatment. Regulation of phagocytic functions in dendritic cells, and thereby antigen processing and presentation by innate signaling, represents a critical level of integration of the adaptive and innate immune systems.
  • flash radiation therapy is combined with an activator of DC maturation, such as a synthetic peptide vaccine.
  • inhibitors of CD47/SIRP-alpha can be used to enhance antigen-cross presentation by dendritic cells and increased T-cell priming.
  • flash radiation therapy is combined with an inhibitors of CD47/SIRP-alpha, such as, among others, antibodies, antibody derivatives or fragments therof, and compounds or small molecules that inhibit the CD47/SIRP-alpha interaction.
  • the therapeutic agent is an Aryl Hydrocarbon Receptor (ahR) inhibitor.
  • flash therapy is combined with an ahR inhibitor, such as SRI, CH-223191, UM729, or Galangin.
  • the FLASH radiation therapy described herein can be administered in combination with one or more immune modulators.
  • the combination therapy can provide an increased antitumor response (a positive clinical response) compared to administration of either treatment as monotherapy.
  • the immune modulator can be selected from the group consisting of an inhibitor to an inhibitory checkpoint molecule, an activator of a stimulatory checkpoint molecule, a chemokine inhibitor, an inhibitor of macrophage migration inhibitory factor (MIF), a growth factor, a cytokine, an interleukin, an interferon, an antibody that binds to an immune system cell, such as a bispecific antibody that binds to T-cells and a tumor antigen, a cellular immune modulator such as a CAR-T cell, a vaccine, an oncolytic virus, and any combination thereof.
  • MIF macrophage migration inhibitory factor
  • Immune modulators can include small molecules and biologic therapies (e.g., antibodies, fragments thereof, and derivatives thereof) that bind molecules expressed on the surface of immune system cells, such as antigen presenting cells and T-cells.
  • biologic therapies e.g., antibodies, fragments thereof, and derivatives thereof
  • Biologic therapies can also include bispecific antibodies, fragments thereof, and derivatives thereof that bind to both antigen presenting tumor cells and T-cells.
  • Immune modulators also can include small molecules that inhibit or stimulate the immune system.
  • the immune modulator stimulates CD27+ immune cells, or inhibits one or more inhibitory checkpoint molecule(s) including PD-1, PD-L1, PD-L2, CTLA-4, BTLA, A2aR, B7-H2, B7-H3, B7-H4, B7-H6, CD47, CD48, CD160, CD244 (2B4), CHK1, CHK2, CGEN-15049, ILT-2, ILT-4, LAG- 3, VISTA, gp49B, PIR-B, TIGIT, TIM1, TIM2, TIM3, TIM4, KIR, and ligands thereof, and others.
  • Immune checkpoint pathways and signaling molecules are described in, e.g., Pardoll, Nature Rev Cancer, 2012, 12:252-264; and Mellman et al., Nature, 2011, 480:480- 489.
  • An inhibitor of an inhibitory checkpoint molecule can be an antibody or fragment thereof that specifically binds or recognizes PD-1, PD-L1, PD-L2, CTLA-4, BTLA, A2aR, B7- H2, B7-H3, B7-H4, B7-H6, CD47, CD48, CD160, CD244 (2B4), CHK1, CHK2, CGEN-15049,
  • the CTLA-4 inhibitor is selected from the group consisting of ipilimumab, tremelimumab, and the like.
  • a small molecule immune modulator is an inhibitor of the enzyme indolamine 2,3-dioxygenase (IDO).
  • the immune modulator is an inhibitor of PD-1, PD-L1, PD-L2, or CTLA-
  • the PD-1 inhibitor is selected from the group consisting of pembrolizumab, nivolumab, lambrolizumab, pidilizumab, AMP-244, MEDI-4736, MPDL328 OA, MIH1, IBI-308, mDX-400, BGB-108, MEDI-0680, SHR-1210, PF-06801591, PDR-001, GB-226, STI-l 110, biosimilars thereof, biobetters thereof, and bioequivalents thereof.
  • the PD-L1 inhibitor is selected from the group consisting of durvalumab, atezolizumab, avelumab, BMS-936559, ALN-PDL, TSR-042, KD-033, CA-170, STI-1014, KY- 1003, biosimilars thereof, biobetters thereof, and bioequivalents thereof.
  • the activator of the stimulatory checkpoint molecule is a small molecule, antibody or a fragment thereof, a polypeptide-based activator, a polynucleotide-based activator (i.e., an aptamer), agonist, agonist antibody or fragment thereof, and the like.
  • the stimulatory checkpoint molecule can be B7-1 (CD80), B7-2 (CD86), 4-1BB (CD137), 0X40 (CD 134), HVEM, inducible costimulator (ICOS), glucocorticoid-induced tumor necrosis factor receptor (GITR), CD27, CD28, CD40, or a ligand thereof.
  • a chemokine inhibitor is administered as an immune modulator.
  • the chemokine inhibitor can be a small molecule, or antibody or fragment thereof that specifically binds to the chemokine (or its receptor) and inhibits its activity.
  • the chemokine is selected from the group consisting of CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL12, CCL13, CCL14, CCL15, CCL16, CCL17, CCL18, CCL19, CCL20, CCL21, CCL22, CCL23, CCL24, CCL5, CCL26, CCL27, CCL28, CXCL1, CXCL2, CXCL3, CXCL4, CXCL5, CXCL6, CXCL7, CXCL8, CXCL9, CXCL10, CXCL11, CXCL12, CXCL13, CXCL14, CXCL5, and CXCL16, or any other chemokine that is associated with cancer such as trafficking leukocytes into the tumor microenvironment (e.g., control leukocyte infiltration to the tumor).
  • the chemokine inhibitor binds to a chemokine receptor selected from the group consisting of CCR1, CCR
  • an immune modulator include but are not limited to an anti- TIM4 antibody, an anti-MFG-E8 antibody, an anti-M199 antibody, any combination thereof, and the like.
  • the immune modulator includes agents (antibodies or small molecules) involved in priming and activation of the immune systems, and includes agents targeting CTLA4, B7 (B7-lor B7-2), PD-L1/PD-L2, or PD-1, or agents targeting the binding interactions between CTLA4 and B7-1/B7-2, or PD-1 and PD-L1/PD-L2.
  • Agents targeting CTLA4, B7 (B7-lor B7-2), PD-L1/PD-L2, and PD-1 include antibodies that specifically bind these molecules, such as monoclonal antibodies.
  • the agent is an antibody that specifically binds to LAG 3, ⁇ M1, ⁇ M3, MFG-E8, IL-10, or Phosphatidylserine.
  • the immune modulators described herein can be administered at therapeutically effective doses.
  • Therapeutically effective doses can be determined by one of ordinary skill in the art based on the type of immune modulator administered. Dosage, routes of administration, and administration schedules described in the art can be used. Representative doses are available in the Merck Manual Professional Edition (see the internet at merckmanuals.com/professional).
  • doses of immune modulators administered to animals can be converted to equivalent doses for humans based on the body surface area (BSA) (represented in mg/m2) normalization method (see, e.g., Reagan-Shaw, S. et al.,“Dose translation from animal to human studies revisited,” FASEB J. 22, 659-661 (2007); and“Guidance for Industry - Estimating the Maximum Safe Starting Dose in Initial Clinical Trials for Therapeutics in Adult Healthy
  • BSA body surface area
  • HED human equivalent dose
  • HED animal dose in mg/kg x (animal weight in kg/human weight in kg)0.33
  • the HED can be determined by the following formula P:
  • HED animal dose (mg/kg) x (animal Km/human Km)
  • Km factor is determined based on the following Table (see Guidance for Industry,
  • mice a 5 mg/kg dose in mice is equivalent to a 0.4 mg/kg dose in a 60 kg human.
  • a 0.4 mg/ml dose in a 60 kg human is equivalent to a dose of 14.8 mg/m2.
  • the immune modulators described herein are administered in therapeutically effective amounts for periods of time effective to treat a cancer or tumor.
  • the effective amount of the immune modulators described herein can be determined by one of ordinary skill in the art and includes dosage amounts for a mammal of from about 0.5 to about 200 mg/kg, about 0.5 to about 150 mg/kg, about 0.5 to 100 mg/kg, about 0.5 to about 75mg/kg, about 0.5 to about SOmg/kg, about 0.01 to about SOmg/kg, about 0.05 to about 25 mg/kg, about 0.1 to about 25 mg/kg, about 0.5 to about 25 mg/kg, about 1 to about 20 mg/kg, about 1 to about 10 mg/kg, about 20mg/kg of body weight, about 10 mg/kg, about 5 mg/kg, about 2.5 mg/kg, about 1.0 mg/kg, or about 0.5 mg/kg of body weight of the immune modulator, or any range derivable therein.
  • the dosage amounts of the immune modulators are from about 0.01 mg/kg to about 10 mg/kg of body weight. In some embodiments, the dosage amount of the immune modulator is from about 0.01 mg/kg to about 5 mg/kg, or from about 0.01 mg/kg to about 2.5 mg/kg of body weight.
  • the compositions described herein can be
  • compositions described herein can also be administered for various treatment cycles, such as 2,
  • the treatment cycles can be different lengths of time depending on the cancer to be treated, for example, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 week treatment cycles.
  • the effective amount of an immune modulator described herein can be determined during pre-clinical trials and clinical trials by methods known to physicians and clinicians.
  • mice 392 age and sex matched mice were treated in 6 Cohorts and sacrificed lhr- 36 wks after lung irradiation. 4 Groups in each cohort: Sham: no radiation; Conventional: lGy/s; FLASH: 40Gy/s beam on; Split-FLASH: 4Gy/0.1sec, pulsed delivery (see Fig. 5). Animals were euthanized either 24 hours, 8 weeks, 16 weeks or 24 weeks after radiation and lungs collected.
  • RNA isolation and quality control ⁇ were taken, three male and three female each from four different treatment groups, i.e. Sham, Conventional 15 Gy, Flash 15 Gy and Split Flash 15 Gy.
  • RNA isolation and quality control ⁇ were taken using Qiagen RNasy Tissue microarray kit (Qiagen cat 74104). Briefly, frozen middle left lung from mice (20-30 mg) was homogenized in liquid nitrogen and RNA isolated using the manufacturers protocol.
  • Integrity of the isolated RNA was assessed using the 2100 Bioanalyzer (Agilent technologies) and only samples with RNA integrity number of at least 7 or 28/18S ratio of 1.3 or higher were considered for further processing.
  • Expression Profile pre-processing & normalization After image extraction using Mapix software correlation analysis between technical replicates was conducted to identify any technical replicates which did not correlate with their sibling replicates. Any arrays that passed QC were consolidated into one file by calculating the median of each technical replicate’s mean intensity and median background. Data files were analyzed using an R package Limma (Ritchie et al., 2015). After uploading data, mean fluorescent intensities arrays were quantile normalized to allow comparisons across different groups(Bolstad et al., 2003). In order to handle flagged spots a weight of 0 for all flags with values less than -50 was assigned. This ensured that during the linear fitting of the data that these points are not be considered for linear fitting.
  • GSEA Gene Set Enrichment Analysis
  • IPA Ingenuity Pathway Analysis
  • IPA queries the Ingenuity Pathways Knowledge Base for interactions between the focused genes first and then all other gene objects stored in the knowledge base. For our data, genes that met the parametric P value of 0.05 were queried for IPA Core analysis followed by identification of major canonical pathways modulated.
  • the significance of the association between the data set and the canonical pathway was determined based on two parameters: (1) A ratio of the number of genes from the data set that map to the pathway divided by the total number of genes that map to the canonical pathway and (2) a P value calculated using Fischer's exact test, followed by Benjamini Hotchberg correction (FDR cutoff value of ⁇ 0.1) determining the probability that the association between the genes in the data set and the canonical pathway is due to chance alone 3) An absolute value cutoff of Z score 1.5 or above to predict the enrichment and activation status of a particular pathway. The pathways that met all these criterion were predicted to be significantly regulated.
  • TUNEL deoxynucleotidyl transferase dUTP nick end labeling
  • Lung Function Lung and penh was evaluated using Whole Body Plethysmograph (Jackson et Health Physics 2014). A baseline measure of penh was taken and thereafter animals were monitored every 2 weeks for lung function. The results are shown in FIG. 6.
  • Lung Fibrosis Mice were either untreated or treated either conventional, Flash or split flash radiation. At various time points 16, 24 and 36 weeks the mice were euthanized, lung tissue was fixed in formalin and embedded in parafilm.
  • the lung sections were stained with mas son trichome and H&E stains and microscopic evaluation was performed by a trained pathologist who scored for fibrosis using the MFSS scoring scheme from 0-8 (Ashcroft Journal of Clinical Pathology 1988 and Hubner et al Biotechniques 2008), with 0 being no fibrosis and 8
  • FIG. 6 shows improved lung function for FLASH when compared to Conventional radiation treatment. This difference confirms the presence of dose rate dependence of radiation toxicity.
  • FIG. 10 shows a 23% reduction in average lung fibrosis severity for FLASH over Conventional group at 17.5 Gy. This difference confirms the presence of dose rate dependence of radiation toxicity.
  • FIG. 11 shows an increased average lung weight for Conventional when compared to FLASH treatment - 0.46 g vs. 0.40 g (M); 0.37 g vs. 0.32 g (F)). This study indicates normal tissue sparing for FLASH.
  • FIG. 7 shows an improved median survival for FLASH over Conventional radiation treament groups: 20.0 Gy: 14% increase; 17.5 Gy: 18% increase.
  • FIG. 9 shows a reduction in average dermatitis for FLASH when compared to
  • Flash radiotherapy FLASH RT modalities synergize with mitotic spindle inhibitors
  • FIG. 12 shows Venn Diagrams of Differentially Expressed genes at each time point.
  • GSEA at 24 hours revealed G2M checkpoint and E2F Targets were repressed by all radiotherapy modalities (Fig. 13 A). These signatures suggest that cells are arresting at G1 and G2M post treatment.
  • E2F targets include a broad range of genes; however, cyclins are major targets for this pathway ⁇ cite ⁇ . Therefore, the use of Flash RT in combination with CDK4/6 inhibitor
  • the mitotic spindle was specifically downregulated in both flash and split flash groups (Fig. 14A, 14B).
  • An overlap analysis of the core enrichment genes for each group shows that key regulators of mitotic spindle genes were downregulated such as AURKA, Kinesin-Like protein family genes (KIF11, KIF23, KIF23, KIF4A) and TPX2 (Fig. 14C, 14D)
  • AURKA and TPX2 Emerging evidence that AURKA and TPX2 play major roles in driving acquired resistance in the context of several targeted therapies (Donnella et al., 2018; Panicker et al., 2017).
  • AURKA expression increases to drive drug resistance, thus blocking AURKA expression may be important for the efficacy of Flash and Split Flash therapies.
  • TPX2 is a driver of AURKA and blocking TPX2-AURKA complexes using a complex disruptor (GSK1070916) (Asteriti et al., 2015; Janedek et al., 2016) is indicated.
  • mitotic spindle integrity can be targeted by using Taxanes (Docetaxel, Paclitaxel).
  • FLASH RT upregulated Mitotic Spindle genes Fig. 13D
  • Flash RT specifically repressed DNA repair pathways genes.
  • Flash RT downregulated the Hallmark DNA Repair pathway (Fig. 13 A & 15 A).
  • HR Homology Directed Repair
  • LIG1, RAD51, and BRCA2 Fig. 15B for full list.
  • the immediate implication of these downregulated genes suggest that flash therapy induces & BRCAness phenotype, therefore targeting tumors with PART inhibitors (Talazoparib, Rucaparib, Olaparib) in combination with FLASH RT (Lord and Ashworth, 2016; Murai et al., 2012) may be indicated.
  • RAD51 is required for the repair of double stranded breaks thus to the combination of FLASH RT and RAD51 inhibitors (RI-1) may synergize.
  • targeting other DNA damage response kinases such as CHCK1 (AZD7762), ATM (KU-55933, KU-60019, NU7026, VE-821), ATR (NU7026), can also be effective in the context of flash RT induced BRCAness (Ashworth and Lord, 2018; Lord and Ashworth, 2016).
  • KRAS Signaling Up was enriched in conventional and FLASH groups between 8-24 weeks ( Figure 16A-C).
  • KRAS signaling is a major driver of cancer and drives many biological programs through the MAPK pathway including proliferation, cell cycle progressing and pro-survival signaling (Sim et al., 2015).
  • conventional radiation therapy depends on blocking EGF/EGFR signaling (Wang et al., 2011). While direct inhibitor of RAS are still in early stages, the aim is to block up and downstream RAS signaling (Downward, 2003) using the combination of FLASH RT with inhibitors upstream and downstream of KRAS.
  • upstream inhibitors such as, EGFR (Erlotinib, Gefitinib, Lapatinib, Afatinib) and SHP2 (RMC-4550) can be targeted in combination with FLASH therapy.
  • downstream inhibitors such as MEK (Trametinib, Selumetinib, PD0325901), BRAF (Dabrafenib, Vermurafenib, PLX-4720), orERK (SCH772984, LY3214996, GDC-0994) can be combined with FLASH RT.
  • Radiotherapy induced EMT Radiotherapy induced EMT
  • EMT Epithelial to Mesenchymal Transition was an upregulated pathway in Flash between 8 to 16 weeks (Fig. 13B-C); however, at the end of 24 weeks EMT was upregulated in both Conventional and Flash Treatments (Figure 17A-B).
  • EMT is known to drive resistance to both targeted and non-targeted therapies and thus may pose a challenge to the efficacy of radiotherapy modalities (Kitai and Ebi, 2016; Liang et al., 2015).
  • EMT is a consequence of gene expression changes that drive cells from one state to another, thus targeting EMT may pose a challenge.
  • LY21157299 may prevent EMT from occurring and give rise to radioresistant tumors (Foroutan et al., 2017) Differential gene expression analysis:
  • IPA analysis revealed that many canonical pathways were altered by these different radiation treatment regimens. Major changes were observed at the initial time point of 24 hrs where most of the regulation at RNA level happens that is captured by the genome wide microarray. Most of the pathways significantly upregulated (p value ⁇ 10.05, Z score of > 1.5 and FDR 0.1) in the conventional radiation were involved in inflammatory' response like
  • Interferon signaling Interferon signaling, IL-8 signaling, STAT3 signaling, GP6 signaling pathway and
  • phospholipase C signaling Some cancer associated pathways were upregulated as well, like the pancreatic adenocarcinoma signaling and colorectal cancer metastasis signaling. Cyclin and cell cycle regulation pathway was predicted to be inhibited after conventional irradiation. ( Figure 18 and Table 6A-C). At 24 hrs for Flash radiation most of the pathways were downregulated and that included Mitotic roles of polo-like kinases, estrogen-mediated S phase entry, Aryl hydrocarbon receptor signaling, cyclin and cell cycle regulation, TUI for helper T cells pathway, dendritic cell maturation and Calcium induced T lymphocyte apoptosis. In the split flash pathways regulated mostly involved cell cycle with distinct phases of cell cycle been modulated differentially along with the p53 pathway. The common pathway modulated by all the treatment types was Cyclin and cell cycle regulation, that is known to be disrupted after radiation treatment.
  • Thl cells are a subset of CD4’ effector T cells and play a key role in immune response as well as cancer immunotherapy. Thl subtype are involved in activating antigen presenting cells (APCs) and also of recruitment of macrophages or mast cells to the tumor site[l ]. They are also involved in direct activation of cytokines in the tumor microenvironment that can lead to enhanced tumor cell kill[2]. This pathway was found to be inhibited by Flash compared to untreated mice, therefore flash radiation and immunotherapy combinations will work more effectively when combined with adjuvants that induce Thl activity.
  • APCs antigen presenting cells
  • macrophages or mast cells to the tumor site[l ].
  • This pathway was found to be inhibited by Flash compared to untreated mice, therefore flash radiation and immunotherapy combinations will work more effectively when combined with adjuvants that induce Thl activity.
  • the adjuvants to be used in combination with FLASH delivery include but are not limited to 1) cytokines associated with Thl activation such as IL-12, IFN- alpha, beta or gamma, IL-2, IL-18, IL-27, CD80 (drug target abatacept, beletacept, galaximab), ICAM1 and TNF-alpha[3]; 2) Toll-like receptor agonist for TLR4 and TLR9 such as monophosphoryl lipid A and Bacillus Calmette-Guerin, Agatolimod, ISS-1018, HYB2055, and MGN1703; 3) STAT3 modulators like danvatirsen and OPB-31121; 4) Live bacteria (such as Listeria monocytogenes) or intracellular parasites (such as Leishmania major and Toxoplasma gondii), or compounds derived therefrom that trigger interferon gamma or IL-12 production, Bacterial
  • Flash radiation may spare T lymphocytes both by nature of its being quicker treatment modality (higher dose rate) that avoids irradiating more blood and also through downregulation of this pathway thus leading to molecular sparing of T lymphocytes.
  • Lymphocytes are considered an oi$an-at-risk during radiation therapy and many organs with a high blood flow like lungs and brain have to be limited in dose to reduce lymphocyte kil ling[5].
  • Flash radiation in combination with treatment planning algorithms can be used to treat organ sites with a high lymphocyte count. This lymphocyte sparing will also have implications in providing effective immunotherapy combinations with radiation.
  • PTEN Phosphatase and tensin homolog (PTEN) pathway that is protective for carcinogenesis w r as activated in Flash, therefore predicting that maybe perhaps Flash can have protective effects on tissue compared to conventional.
  • Loss of PTEN expression in mouse fibroblast is shown to result in lung fibrosis (Parapuram et al, Matrix Biol 2015).
  • PTEN knockout mice treated with bleomycin (radio-mimetic drug) showed increased lung fibrosis. Because reduced lung fibrosis was observed in Flash vs conventional radiation treatment(Fig. 10), one of the mechanisms through which Flash results in reduced lung fibrosis could be through the activation of PTEN pathway.
  • Activators/agonists of the PTEN pathway are described in US 2011/0189169 Al , and include mTOR inhibitors such as rapamycin
  • Pertuzumab Increases PTEN through Src inhibition
  • Resistin p38 MAPK modulator, increases PTEN
  • Simvastatin NFO-kB inhibitor
  • Lovastatin and Rosiglitazone PPAR-gamma modulators
  • NVP-AEW541 IGF-1R modulator that increases PTEN
  • PP1 Herbimycin Src inhibitors
  • BMP pathway Bone morphogenic proteins (BMPs) are members of the TGF-beta superfamily. TGF-beta is a protein known to be involved in several normal tissue toxicity effects including lung fibrosis. The BMP pathway was downregulated at 16 week time point in the Flash treatment group. Flash treated samples also exhibited reduced lung fibrosis at 16 and 24 week time points. Therefore, inhibiting the TGF-beta pathway may reduce normal tissue toxicity.
  • BMPs Bone morphogenic proteins
  • Type 1 interferons influence the development of innate and adaptive immune responses.
  • Type 1 interferons modulate innate immune responses in a balanced manner that promotes antigen presentation and natural killer cell functions while restraining pro-inflammatory pathways and cytokine production.
  • Type 1 interferons also activate the adaptive immune system, promoting the development of high- affinity antigen-specific T and B cell responses and immunological memory.
  • Typel interferons in the microenvironment promote the maturation and antigen presentation of DCs and boost endogenous NK or CD8+ T-cell mediated antitumor immune responses.
  • type 1 interferon activators can be used in combination with FLASH delivery to create an environment in which immune cells, including T-cells, can thrive to eradicate tumor cells.
  • STING/cGAS pathway One key pathway involved in the production of type 1 interferons is the STING/cGAS pathway.
  • Stimulator of interferon genes is an intracellular signaling molecule that senses cyclic dinucleotides (CDNs).
  • CDNs are derived from infectious agents exogenously, or are produced by the mammalian dsDNA sensor cGAS (cyclic guanosine monophosphate - adenosine monophosphate; cyclic GMP-AMP synthase).
  • cGAS cyclic guanosine monophosphate - adenosine monophosphate
  • GMP-AMP synthase cyclic GMP-AMP synthase
  • activators of the STING/cGAS pathway can be used in combination with FLASH delivery to create an environment in which immune cell can thrive to eradicate tumor cells.
  • These activators include, among others, synthetic CDN STING agonists, small molecule STING agonists, small molecule STING pathway agonists, viruses encoding STING pathway agonists, bacteria encoding STING pathway agonists, or STING agonist encapsulated nanoparticles and liposomes.
  • Other type 1 interferon activators include compounds that bind and activate Toll-like receptors (TLR) such as TLR4 and TLR9, and compounds that active the MAYS pathway.
  • TLR Toll-like receptors
  • Dendritic cell maturation is down-regulated in FLASH. Regulation of phagocytic functions in dendritic cells, and thereby antigen processing and presentation by innate signaling, represents a critical level of integration of the adaptive and innate immune systems. Combination of FLASH and synthetic peptide vaccines could be beneficial to induce long-lasting immune responses.
  • inhibitors of CD47/SIRP-alpha can be used enhance antigen-cross presentation by dendritic cells and increased T-cell priming. These include, among others, antibodies, antibody derivatives and small molecules inhibiting the CD47/SIRP-alpha interaction.
  • Nanoparticles are small particles between 1 and 100 nm in size. They can have different shapes such as spheres, rods, or stars. They can be passively targeted to tumors through the enhanced permeability and retention effect or actively targeted, such as by conjugating antibodies or peptides to the nanoparticles. Furthermore, they can be encapsulated in vesicles or inserted into gel matrices to increase tumor targeting. [0271] It has been previously shown that nanoparticles with a high effective atomic number, such as gold or gadolinium, can have a synergistic effect when administered prior to
  • radiotherapy by providing a dose enhancement (Hainfeld et al., 2004). This is because when hit by photons, the photoelectric effect occurs in the nanoparticles, whereby electrons and additional x-rays are emitted. Furthermore, radiation of nanoparticles can also cause hyperthermia in the tumor, increasing the treatment efficacy. It has also been shown that a dose enhancement can be achieved when using nanoparticles in conjunction with proton therapy (Lin, et al. 2014). Finally, radiation can also be used to modulate and enhance the delivery of nanoparticles to the tumor by altering the tumor microenvironment, such as by reducing the tumor interstitial pressure
  • Flash RT can be used in conjunction with nanoparticles
  • nanoparticles can have a short half-life in the body. It is also challenging and impractical to deliver nanoparticles before each of several treatments in a traditional fractionated schedule. In addition, some nanoparticles can be toxic in high enough concentrations, especially when not quickly cleared from the body. These challenges can be overcome by using nanoparticles in conjunction with Flash radiotherapy. By treating the tumor or tumors in only a single fraction, the nanoparticle concentration in the tumor or tumors could remain high enough throughout the entire treatment, even if the nanoparticles had a relatively short half-life.
  • Nanoparticles with a short half-life would still be effective, possible toxicity would be reduced as the nanoparticles would be cleared from the body quickly.
  • One example of a workflow for Flash radiotherapy in conjunction with nanoparticles is the administration of nanoparticles followed by imaging, such as by CT or MRI. These imaging data are used to create a Flash radiotherapy treatment plan, considering the distribution of the nanoparticles. Then, prior to treatment, nanoparticles are reinjected and the planned Flash treatment delivered.
  • the Aryl Hydrocarbon Receptor (ahR) Signaling pathway was downregulated in Flash treated lungs.
  • the general function of this pathway is to detect aromatic (aryl) hydrocarbons and activate a suite of xenobiotic-metabolizing genes, specifically cytochrome P450 enzymes. This has major implication for drug combination strategies as the downregulation of this pathway may alter the clearance of other drugs in a patient. Additionally, the activation of this pathway may also promote pan drug resistance to small molecules or the cell’s ability to process toxic agents due to radiotherapy. AhR pathway activation has also been associated with cancer
  • AhR AhR regulates both innate and adaptive immunity, it activates anti- inflammatory Treg cells and M2 macrophages. Therefore the combination of radiotherapy with ahR inhibtors (such as SRI, CH-223191, UM729, Galangin) may suppress the tumors ability to clear toxic agents and activate immune cells.
  • ahR inhibtors such as SRI, CH-223191, UM729, Galangin
  • FIG. 24 is a graph showing the TUNEL results.
  • the graph shows the average number of counts per animal for the roughly 20 animals per group (males and females pooled). Quantifying TUNEL cells constitutes a counting problem in which the number of TUNEL positive cells is counted per group of animal samples and therefor should follow Poisson statistics.
  • the eaprror bars on the chart indicate the 95% confidence intervals calculated using the exact estimation method articulated by Ulm et al. (Ulm, K., "A simple method to calculate the confidence interval of a standardized mortality ratio
  • NES Normalized Enrichment Score
  • Nom p-val Normalized -values
  • FDR-q-val False Discovery Rate value.
  • the Hh signaling pathway has recently been recognized as an important signaling pathway and a therapeutic target in cancer. In adults, mutation or deregulation of this pathway plays a key role in both proliferation and differentiation leading to tumorigenesis or tumor growth acceleration in a wide variety of tissues. Inappropriate activation of the Hh signaling pathway has been implicated in the development of several other types of cancer including lung, prostate, breast, and pancreas. In addition, some recent findings suggest that Hh might also promote tumorigenesis by signaling in a paracrine manner from the tumor to the surrounding stroma or in cancer stem cells (CSCs). As shown in Figure 25 and Table 7, flash radiation leads to reduced activation of the Hedgehog signaling pathway when compared to conventional proton irradiation.
  • CSCs cancer stem cells
  • the cumulative enrichment score is indicative of downregulation of genes.
  • the components of the Hh/GLI signaling pathway involved in the signaling transfer to GLI transcription factors include Hedgehog ligands (Sonic Hh (SHh), Indian Hh (IHh), and Desert Hh (DHh])), Patched receptor (Ptchl, Ptch2), Smoothened receptor (Smo), Suppressor of fused homolog (Sufu), kinesin protein Kif7, protein kinase A (PKA), and cyclic adenosine
  • GLI GLI monophosphate
  • cAMP monophosphate
  • the activator form of GLI travels to the nucleus and stimulates the transcription of the target genes by binding to their promoters.
  • the main target genes of the Hh signaling pathway are PTCH1, PTCH2, and GLI family zinc finger 1 (GLI1).
  • hedgehog antagonists including but not limited to hedgehog antagonist Smo antagonist, PTCH1 inhibitors like RU-SKI 43, Cyclopamine, Vismodegib, LDE 225, saridegib, BMS 833923, LEQ 506, PF- 04449913 , PF-5274857, GANT61, SANT-1, Glasdegib (PF-
  • TAK-441 may work in combination with Flash therapy.
  • SEQ ID NO: 1 Sonic hedgehog protein (SHH) (HHG-1) (Shh unprocessed N-terminal signaling and C-terminal autoprocessing domains) (ShhNC) [Cleaved into: Sonic hedgehog protein N- product (ShhN) (Shh N-terminal processed signaling domains) (ShhNp)]. (UniProt ID Q 15465) >sp
  • IHH Indian hedgehog protein
  • HHG-2 Indian hedgehog protein [Cleaved into: Indian hedgehog protein N-product; Indian hedgehog protein C-product] (UniProt ID Q14623)
  • DHH Desert hedgehog protein
  • HHG-3 [Cleaved into: Desert hedgehog protein N-product; Desert hedgehog protein C-product] (UniProt ID 043323)
  • SEQ ID NO:8 Protein patched homolog 2 (PTC2). UniProt ID Q9Y6C5. Isoform 1 (Q9Y6C5-
  • SEQ ID NO: 10 Smoothened homolog (SMO) (Protein Gx). UniProt ID Q99835.
  • SEQ ID NO: 11 Suppressor of fused homolog (SUFUH). UniProt ID Q9UMX1. Isoform 1. >sp
  • SEQ ID NO:20 Tnmsducin-like enhancer protein 3 TLE3. UniProt ID Q04726-4. Isoform 4.
  • SEQ ID NO:22 Transducin-like enhancer protein 3 TLE3. UniProt ID Q04726-6. Isoform 6.
  • Adhesion G-protein coupled receptor G1 AGRG1. UniProt ID Q9Y653. Isoform 1. >sp
  • Adhesion G-protein coupled receptor G1 AGRG1. UniProt ID Q9Y653-2. Isoform 2. >sp
  • Adhesion G-protein coupled receptor G1 AGRG1. UniProt ID Q9Y653-3. Isoform 3. >sp
  • Adhesion G-protein coupled receptor G1 AGRG1. UniProt ID Q9Y653-4. Isoform 4. >sp
  • SEQ ID NO:32 Protein patched homolog 1 PTC1. UniProt ID Q13635-2. Isoform L’.
  • SEQ ID NO:35 Transducin-like enhancer protein 1 TLE1. UniProt ID Q04724.
  • SEQ ID NO:40 Ras GTPase -activating protein 1 RASA1. UniProt ID P20936-3. Isoform 3.
  • SEQ ID NO:48 LIM domain-binding protein 1 LDB1. UniProt ID Q86U70-2. Isoform 3.
  • SEQ ID NO:50 Netrin receptor LJNC5C. UniProt ID 095185-2. Isoform 2.
  • SEQ ID NO:54 Neurofibromin NF1. UniProt ID P21359-4. Isoform 4.
  • SEQ ID NO:55 Neurofibromin NF1. UniProt ID P21359-5. Isoform 5.
  • SEQ ID NO:56 Neurofibromin NF1. UniProt ID P21359-6. Isoform 6.
  • SEQ ID NO:57 Cyclin-dependent kinase 6 CDK6. UniProt ID Q00534.
  • SEQ ID NO:58 Cyclin-Veiy low-density lipoprotein receptor VLDLR. UniProt ID P98155. Isoform Long.
  • SEQ ID NO:59 Cyclin-Veiy low-density lipoprotein receptor VLDLR. UniProt ID P98155-2. Isoform Short.
  • SEQ ID NO:60 Neuropilin-2 NRP2. UniProt ID 060462. Isoform A22.
  • AKPKMEIILQFLIFDLEHDPLQ V GEGDCKYDWLDIWDGIPHV GPLIGKY CGTKTP SELRS STGILSLTFHTDMAVAKDGFSARYYLVHQEPLENFQCNVPLGMESGRIANEQISASSTYS DGRWTPQQSRLHGDDNGWTPNLDSNKEYLQVDLRFLTMLTAIATQGAISRETQNGYYVKS YKLEVSTNGEDWMVYRHGKNHKVFQANNDATEWLNKLHAPLLTRFVRIRPQTWHSGIAL RLELFGCRVTDAPCSNMLGMLSGLIADSQISASSTQEYLWSPSAARLVSSRSGWFPRIPQ AQPGEEWLQVDLGTPKTVKGVIIQGARGGDSITAVEARAFVRKFKVSYSLNGKDWEYIQD PRTQQPKLFEGNMHYDTPDIRRFDPIPAQYVRVYPERWSPAGIGMRLEVLGCDWTDSKPT VETLGPTVKSEETTTP
  • AKPKMEIILQFLIFDLEHDPLQ V GEGDCKYDWLDIWDGIPHV GPLIGKY CGTKTP SELRS STGILSLTFHTDMAVAKDGFSARYYLVHQEPLENFQCNVPLGMESGRIANEQISASSTYS DGRWTPQQSRLHGDDNGWTPNLDSNKEYLQVDLRFLTMLTAIATQGAISRETQNGYYVKS YKLEVSTNGEDWMVYRHGKNHKVFQANNDATEWLNKLHAPLLTRFVRIRPQTWHSGIAL RLELFGCRVTDAPCSNMLGMLSGLIADSQISASSTQEYLWSPSAARLVSSRSGWFPRIPQ AQPGEEWLQVDLGTPKTVKGVIIQGARGGDSITAVEARAFVRKFKVSYSLNGKDWEYIQD PRTQQPKLFEGNMHYDTPDIRRFDPIPAQYVRVYPERWSPAGIGMRLEVLGCDWTDSKPT VETLGPTVKSEETTTP
  • SEQ ID NO:63 Neuropilin-2 NRP2. UniProt ID 060462-4. Isofonn B0.
  • AKPKMEIILQFLIFDLEHDPLQ V GEGDCKYDWLDIWDGIPHV GPLIGKY CGTKTP SELRS STGILSLTFHTDMAVAKDGFSARYYLVHQEPLENFQCNVPLGMESGRIANEQISASSTYS DGRWTPQQSRLHGDDNGWTPNLDSNKEYLQVDLRFLTMLTAIATQGAISRETQNGYYVKS YKLEVSTNGEDWMVYRHGKNHKVFQANNDATEWLNKLHAPLLTRFVRIRPQTWHSGIAL RLELFGCRVTDAPCSNMLGMLSGLIADSQISASSTQEYLWSPSAARLVSSRSGWFPRIPQ AQPGEEWLQVDLGTPKTVKGVIIQGARGGDSITAVEARAFVRKFKVSYSLNGKDWEYIQD PRTQQPKLFEGNMHYDTPDIRRFDPIPAQYVRVYPERWSPAGIGMRLEVLGCDWTDSKPT VETLGPTVKSEETTTP
  • SEQ ID NO:65 Neuropilin-2 NRP2.
  • UniProt ID 060462-6 Isoform s9.
  • SEQ ID NO:66 Dihydropyrimidinase-related protein 2 DPYL2. UniProt ID Q16555. Isoform 1.
  • Dihydropyrimidinase-related protein 2 DPYL2. UniProt ID Q16555-2. Isoform 2. >sp
  • SEQ ID NO:68 Neuropilin-1 NRP1. UniProt ID 014786. Isofonn 1.
  • SEQ ID NO:70 Neuropilin-1 NRP1. UniProt ID 014786-3. Isofonn 3.

Landscapes

  • Health & Medical Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Public Health (AREA)
  • General Health & Medical Sciences (AREA)
  • Biomedical Technology (AREA)
  • Medical Informatics (AREA)
  • Chemical & Material Sciences (AREA)
  • Pathology (AREA)
  • Epidemiology (AREA)
  • Urology & Nephrology (AREA)
  • Primary Health Care (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Immunology (AREA)
  • Medicinal Chemistry (AREA)
  • Veterinary Medicine (AREA)
  • Cell Biology (AREA)
  • Molecular Biology (AREA)
  • Hematology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Data Mining & Analysis (AREA)
  • Biotechnology (AREA)
  • Microbiology (AREA)
  • Radiology & Medical Imaging (AREA)
  • Surgery (AREA)
  • Hospice & Palliative Care (AREA)
  • Oncology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Organic Chemistry (AREA)
  • General Chemical & Material Sciences (AREA)
  • Databases & Information Systems (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Food Science & Technology (AREA)
  • Physics & Mathematics (AREA)
  • Analytical Chemistry (AREA)
  • Biochemistry (AREA)
  • General Physics & Mathematics (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)

Abstract

La présente invention concerne des méthodes de traitement de tumeurs par l'administration d'un rayonnement FLASH et d'un agent thérapeutique à un patient atteint d'un cancer. Les méthodes présentent le double avantage d'une efficacité anti-tumorale et d'une protection des tissus normaux lors de l'association d'agents thérapeutiques avec un rayonnement FLASH pour traiter des patients atteints d'un cancer. Les méthodes décrites dans la description de la présente invention permettent également la classification de patients en groupes pour recevoir un traitement par rayonnement optimisé en association avec un agent thérapeutique sur la base de signatures de biomarqueurs spécifiques au patient. L'invention concerne également des méthodes et des systèmes de planification de radiothérapie incorporant un rayonnement FLASH et des agents thérapeutiques.
EP19749118.6A 2018-07-19 2019-07-19 Méthodes d'utilisation de rayonnement à débit de dose ultra élevé et d'agents thérapeutiques Pending EP3823618A1 (fr)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201862700783P 2018-07-19 2018-07-19
PCT/US2019/042603 WO2020018904A1 (fr) 2018-07-19 2019-07-19 Méthodes d'utilisation de rayonnement à débit de dose ultra élevé et d'agents thérapeutiques

Publications (1)

Publication Number Publication Date
EP3823618A1 true EP3823618A1 (fr) 2021-05-26

Family

ID=67515191

Family Applications (1)

Application Number Title Priority Date Filing Date
EP19749118.6A Pending EP3823618A1 (fr) 2018-07-19 2019-07-19 Méthodes d'utilisation de rayonnement à débit de dose ultra élevé et d'agents thérapeutiques

Country Status (3)

Country Link
EP (1) EP3823618A1 (fr)
CN (1) CN112449602A (fr)
WO (1) WO2020018904A1 (fr)

Families Citing this family (22)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9855445B2 (en) 2016-04-01 2018-01-02 Varian Medical Systems, Inc. Radiation therapy systems and methods for delivering doses to a target volume
US10843011B2 (en) 2017-07-21 2020-11-24 Varian Medical Systems, Inc. Particle beam gun control systems and methods
US11712579B2 (en) 2017-07-21 2023-08-01 Varian Medical Systems, Inc. Range compensators for radiation therapy
WO2019018813A1 (fr) 2017-07-21 2019-01-24 Varian Medical Systems, Inc. Procédés d'utilisation de rayonnement à débit de dose ultra élevé et d'agents thérapeutiques
US11590364B2 (en) 2017-07-21 2023-02-28 Varian Medical Systems International Ag Material inserts for radiation therapy
US10549117B2 (en) 2017-07-21 2020-02-04 Varian Medical Systems, Inc Geometric aspects of radiation therapy planning and treatment
US10092774B1 (en) 2017-07-21 2018-10-09 Varian Medical Systems International, AG Dose aspects of radiation therapy planning and treatment
US10183179B1 (en) 2017-07-21 2019-01-22 Varian Medical Systems, Inc. Triggered treatment systems and methods
CN111556776B (zh) 2017-11-16 2022-09-02 瓦里安医疗系统公司 用于放射疗法系统的增加的束输出和动态场成形
US10910188B2 (en) 2018-07-25 2021-02-02 Varian Medical Systems, Inc. Radiation anode target systems and methods
US11116995B2 (en) 2019-03-06 2021-09-14 Varian Medical Systems, Inc. Radiation treatment planning based on dose rate
US10814144B2 (en) 2019-03-06 2020-10-27 Varian Medical Systems, Inc. Radiation treatment based on dose rate
US11103727B2 (en) 2019-03-08 2021-08-31 Varian Medical Systems International Ag Model based PBS optimization for flash therapy treatment planning and oncology information system
US11090508B2 (en) 2019-03-08 2021-08-17 Varian Medical Systems Particle Therapy Gmbh & Co. Kg System and method for biological treatment planning and decision support
US10918886B2 (en) 2019-06-10 2021-02-16 Varian Medical Systems, Inc. Flash therapy treatment planning and oncology information system having dose rate prescription and dose rate mapping
US11291859B2 (en) 2019-10-03 2022-04-05 Varian Medical Systems, Inc. Radiation treatment planning for delivering high dose rates to spots in a target
US11865361B2 (en) 2020-04-03 2024-01-09 Varian Medical Systems, Inc. System and method for scanning pattern optimization for flash therapy treatment planning
US11541252B2 (en) 2020-06-23 2023-01-03 Varian Medical Systems, Inc. Defining dose rate for pencil beam scanning
WO2021260395A1 (fr) * 2020-06-26 2021-12-30 Cancer Research Technology Limited Système de planification de traitement
US11957934B2 (en) 2020-07-01 2024-04-16 Siemens Healthineers International Ag Methods and systems using modeling of crystalline materials for spot placement for radiation therapy
EP4112123A1 (fr) * 2021-07-02 2023-01-04 RaySearch Laboratories AB Planification et optimisation de thérapie à multimodalité
US20240091559A1 (en) * 2022-09-21 2024-03-21 Siemens Healthineers International Ag Enhanced dose rate/ultra-high dose rate radiation and spatially fractioned radiation therapy

Family Cites Families (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2006039569A1 (fr) * 2004-09-30 2006-04-13 The University Of Chicago Polytherapie d'inhibiteurs hedgehog, de rayonnement et d'agents chimiotherapeutiques
TW200948380A (en) 2008-04-11 2009-12-01 Galaxy Biotech Llc Combination of HGF inhibitor and PTEN agonist to treat cancer
US7801270B2 (en) 2008-06-19 2010-09-21 Varian Medical Systems International Ag Treatment plan optimization method for radiation therapy
US8600003B2 (en) * 2009-01-16 2013-12-03 The University Of North Carolina At Chapel Hill Compact microbeam radiation therapy systems and methods for cancer treatment and research
US9636525B1 (en) * 2011-02-15 2017-05-02 Velayudhan Sahadevan Method of image guided intraoperative simultaneous several ports microbeam radiation therapy with microfocus X-ray tubes
US20130274233A1 (en) * 2012-04-03 2013-10-17 President And Fellow Of Harvard College Modulators of hedgehog signaling pathway
WO2014144804A1 (fr) * 2013-03-15 2014-09-18 Varian Medical Systems, Inc. Biomarqueurs pour une radiothérapie
EP3384959B1 (fr) * 2013-06-18 2019-11-06 Duke University Systèmes et procédés pour spécifier des critères de traitement et paramètres de traitement pour planification de radiothérapie spécifique à un patient
US20150011817A1 (en) * 2013-07-03 2015-01-08 Yuxin Feng System and Method for Delivering an Ultra-High Dose of Radiation Therapy
US10080911B2 (en) * 2015-09-10 2018-09-25 Varian Medical Systems, Inc. Knowledge-based spatial dose metrics and methods to generate beam orientations in radiotherapy
WO2019018813A1 (fr) * 2017-07-21 2019-01-24 Varian Medical Systems, Inc. Procédés d'utilisation de rayonnement à débit de dose ultra élevé et d'agents thérapeutiques

Also Published As

Publication number Publication date
WO2020018904A1 (fr) 2020-01-23
CN112449602A (zh) 2021-03-05
WO2020018904A9 (fr) 2020-04-16

Similar Documents

Publication Publication Date Title
US11771920B2 (en) Methods of use of ultra-high dose rate radiation and therapeutic agent
EP3823618A1 (fr) Méthodes d'utilisation de rayonnement à débit de dose ultra élevé et d'agents thérapeutiques
JP7343565B2 (ja) 正規化バイオマーカースコアからがん治療を特定するためのシステム及び方法
EP3471752B1 (fr) Modulateurs immunitaires en combinaison avec un traitement par rayonnement
Vilgelm et al. Chemokines modulate immune surveillance in tumorigenesis, metastasis, and response to immunotherapy
Herter-Sprie et al. Synergy of radiotherapy and PD-1 blockade in Kras-mutant lung cancer
US10844437B2 (en) Biomarkers for radiation treatment
US20200108066A1 (en) Methods for modulating regulatory t cells and immune responses using cdk4/6 inhibitors
Yhim et al. Combination treatment of copanlisib and gemcitabine in relapsed/refractory PTCL (COSMOS): An open-label phase I/II trial
Farrell et al. Targeting the fatty acid binding proteins disrupts multiple myeloma cell cycle progression and MYC signaling
Laurent et al. In-vivo and in-vitro impact of high-dose rate radiotherapy using flattening-filter-free beams on the anti-tumor immune response
Farren et al. Immunologic alterations in the pancreatic cancer microenvironment of patients treated with neoadjuvant chemo-and radiotherapy
El-Sayes IMPROVING OUTCOMES FOR CANCER IMMUNOTHERAPY
Connor et al. EXTH-64. ESTABLISHING A CLINICALLY RELEVANT MOUSE MODEL OF MESENCHYMAL GLIOBLASTOMA FOR STUDYING TME TARGETING TREATMENTS

Legal Events

Date Code Title Description
STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: UNKNOWN

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE INTERNATIONAL PUBLICATION HAS BEEN MADE

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE INTERNATIONAL PUBLICATION HAS BEEN MADE

PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: REQUEST FOR EXAMINATION WAS MADE

17P Request for examination filed

Effective date: 20210114

AK Designated contracting states

Kind code of ref document: A1

Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO RS SE SI SK SM TR

DAV Request for validation of the european patent (deleted)
P01 Opt-out of the competence of the unified patent court (upc) registered

Effective date: 20230515