EP3298046A1 - Anti-gd3 specific chimeric antigen receptors for cancer immunotherapy - Google Patents

Anti-gd3 specific chimeric antigen receptors for cancer immunotherapy

Info

Publication number
EP3298046A1
EP3298046A1 EP16734198.1A EP16734198A EP3298046A1 EP 3298046 A1 EP3298046 A1 EP 3298046A1 EP 16734198 A EP16734198 A EP 16734198A EP 3298046 A1 EP3298046 A1 EP 3298046A1
Authority
EP
European Patent Office
Prior art keywords
seq
cells
cell
specific car
sequence
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Pending
Application number
EP16734198.1A
Other languages
German (de)
English (en)
French (fr)
Inventor
Julianne Smith
Cècile SCHIFFER-MANNIOUI
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Cellectis SA
Original Assignee
Cellectis SA
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Cellectis SA filed Critical Cellectis SA
Publication of EP3298046A1 publication Critical patent/EP3298046A1/en
Pending legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/7051T-cell receptor (TcR)-CD3 complex
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/70517CD8
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/70535Fc-receptors, e.g. CD16, CD32, CD64 (CD2314/705F)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70575NGF/TNF-superfamily, e.g. CD70, CD95L, CD153, CD154
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/3076Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells against structure-related tumour-associated moieties
    • C07K16/3084Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells against structure-related tumour-associated moieties against tumour-associated gangliosides
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/0634Cells from the blood or the immune system
    • C12N5/0636T lymphocytes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/51Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/515Animal cells
    • A61K2039/5158Antigen-pulsed cells, e.g. T-cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • C07K2317/53Hinge
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/02Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/03Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/30Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/33Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies

Definitions

  • the present invention relates to Chimeric Antigen Receptors (CAR) that are recombinant chimeric proteins able to redirect immune cell specificity and reactivity toward GD3, a ganglioside found in the central nervous system tissues and used to diagnose solid tumors such as melanomas, neuroectodermal tumors and carcinomas and also liquid tumor such as acute lymphoblastic leukemia (ALL) in patients.
  • CARs according to the invention are particularly useful to treat malignant cells bearing GD3 antigen, when expressed in immune cells, such as T-cells or NK cells.
  • the resulting engineered immune cells display high level of specificity toward malignant GD3 positive cells, conferring safety and efficiency for immunotherapy.
  • Adoptive immunotherapy which involves the transfer of autologous antigen-specific T cells generated ex vivo, is a promising strategy to treat viral infections and cancer.
  • the T cells used for adoptive immunotherapy can be generated either by expansion of antigen-specific T cells or redirection of T cells through genetic engineering (Park, Rosenberg et al. 2011). Transfer of viral antigen specific T cells is a well-established procedure used for the treatment of transplant associated viral infections and rare viral-related malignancies. Similarly, isolation and transfer of tumor specific T cells has been shown to be successful in treating melanoma.
  • CARs transgenic T cell receptors or chimeric antigen receptors
  • CARs are synthetic receptors consisting of a targeting moiety that is associated with one or more signaling domains in a single fusion molecule.
  • the binding moiety of a CAR consists of an antigen- binding domain of a single-chain antibody (scFv), comprising the light and variable fragments of a monoclonal antibody joined by a flexible linker. Binding moieties based on receptor or ligand domains have also been used successfully.
  • the signaling domains for first generation CARs are derived from the cytoplasmic region of the CD3zeta or the Fc receptor gamma chains.
  • First generation CARs have been shown to successfully redirect T-cell cytotoxicity. However, they failed to provide prolonged expansion and anti-tumor activity in vivo.
  • Signaling domains from co-stimulatory molecules, as well as transmembrane and hinge domains have been added to form CA s of second and third generations, leading to some successful therapeutic trials in humans, where T-cells could be redirected against malignant cells expressing CD19 (June et al., 2011).
  • the particular combination of signaling domains, transmembrane and co-stimulatory domains used with respect to CD19 ScFv was rather antigen-specific and cannot be expanded to any antigen markers.
  • the disialoganglioside GD3 is an acid glycosphingolipid depicted in Figure 1 which has been shown to be strongly expressed in melanoma cell lines, adult and fetal brain and to a lesser extent in adult and fetal lung (Haraguchi et al, 1994; Nakayama et al. 1996).
  • Gangliosides are a family composed of a common hydrophobic ceramide moiety and a hydrophilic oligosaccharide chain containing one or several sialic acids.
  • Ceramide therefore a source of GD3, is converted into GD3 by diverse glycosyltransferases and in particular by the GD3 synthase (alpha 2,8-sialyltransferase or ST8Sia I or SATII).
  • GD3 ganglioside also named alpha-N-acetylneuraminide alpha-2,8-sialyltransferase (ref: Uniprot: Q92185 ;SIA8A human) , an enzyme that is encoded in humans by the ST8SIA1 gene (RefSeq: NP_003025.1. NM_003034.3).
  • GD3 is highly expressed at early development stages of the central nervous system, when neural cells proliferate actively. At later developmental stages, the GD3 content declines and others gangliosides become major species (Daniotti et al., 1997; Gravotta et al., 1989). In addition, the expression level of gangliosides in general, and GD3 in particular, is very low and restricted in adult extra neural tissues. Nevertheless, GD3 is highly expressed in tumor cells, accounting for more than 80% of melanomas. It is also overexpressed in neuroectodermal tumors (neuroblastoma and glioma) and carcinomas, including lung, breast, colon, prostate and ovary (Lo et al., 2010). In addition, GD3 expression was observed in T cell acute lymphoblastic leukemia (Reaman et al., 1990).
  • GD3 could be a valuable target antigen by using CAR-expressing T cells for treating liquid tumors, such as T cell acute lymphoblastic leukemia and solid tumors, such as melanomas, neuroectodermal tumors (neuroblastoma and glioma) and carcinomas, including lung, breast, colon, prostate and ovary.
  • liquid tumors such as T cell acute lymphoblastic leukemia and solid tumors, such as melanomas, neuroectodermal tumors (neuroblastoma and glioma) and carcinomas, including lung, breast, colon, prostate and ovary.
  • the present invention provides with new GD3 specific CAR constructs, which can be expressed in immune cells to target GD3 malignant cells with significant clinical advantage.
  • CAR polypeptides of the invention comprise an amino acid sequence selected from SEQ ID NO.19 to 30 (having scFv from R24, MB3.6, KM641 or BW2121; and with a conformation of vl to v3) preferably SEQ ID NO. 30 (BW2121-V3), SEQ ID NO. 20 (R24-v2) and SEQ ID NO. 21 (R24-v3) and more preferably SEQ ID NO. 20 (R24-v2).
  • SEQ ID NO.19 to 30 having scFv from R24, MB3.6, KM641 or BW2121; and with a conformation of vl to v3 preferably SEQ ID NO. 30 (BW2121-V3), SEQ ID NO. 20 (R24-v2) and SEQ ID NO. 21 (R24-v3) and more preferably SEQ ID NO. 20 (R24-v2).
  • T-cells from donors have been transformed with polynucleotides expressing these CARs using viral transduction.
  • the T-cells were further engineered to create non- alloreactive T-cells, more especially by disruption of a component of TCR ( ⁇ - T-Cell receptors) to prevent Graft versus host reaction.
  • the resulting engineered T-cells displayed reactivity in-vitro against GD3 positive cells to various extend, showing that the CARs of the present invention contribute to antigen dependent activation, and also proliferation, of the T-cells, making them useful for immunotherapy.
  • polypeptides and polynucleotide sequences encoding the CARs of the present invention are detailed in the present specification.
  • the engineered immune cells of the present invention are particularly useful for therapeutic applications, such as for treating solid tumors such as melanomas, neuroblastoma, glioma or breast, colon, lung, prostate or ovary tumors, and liquid tumors such as T-cell acute lymphoblastic leukemia. Description of the figures
  • Figure 1 Structure of the GD3 ganglioside which is composed of two sialic acids linked to a lactosylceramide core common to many gangliosides.
  • Figure 2 Analysis by flow cytometry using the Qifikit (Dako) to identify cells expressing GD3 surface molecules: 7 different human cell lines were tested and amongst them 4 (CHP-134, G-361, MeWo and SK-MEL-28) had previously been described in the literature to be positive for GD3.
  • FIG. 3 Schematic representation of an engineered immune cell according to the invention.
  • the engineered immune cell presented in this figure is a T-cell transduced with a retroviral polypeptide encoding CAR.
  • This T-cell is further engineered to allow a better and safer engraftment into the patient, which is optional within the frame of the present invention.
  • X gene may be for instance a gene expressing a component of TCR (TCRalpha or TCRbeta)
  • Y may be a gene involved into the sensitivity of T-cells to immune-suppressive drugs like CD52 (with respect to Campath) or chemotherapy drugs like HPRT (with respect to 6-Thioguanine).
  • FIG 4 Schematic representation of the different CAR Architecture (VI to V3). In these experiments were designed twelve 2nd generation anti-GD3 specific scCARs resulting from the fusion of the following building blocks: -one scFv from murine (MB3.6 or KM641 or BW2121 or R24) origin;- one spacer (human FcvRllla hinge or human CD8ahinge or human IgGl hinge CH2 CH3);-the transmembrane domain of human CD8a;-the costimulatory domain of human 41BB and -the activation domain of human CD3 ⁇ .
  • Figure 5 Two-step screening method used to test the anti-GD3 scCARs designed in human primay T cells.
  • Figure 6 During primary screening, analysis of total expression of 12 scCARs in human T cells by western blot using an anti-human CD3 zeta mAb.
  • A Experiment 1.
  • B Experiment 2.
  • Figure 7 During primary screening, analysis of total expression of 12 scCARs in human T cells by western blot using anti-Fab or protein L (A) first series. (B) second series.
  • Figure 8 During primary screening, analysis of degranulation of 12 scCAR modified T cells upon co-culture with target cells.
  • A first series.
  • B second series.
  • Figure 9 During secondary screening, analysis of degranulation of scCAR modified T cells upon co-culture with target cells. Data are presented as mean+/- SD of four independent experiments.
  • Figure 10 During secondary screening, analysis of IFNy production by scCAR-modified T cells upon co-culture with target cells. Data are presented as mean+/- SD of four independent experiments.
  • Figure 11 During secondary screening, analysis of cytotoxic activity of scCAR-modified T cells upon co-culture with adherent target cells. Data are presented as mean+/- SD of three independent experiments.
  • Figure 12 Bicistronic lentiviral vector encoding under the transcriptional control of the
  • Spleen Focus Forming Virus promoter the R24-v2 CAR and the suicide gene (RQR8) separated by a 2A peptide.
  • FIG. 13 Transduction of CD3/CD28-stimulated peripheral blood mononuclear cells (PBMCs) with a lentiviral vector encoding under the transcriptional control of the Spleen Focus Forming Virus promoter (SFFV) the R24-v2 CAR and the suicide gene (RQR8) separated by a 2A peptide.
  • SFFV Spleen Focus Forming Virus promoter
  • Figure 14 Secretion of interferon ⁇ (IFN- ⁇ ) by lentiviral transduced GD3 CAR T cells or non- transduced T cells in the presence of GD3+ cells (G361), GD- cells (MCF-7) or non-tumor cells.
  • IFN- ⁇ interferon ⁇
  • Figure 15 Expression of CD107a at the cell surface of lentiviral transduced GD3 CAR T cells or non-transduced T cells in the presence of GD3+ cells (G361), GD- cells (MCF-7) or non-tumor cells.
  • Figure 16 Lytic activity of lentiviral transduced GD3 CAR T-cells or non-transduced T cells towards GD3+ cells (G361).
  • Figure 17 Humanization strategy for R24 VH (SEQ ID NO.ll) of anti-GD3 CAR based on R24 ScFv based respectively on closest mouse germline IGHV5-17*02 and closest human germline gene IGHV3-NL1*01.
  • Figure 18 Individual amino acid residues substitutions with respect to SEQ ID NO.ll concerned by R24 VH humanization.
  • Figure 19 Humanization strategy for 24 VL (SEQ ID N0.12) of anti-GD3 CAR based on R24 ScFv based respectively on closest mouse germline IGKV10-96*01 and closest human germline gene IGKV1-33*01.
  • Figure 20 Individual amino acid residues substitutions with respect to SEQ ID NO.11 concerned by R24 VH humanization.
  • the present invention relates to new designs of anti-GD3 chimeric antigen receptor (CAR) comprising an extracellular ligand-binding domain, a transmembrane domain and a signaling transducing domain.
  • CAR chimeric antigen receptor
  • extracellular ligand-binding domain is defined as an oligo- or polypeptide that is capable of binding a ligand.
  • the domain will be capable of interacting with a cell surface molecule.
  • the extracellular ligand-binding domain may be chosen to recognize a ligand that acts as a cell surface marker on target cells associated with a particular disease state.
  • the antigen binding domain of the anti-GD3 CARs of the invention can be any domain that binds to the off-tissue antigen including but not limited to a monoclonal antibody, a recombinant antibody, a human antibody, a humanized antibody, and a functional fragment thereof.
  • said extracellular ligand-binding domain comprises a single chain antibody fragment (scFv) comprising the light (V L ) and the heavy (V H ) variable fragment of a target antigen specific monoclonal anti GD3 antibody joined by a flexible linker.
  • scFv single chain antibody fragment
  • V L and V H are preferably selected from the antibodies referred to as R24, M B3.6, KM641 and BW2121 as indicated in Table 4. They are preferably linked together by a flexible linker comprising for instance the sequence SEQ I D NO:10.
  • said CARs preferentially comprise an extracellular ligand- binding domain comprising a polypeptide sequence displaying at least 90 %, 95 % 97 % or 99 % identity with an amino acid sequence selected from the group consisting of SEQ I D NO: 11 to SEQ I D NO: 18.
  • recombinant antibody as used herein, is meant an antibody or antibody fragment which is generated using recombinant DNA technology, such as, for example, an antibody or antibody fragment expressed by a bacteriophage, a yeast expression system or a mammalian cell expression system, and more especially by a T cell transduced with a viral vector comprising a nucleic acid sequence encoding CDR regions of an antibody.
  • the term should also be construed to mean an antibody or antibody fragment which has been generated by the synthesis of a DNA molecule encoding the antibody or antibody fragment and which DNA molecule expresses an antibody or antibody fragment protein, or an amino acid sequence specifying the antibody or antibody fragment, wherein the DNA or amino acid sequence has been obtained using recombinant or synthetic DNA or amino acid sequence technology which is available and well known in the art.
  • a humanized antibody can be produced using a variety of techniques known in the art, including but not limited to, CDR-grafting (see, e.g., European Patent No. EP 239,400; International Publication No. WO 91/09967; and U.S. Pat. Nos. 5,225,539, 5,530,101, and 5,585,089, each of which is incorporated herein in its entirety by reference), veneering or resurfacing (see, e.g., European Patent Nos.
  • framework substitutions are identified by methods well-known in the art, e.g., by modeling of the interactions of the CDR and framework residues to identify framework residues important for antigen binding and sequence comparison to identify unusual framework residues at particular positions. (See, e.g., Queen et al., U.S. Pat. No. 5,585,089; and Riechmann et al., 1988, Nature, 332:323, which are incorporated herein by reference in their entireties).
  • said anti-GD3 specific CAR of the invention comprises an extracellular ligand-binding domain wherein the VH polypeptide comprises a CDR sequence of the R24 antibody selected from SEQ ID N0.36 (CDR1), SEQ ID N0.37 (CDR2) and SEQ ID N0.38 (CDR3), and said VL polypepetide sequence comprises a CDR sequence of the R24 antibody selected from SEQ ID N0.39 (CDR1), SEQ ID NO.40 (CDR2) and SEQ ID N0.41 (CDR3).
  • the VH polypeptide comprises a CDR sequence of the R24 antibody selected from SEQ ID N0.36 (CDR1), SEQ ID N0.37 (CDR2) and SEQ ID N0.38 (CDR3)
  • said VL polypepetide sequence comprises a CDR sequence of the R24 antibody selected from SEQ ID N0.39 (CDR1), SEQ ID NO.40 (CDR2) and SEQ ID N0.41 (CDR3).
  • said anti-GD3 specific CAR of the invention comprises an extracellular ligand-binding domain
  • the VH comprises a CDR sequence from the MB3.6 antibody, for instance, one selected from SEQ ID N0.42 (CDR1), SEQ ID N0.43 (CDR2) and SEQ ID NO.44 (CDR3)
  • said VL comprises a CDR sequence of the MB3.6 antibody, for instance, one selected from SEQ ID N0.45 (CDR1), SEQ ID N0.46 (CDR2) and SEQ ID N0.47 (CDR3).
  • said anti-GD3 specific CAR of the invention comprises an extracellular ligand-binding domain
  • the VH polypeptide sequence comprises a CDR sequence from the KM641 antibody, for instance, one selected from SEQ ID N0.48 (CDR1), SEQ ID N0.49 (CDR2) and SEQ ID NO.50 (CDR3)
  • said VL polypeptide sequence comprises a CDR sequence from the KM641 antibody, for instance, one selected from SEQ ID N0.51 (CDR1), SEQ ID N0.52 (CDR2) and SEQ ID N0.53 (CDR3).
  • said anti-GD3 specific CAR of the invention comprises an extracellular ligand-binding domain
  • the VH polypeptide sequence comprises a CDR sequence from BW2121, for instance, one selected from SEQ ID N0.54 (CDR1), SEQ ID N0.55 (CDR2) and SEQ ID NO.56 (CDR3)
  • said VL polypeptide sequence comprises a CDR sequence from BW2121 antibody , for instance, one selected from SEQ ID N0.57 (CDR1), SEQ ID N0.58 (CDR2) and SEQ ID N0.59 (CDR3).
  • the invention provides humanizing the foreign framework regions (FRs) of the heavy and light chain variable domains of the anti-R24 ScFvs of SEQ ID NO. 11 and SEQ ID NO.12 by changing the murine framework surface residues that are not observed in human immunoglobulins. These residues are typically mutated into those observed in the most resembling human counterpart.
  • This technique of resurfacing an antibody which was first described by Padlan (A possible procedure for reducing the immunogenicity of antibody variable domains while preserving their ligand-binding properties, 1991, Molecular Immunology, 28 (4-5): 489-4981991). Such an approach is shown in Figures 17 and 19, with the human counterparts IGHV3-NL1*01 and IGKV1-33*01.
  • amino acid mutations preferably substitutions, can be introduced into SEQ I D NO.11 and SEQ ID NO.12 at any of the following positions of the CAR GD3 according to the present invention in view of reducing the immunogenicity to humans: - SEQ ID NO.ll (R24 - VH): L12, R19, K20, N36, F37, E47, A54, Y55, S57, 165, N66, T70, P83,
  • the present invention thus covers humanized functional variants of CAR GD3, wherein said CAR comprises a polypeptide sequence binding a GD3 antigen that can display up to 18 % and 24 % variability in its amino acid composition with respect to SEQ ID NO.11 and SEQ ID NO.12 respectively.
  • the amino acid sequence of the ScFv that comprises R24 VH and VL under humanized form generally display an overall amino acid identity higher than 80%, and more generally, the anti-GD3 specific CAR of the invention comprises an extracellular ligand-binding domain that comprises a polypeptide that shares at least 85 % identity with SEQ ID NO.ll and/or SEQ ID N0.12.
  • Preferred amino acid substitutions into R24 VH and/or VL resulting form the humanization approach displayed in figures 17 and 19 are as follows (first letter correspond to the wild type murine sequence, last letter is proposed for substitution):
  • - SEQ ID NO.ll (R24 - VH): L12V, R19L, K20R, N36S, F37Y, E47G, A54S, Y55V, S57Y, I65T, N66Y, T70S, P83S, F88Y, T92N, S96A, 1101V, T105A, R106K, A122T, T123L, L124V and I125T.
  • SEQ ID NO.12 R24 - VL: I7S, T8P, V13A, L15V, I20T, S22T, R24Q, G36S, F38Y, D47G, G48K,
  • the present invention encompasses any GD3 CAR, in particular such humanized functional variants of CAR GD3, comprising an amino acid sequence having identity to SEQ ID NO.ll and/or SEQ ID NO.12 including at least one of the above mutated or substituted residues.
  • - SEQ ID NO.11 (R24 - VH): Dl, A54, Y55, N64, P83, and/or F88, and more critically, A54, Y55 and/or N64;
  • - SEQ ID NO.12 (R24 - VL): 71, 8T, 24R, 66R, 68Q, 79W, Y85, S86, L87, F101 and/or F102, and more critically, 66R, Y85 and/or F102.
  • the present invention encompasses any GD3 CAR, in particular humanized functional variants of CAR GD3 as previously described, comprising an amino acid sequence having identity to SEQ ID NO.ll and/or SEQ ID N0.12, preferably at least 80% sequence identity, wherein the above aminoacids have been maintained (i.e. not mutated).
  • Conservative amino acid substitutions are ones in which the amino acid residue is replaced with an amino acid residue having a similar side chain.
  • Families of amino acid residues having similar side chains have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine, tryptophan), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
  • the signal transducing domain or intracellular signaling domain of a CAR is responsible for intracellular signaling following the binding of extracellular ligand binding domain to the target resulting in the activation of the immune cell and immune response.
  • the signal transducing domain is responsible for the activation of at least one of the normal effector functions of the immune cell in which the CAR is expressed.
  • the effector function of a T cell can be a cytolytic activity or helper activity including the secretion of cytokines.
  • the term "signal transducing domain” refers to the portion of a protein which transduces the effector signal function signal and directs the cell to perform a specialized function.
  • Preferred examples of signal transducing domain for use in a CAR can be the cytoplasmic sequences of the T cell receptor and co-receptors that act in concert to initiate signal transduction following antigen receptor engagement, as well as any derivate or variant of these sequences and any synthetic sequence that has the same functional capability.
  • Signal transduction domain comprises two distinct classes of cytoplasmic signaling sequence, those that initiate antigen- dependent primary activation, and those that act in an antigen-independent manner to provide a secondary or co-stimulatory signal.
  • Primary cytoplasmic signaling sequence can comprise signaling motifs which are known as immunoreceptor tyrosine-based activation motifs of ITAMs.
  • ITAMs are well defined signaling motifs found in the intracytoplasmic tail of a variety of receptors that serve as binding sites for syk/zap70 class tyrosine kinases.
  • Examples of ITAM used in the invention can include as non-limiting examples those derived from TCRzeta, FcRgamma, FcRbeta, FcRepsilon, CD3gamma, CD3delta, CD3epsilon, CD5, CD22, CD79a, CD79b and CD66d.
  • the signaling transducing domain of the CAR can comprise the CD3zeta signaling domain which has amino acid sequence with at least 70%, preferably at least 80%, more preferably at least 90 %, 95 % 97 % or 99 % sequence identity with amino acid sequence selected from the group consisting of (SEQ ID NO: 9).
  • the signal transduction domain of the CAR of the present invention comprises a co-stimulatory signal molecule.
  • a co-stimulatory molecule is a cell surface molecule other than an antigen receptor or their ligands that is required for an efficient immune response.
  • Co-stimulatory ligand refers to a molecule on an antigen presenting cell that specifically binds a cognate co-stimulatory molecule on a T-cell, thereby providing a signal which, in addition to the primary signal provided by, for instance, binding of a TCR/CD3 complex with an MHC molecule loaded with peptide, mediates a T cell response, including, but not limited to, proliferation activation, differentiation and the like.
  • a co-stimulatory ligand can include but is not limited to CD7, B7-1 (CD80), B7-2 (CD86), PD-L1, PD-L2, 4-1BBL, OX40L, inducible costimulatory ligand (ICOS-L), intercellular adhesion molecule (ICAM, CD30L, CD40, CD70, CD83, HLA-G, MICA, M1CB, HVEM, lymphotoxin beta receptor, 3/TR6, ILT3, ILT4, an agonist or antibody that binds Toll ligand receptor and a ligand that specifically binds with B7-H3.
  • a co-stimulatory ligand also encompasses, inter alia, an antibody that specifically binds with a co-stimulatory molecule present on a T cell, such as but not limited to, CD27, CD28, 4-1BB, OX40, CD30, CD40, PD-1, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LTGHT, NKG2C, B7-H3, a ligand that specifically binds with CD83.
  • an antibody that specifically binds with a co-stimulatory molecule present on a T cell such as but not limited to, CD27, CD28, 4-1BB, OX40, CD30, CD40, PD-1, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LTGHT, NKG2C, B7-H3, a ligand that specifically binds with CD83.
  • LFA-1 lymphocyte function-associated antigen-1
  • a "co-stimulatory molecule” refers to the cognate binding partner on a T-cell that specifically binds with a co-stimulatory ligand, thereby mediating a co-stimulatory response by the cell, such as, but not limited to proliferation.
  • Co-stimulatory molecules include, but are not limited to, an MHC class I molecule, BTLA and Toll ligand receptor.
  • costimulatory molecules include CD27, CD28, CD8, 4-1BB (CD137), OX40, CD30, CD40, PD-1, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, B7-H3 and a ligand that specifically binds with CD83 and the like.
  • the signal transduction domain of the CAR of the present invention comprises a part of co-stimulatory signal molecule selected from the group consisting of fragment of 4-1BB (GenBank: AAA53133.) and CD28 (NP_006130.1).
  • the signal transduction domain of the CAR of the present invention comprises amino acid sequence which comprises at least 70%, preferably at least 80%, more preferably at least 90 %, 95 % 97 % or 99 % sequence identity with amino acid sequence selected from the group consisting of SEQ ID NO: 8.
  • a CAR according to the present invention is expressed on the surface membrane of the cell.
  • Such CAR further comprises a transmembrane domain.
  • the distinguishing features of appropriate transmembrane domains comprise the ability to be expressed at the surface of a cell, preferably in the present invention an immune cell, in particular lymphocyte cells or Natural killer (NK) cells, and to interact together for directing cellular response of immune cell against a predefined target cell.
  • the transmembrane domain can be derived either from a natural or from a synthetic source.
  • the transmembrane domain can be derived from any membrane-bound or transmembrane protein.
  • the transmembrane polypeptide can be a subunit of the T-cell receptor such as ⁇ , ⁇ , ⁇ or ⁇ , polypeptide constituting CD3 complex, IL2 receptor p55 (a chain), p75 ( ⁇ chain) or ⁇ chain, subunit chain of Fc receptors, in particular Fey receptor III or CD proteins.
  • the transmembrane domain can be synthetic and can comprise predominantly hydrophobic residues such as leucine and valine.
  • said transmembrane domain is derived from the human CD8 alpha chain (e.g. NP_001139345.1)
  • the transmembrane domain can further comprise a hinge region between said extracellular ligand-binding domain and said transmembrane domain.
  • hinge region generally means any oligo- or polypeptide that functions to link the transmembrane domain to the extracellular ligand-binding domain.
  • hinge region are used to provide more flexibility and accessibility for the extracellular ligand-binding domain.
  • a hinge region may comprise up to 300 amino acids, preferably 10 to 100 amino acids and most preferably 25 to 50 amino acids.
  • Hinge region may be derived from all or part of naturally occurring molecules, such as from all or part of the extracellular region of CD8, CD4 or CD28, or from all or part of an antibody constant region.
  • the hinge region may be a synthetic sequence that corresponds to a naturally occurring hinge sequence, or may be an entirely synthetic hinge sequence.
  • said hinge domain comprises a part of human CD8 alpha chain, FcyRllla receptor or IgGl respectively referred to in this specification as SEQ ID NO. 3, SEQ ID NO. 4 and SEQ ID NO.5, or hinge polypeptides which display preferably at least 80%, more preferably at least 90 %, 95 % 97 % or 99 % sequence identity with these polypeptides.
  • a CAR according to the invention generally further comprises a transmembrane domain (TM) preferably selected from CD8a and 4-1BB, showing identity with the polypeptides of SEQ ID NO. 6 or 7, and more preferably with SEQ ID NO.6 (CD8a TM).
  • TM transmembrane domain
  • the anti-GD3 specific CAR can comprise another extracellular ligand-binding domains, to simultaneously bind different elements in target thereby augmenting immune cell activation and function.
  • the extracellular ligand- binding domains can be placed in tandem on the same transmembrane polypeptide, and optionally can be separated by a linker.
  • said different extracellular ligand-binding domains can be placed on different transmembrane polypeptides composing the CAR.
  • the present invention relates to a population of CARs comprising each one different extracellular ligand binding domains.
  • the present invention relates to a method of engineering immune cells comprising providing an immune cell and expressing at the surface of said cell a population of CAR each one comprising different extracellular ligand binding domains.
  • the present invention relates to a method of engineering an immune cell comprising providing an immune cell and introducing into said cell polynucleotides encoding polypeptides composing a population of CAR each one comprising different extracellular ligand binding domains.
  • population of CARs it is meant at least two, three, four, five, six or more CARs each one comprising different extracellular ligand binding domains.
  • the different extracellular ligand binding domains according to the present invention can preferably simultaneously bind different elements in target thereby augmenting immune cell activation and function.
  • the present invention also relates to an isolated immune cell which comprises a population of CARs each one comprising different extracellular ligand binding domains.
  • the present invention also relates to polynucleotides, vectors encoding the above described CAR according to the invention.
  • the polynucleotide may consist in an expression cassette or expression vector (e.g. a plasmid for introduction into a bacterial host cell, or a viral vector such as a baculovirus vector for transfection of an insect host cell, or a plasmid or viral vector such as a lentivirus for transfection of a mammalian host cell).
  • an expression cassette or expression vector e.g. a plasmid for introduction into a bacterial host cell, or a viral vector such as a baculovirus vector for transfection of an insect host cell, or a plasmid or viral vector such as a lentivirus for transfection of a mammalian host cell.
  • the different nucleic acid sequences can be included in one polynucleotide or vector which comprises a nucleic acid sequence encoding ribosomal skip sequence such as a sequence encoding a 2A peptide.
  • 2A peptides which were identified in the Aphthovirus subgroup of picornaviruses, causes a ribosomal "skip" from one codon to the next without the formation of a peptide bond between the two amino acids encoded by the codons (see (Donnelly and Elliott 2001; Atkins, Wills et al. 2007; Doronina, Wu et al. 2008)).
  • cognate is meant three nucleotides on an mRNA (or on the sense strand of a DNA molecule) that are translated by a ribosome into one amino acid residue.
  • two polypeptides can be synthesized from a single, contiguous open reading frame within an mRNA when the polypeptides are separated by a 2A oligopeptide sequence that is in frame.
  • Such ribosomal skip mechanisms are well known in the art and are known to be used by several vectors for the expression of several proteins encoded by a single messenger RNA.
  • a secretory signal sequence (also known as a leader sequence, prepro sequence or pre sequence) is provided in polynucleotide sequence or vector sequence.
  • the secretory signal sequence is operably linked to the transmembrane nucleic acid sequence, i.e., the two sequences are joined in the correct reading frame and positioned to direct the newly synthesized polypeptide into the secretory pathway of the host cell.
  • Secretory signal sequences are commonly positioned 5' to the nucleic acid sequence encoding the polypeptide of interest, although certain secretory signal sequences may be positioned elsewhere in the nucleic acid sequence of interest (see, e.g., Welch et al., U.S. Patent No. 5,037,743; Holland et al., U.S. Patent No. 5,143,830).
  • the signal peptide comprises the amino acid sequence SEQ ID NO: 1 and 2.
  • the nucleic acid sequences of the present invention are codon-optimized for expression in mammalian cells, preferably for expression in human cells.
  • Codon-optimization refers to the exchange in a sequence of interest of codons that are generally rare in highly expressed genes of a given species by codons that are generally frequent in highly expressed genes of such species, such codons encoding the amino acids as the codons that are being exchanged.
  • the present invention provides inter alia an expression vector in the form of a lentiviral vector comprising a polynucleotide sequence encoding a CAR according to the present invention.
  • the letiviral vector may comprise a polynucleotide sequence encoding a CAR according to the present invention operably linked to a promoter (such as the Spleen Focus Forming Virus promoter (SFFV)).
  • a promoter such as the Spleen Focus Forming Virus promoter (SFFV)
  • SFFV Spleen Focus Forming Virus promoter
  • operably linked it is meant a juxtaposition wherein the components described are in a relationship permitting them to function in their intended manner.
  • a gene (such as a CAR encoding polynucleotide sequence) is "operably linked" to a promoter when its transcription is under the control of said promoter and this transcription results in the production of the product encoded by said gene.
  • the lentiviral vector of the present invention typically contains regulatory elements such as 5' and 3' long terminal repeat (LTR) sequences, but may also contain other structural and functional genetic elements that are primarily derived from a lentivirus. Such structural and functional genetic elements are well known in the art.
  • the lentiviral vector may, for example, contain the genes gag, pol and env. Preferably, however, the lentiviral vector of the presention invention does not contain the genes gag, pol and env.
  • the lentiviral vecor may included one or more (such as two or more) of a packaging singal (such as the packaging signal ⁇ ), a primer binding site, a trans-activation-responsive region (TAR) and a rev-responive element (RRE).
  • a packaging singal such as the packaging signal ⁇
  • TAR trans-activation-responsive region
  • RRE rev-responive element
  • the 5' and 3' long terminal repeat (LTR) sequences typically flanking the lentiviral genome have promoter/enhancer activity and are essential for the correct expression of the full-length lentiviral vector transcript.
  • the LTRs usually include the repetitive sequence U3RU5 present at both the 5'- and 3' ends of a double-stranded DNA molecule, which is a combination of 5' R-U5 segment and the 3' U3-R segment of the single-stranded RNA, wherein repetition R occurs at both termini of the RNA, while U5 (unique sequence 5) only occurs at the 5' end of the RNA and U3 (unique sequence 3) only occurs at the 3' end of the RNA.
  • lentiviral vectors have been improved in their safety by removal of the U3 sequence, resulting in "self-inactivating" vectors that are entirely devoid of viral promoter and enhancer sequences originally present within the LTRs.
  • the 3' LTR enhancer- promoter sequence i.e. U3 sequence
  • the lentiviral vector is a self-inactivating (SIN) lentiviral vector.
  • the lentiviral vector contains a 3' LTR in which the 3' LTR enhancer-promoter sequence (i.e. U3 sequence) has been modified (e.g., deleted).
  • the lentiviral vector comprises a polynucleotide sequence which comprises the following elements in a 5' to 3' order:
  • (B) a promoter (such as the SFFV promoter);
  • the lentiviral vector comprises a polynucleotide sequence which comprises the following elements in a 5' to 3' order:
  • a promoter such as the SFFV promoter
  • the suicide gene of item (c) , the 2A peptide encoding polynucleotide sequence of item (d) and the CAR encoding sequence of item (e) form a single transcription unit operably linked to the promoter of item (b) and are all transcribed under the control of said promoter.
  • suicide gene refers to a gene that expresses a product that is fatal to the cell expressing the suicide gene. Activation of the suicide gene causes the cell to kill itself through apoptosis.
  • An example of a suicide gene produce is RQR8 (described e.g., in WO 2013/153391 Al).
  • RQR8 has the general formula St-Rl-Sl-Q-S2-R2 in which St is a stalk sequence, Rl and R2 are rituximab-binding epitopes; and Q is a QBEndlO-binding epitope.
  • SI and S2 are optional spacer sequences, such S-(G)n-S where S is serine, G is Glycine and n is a number between 2 and 8.
  • a representative polypeptide sequence of Q 8 is set forth in SEQ ID NO: 60.
  • the 2A peptide is selected from the group consisting of F2A, E2A, T2A and P2A.
  • Suitable promoters for driving expression of a CAR according to the present invention from a lentiviral vector in immune cells are well know and include the SFFV promoter, the human ubiquitin c (UbC) promoter , MHC class I promoter, MHC class II promoter and ⁇ 2 microglobulin promoter.
  • the promoter is the SFFV promoter.
  • the lentiviral vector is in the form of a lentiviral vector particle, such as an RNA molecule(s) within a complex of lentiviral and other proteins.
  • lentiviral particle vectors comprise a genome which is composed of two copies of single-stranded RNA.
  • RNA sequences can be obtained by transcription from a double-stranded DNA sequence inserted into a host cell genome (proviral vector DNA) or can be obtained from the transient expression of plasmid DNA (plasmid vector DNA) in a transduced host cell.
  • the lentiviral vector particles have the capacity for integration. As such, they contain a functional integrase protein.
  • Non-integrating vector particles have one or more mutations that eliminate most or all of the integrating capacity of the lentiviral vector particles.
  • a non-integrating vector particle can contain mutation(s) in the integrase encoded by the lentiviral pol gene that cause a reduction in integrating capacity.
  • an integrating vector particle comprises a functional integrase protein that does not contain any mutations that eliminate most or all of the integrating capacity of the lentiviral vector particles.
  • the lentiviral vector is in the form of a recombinant DNA molecule, such as a plasmid.
  • the lentiviral vector is based on a human immunodeficiency virus (e.g., HIV-1 or
  • HIV-2 most preferably HIV-1.
  • the present invention encompasses the method of preparing immune cells for immunotherapy comprising introducing ex-vivo into said immune cells the polynucleotides or vectors encoding one of the anti-GD3 CAR as previously described.
  • said polynucleotides are included in lentiviral vectors in view of being stably expressed in the immune cells.
  • the method comprises introducing ex-vivo into said immune cells a lentiviral vector as described above.
  • the lentiviral vector introduced into said immune cells may, for example, comprise a polynucleotide sequence which comprises the following elements in a 5' to 3' order:
  • a promoter such as the SFFV promoter
  • said method further comprises the step of genetically modifying said cell to make them more suitable for allogeneic transplantation.
  • the immune cell can be made allogeneic, for instance, by inactivating at least one gene expressing one or more component of T-cell receptor (TCR) as described in WO 2013/176915, which can be combined with the inactivation of a gene encoding or regulating HLA or ⁇ 2 ⁇ protein expression.
  • TCR T-cell receptor
  • a representation of such TCR disrupted immune cell endowing a chimeric antigen receptor (CAR) is shown in Figure 3. Accordingly the risk of graft versus host syndrome and graft rejection is significantly reduced.
  • the immune cells can be further genetically engineered to improve their resistance to immunosuppressive drugs or chemotherapy treatments, which are used as standard care for treating GD3 positive malignant cells.
  • immunosuppressive drugs or chemotherapy treatments which are used as standard care for treating GD3 positive malignant cells.
  • CD52 and glucocorticoid receptors (GR) which are drug targets of Campath (alemtuzumab) and glucocorticoids treatments, can be inactivated to make the cells resistant to these treatments and give them a competitive advantage over patient's own T-cells not endowed with specific anti-GD3 CARs.
  • Expression of CD3 gene can also be suppressed or reduced to confer resistance to Teplizumab, which is another immune suppressive drug.
  • Expression of HPRT can also be suppressed or reduced according to the invention to confer resistance to 6- thioguanine, a cytostatic agent commonly used in chemotherapy especially for the treatment of acute lymphoblasic leukemia.
  • the immune cells can be further manipulated to make them more active or limit exhaustion, by inactivating genes encoding proteins that act as "immune checkpoints" that act as regulators of T-cells activation, such as PDCDl or CTLA-4. Examples of genes, which expression could be reduced or suppressed are indicated in Table 1.
  • Table 1 List of genes encoding immune checkpoint proteins.
  • CTLA4 PPP2CA, PPP2CB, PTPN6,
  • CTLA4 (CD152)
  • PDCDl (PD-1, CD279)
  • TNFRSF10B TNFRSF10A
  • CASP8 TNFRSF10A
  • said method of further engineering the immune cells involves introducing into said T cells polynucleotides, in particular m NAs, encoding specific rare-cutting endonuclease to selectively inactivate the genes, as those mentioned above, by DNA cleavage.
  • said rare-cutting endonucleases are TALE-nucleases or Cas9 endonuclease.
  • TAL-nucleases have so far proven higher specificity and cleavage efficiency over the other types of rare-cutting endonucleases, making them the endonucleases of choice for producing of the engineered immune cells on a large scale with a constant turn-over.
  • CAR can be introduced as transgenes encoded by one plasmid vector.
  • Said plasmid vector can also contain a selection marker which provides for identification and/or selection of cells which received said vector.
  • Polypeptides may be synthesized in situ in the cell as a result of the introduction of polynucleotides encoding said polypeptides into the cell. Alternatively, said polypeptides could be produced outside the cell and then introduced thereto.
  • Methods for introducing a polynucleotide construct into cells are known in the art and including as non-limiting examples stable transformation methods wherein the polynucleotide construct is integrated into the genome of the cell, transient transformation methods wherein the polynucleotide construct is not integrated into the genome of the cell and virus mediated methods.
  • Said polynucleotides may be introduced into a cell by for example, recombinant viral vectors (e.g.
  • retroviruses adenoviruses
  • liposome adenoviruses
  • transient transformation methods include for example microinjection, electroporation or particle bombardment.
  • Said polynucleotides may be included in vectors, more particularly plasmids or virus, in view of being expressed in cells.
  • Engineered immune cells include plasmids or virus, in view of being expressed in cells.
  • the present invention also relates to isolated cells or cell lines susceptible to be obtained by said method to engineer cells.
  • said isolated cell comprises at least one CAR as described above.
  • said isolated cell comprises a population of CARs each one comprising different extracellular ligand binding domains.
  • said isolated cell comprises exogenous polynucleotide sequence encoding CAR.
  • Genetically modified immune cells of the present invention are activated and proliferate independently of antigen binding mechanisms.
  • an isolated immune cell preferably a T-cell obtained according to any one of the methods previously described.
  • Said immune cell refers to a cell of hematopoietic origin functionally involved in the initiation and/or execution of innate and/or adaptative immune response.
  • Said immune cell according to the present invention can be derived from a stem cell.
  • the stem cells can be adult stem cells, non-human embryonic stem cells, more particularly non-human stem cells, cord blood stem cells, progenitor cells, bone marrow stem cells, induced pluripotent stem cells, totipotent stem cells or hematopoietic stem cells.
  • Representative human cells are CD34+ cells.
  • Said isolated cell can also be a dendritic cell, killer dendritic cell, a mast cell, a NK-cell, a B-cell or a T-cell selected from the group consisting of inflammatory T-lymphocytes, cytotoxic T-lymphocytes, regulatory T-lymphocytes or helper T- lymphocytes.
  • said cell can be derived from the group consisting of CD4+ T- lymphocytes and CD8+ T-lymphocytes.
  • a source of cells Prior to expansion and genetic modification of the cells of the invention, a source of cells can be obtained from a subject through a variety of non-limiting methods. Cells can be obtained from a number of non-limiting sources, including peripheral blood mononuclear cells, bone marrow, lymph node tissue, cord blood, thymus tissue, tissue from a site of infection, ascites, pleural effusion, spleen tissue, and tumors. In certain embodiments of the present invention, any number of T cell lines available and known to those skilled in the art, may be used.
  • said cell can be derived from a healthy donor, from a patient diagnosed with cancer or from a patient diagnosed with an infection.
  • said cell is part of a mixed population of cells which present different phenotypic characteristics.
  • a cell line obtained from a transformed T- cell according to the method previously described. Modified cells resistant to an immunosuppressive treatment and susceptible to be obtained by the previous method are encompassed in the scope of the present invention.
  • the present invention provides T-cells or a population of T-cells endowed with an anti-GD3 CAR as described above, that do not express functional TCR and that a reactive towards GD3 positive cells, for their allogeneic transplantation into patients.
  • the TRAC locus of SEQ ID NO.43 can be inactivated by using the pair of TALENs of SEQ ID N0.44 and 45. Activation and expansion of T cells
  • the immune cells, particularly T-cells of the present invention can be further activated and expanded generally using methods as described, for example, in U.S. Patents 6,352,694; 6,534,055; 6,905,680; 6,692,964; 5,858,358; 6,887,466; 6,905,681; 7,144,575; 7,067,318; 7,172,869; 7,232,566; 7,175,843; 5,883,223; 6,905,874; 6,797,514; 6,867,041; and U.S. Patent Application Publication No. 20060121005.
  • T cells can be expanded in vitro or in vivo.
  • the T cells of the invention are expanded by contact with an agent that stimulates a CD3 TC complex and a co-stimulatory molecule on the surface of the T cells to create an activation signal for the T-cell.
  • an agent that stimulates a CD3 TC complex and a co-stimulatory molecule on the surface of the T cells to create an activation signal for the T-cell.
  • chemicals such as calcium ionophore A23187, phorbol 12-myristate 13-acetate (PMA), or mitogenic lectins like phytohemagglutinin (PHA) can be used to create an activation signal for the T-cell.
  • T cell populations may be stimulated in vitro such as by contact with an anti-CD3 antibody, or antigen-binding fragment thereof, or an anti-CD2 antibody immobilized on a surface, or by contact with a protein kinase C activator (e.g., bryostatin) in conjunction with a calcium ionophore.
  • a protein kinase C activator e.g., bryostatin
  • a ligand that binds the accessory molecule is used for co-stimulation of an accessory molecule on the surface of the T cells.
  • a population of T cells can be contacted with an anti-CD3 antibody and an anti-CD28 antibody, under conditions appropriate for stimulating proliferation of the T cells.
  • Conditions appropriate for T cell culture include an appropriate media (e.g., Minimal Essential Media or RPMI Media 1640 or, X-vivo 5, (Lonza)) that may contain factors necessary for proliferation and viability, including serum (e.g., fetal bovine or human serum), interleukin-2 (IL-2), insulin, IFN-g , 1L-4, 1L-7, GM-CSF, -10, - 2, 1L-15, TGFp, and TNF- or any other additives for the growth of cells known to the skilled artisan.
  • Other additives for the growth of cells include, but are not limited to, surfactant, plasmanate, and reducing agents such as N-acetyl- cysteine and 2-mercaptoethanoi.
  • Media can include RPMI 1640, A1M-V, DMEM, MEM, a-MEM, F-12, X-Vivo 1, and X-Vivo 20, Optimizer, with added amino acids, sodium pyruvate, and vitamins, either serum-free or supplemented with an appropriate amount of serum (or plasma) or a defined set of hormones, and/or an amount of cytokine(s) sufficient for the growth and expansion of T cells.
  • Antibiotics e.g., penicillin and streptomycin, are included only in experimental cultures, not in cultures of cells that are to be infused into a subject.
  • the target cells are maintained under conditions necessary to support growth, for example, an appropriate temperature (e.g., 37° C) and atmosphere (e.g., air plus 5% C02).
  • T cells that have been exposed to varied stimulation times may exhibit different characteristics
  • said cells can be expanded by co-culturing with tissue or cells. Said cells can also be expanded in vivo, for example in the subject's blood after administrating said cell into the subject.
  • isolated cell obtained by the different methods or cell line derived from said isolated cell as previously described can be used as a medicament.
  • said medicament can be used for treating cancer, particularly for the treatment of solid tumors such as melanomas, neuroblastomas, gliomas or carcinomas such as lung, breast, colon, prostate or ovary tumors in a patient in need thereof.
  • said isolated cell according to the invention or cell line derived from said isolated cell can be used in the manufacture of a medicament for treatment of a cancer in a patient in need thereof.
  • the present invention relies on methods for treating patients in need thereof, said method comprising at least one of the following steps: (a) providing an immune-cell obtainable by any one of the methods previously described;
  • said T cells of the invention can undergo robust in vivo T cell expansion and can persist for an extended amount of time.
  • Said treatment can be ameliorating, curative or prophylactic. It may be either part of an autologous immunotherapy or part of an allogenic immunotherapy treatment.
  • autologous it is meant that cells, cell line or population of cells used for treating patients are originating from said patient or from a Human Leucocyte Antigen (HLA) compatible donor.
  • HLA Human Leucocyte Antigen
  • allogeneic is meant that the cells or population of cells used for treating patients are not originating from said patient but from a donor. Cells that can be used with the disclosed methods are described in the previous section.
  • Said treatment can be used to treat patients diagnosed wherein a pre-malignant or malignant cancer condition characterized by GD3-expressing cells, especially by an overabundance of GD3-expressing cells.
  • said isolated cell according to the invention or cell line derived from said isolated cell can be used for the treatment of liquid tumors, and preferably of T-cell acute lymphoblastic leukemia.
  • the treatment with the engineered immune cells according to the invention may be in combination with one or more therapies against cancer selected from the group of antibodies therapy, chemotherapy, cytokines therapy, dendritic cell therapy, gene therapy, hormone therapy, laser light therapy and radiation therapy.
  • said treatment can be administrated into patients undergoing an immunosuppressive treatment.
  • the present invention preferably relies on cells or population of cells, which have been made resistant to at least one immunosuppressive agent due to the inactivation of a gene encoding a receptor for such immunosuppressive agent.
  • the immunosuppressive treatment should help the selection and expansion of the T-cells according to the invention within the patient.
  • the administration of the cells or population of cells according to the present invention may be carried out in any convenient manner, including by aerosol inhalation, injection, ingestion, transfusion, implantation or transplantation.
  • compositions described herein may be administered to a patient subcutaneously, intradermal ⁇ , intratumorally, intranodally, intramedullary, intramuscularly, by intravenous or intralymphatic injection, or intraperitoneally.
  • the cell compositions of the present invention are preferably administered by intravenous injection.
  • the administration of the cells or population of cells can consist of the administration of 10 4 - 10 9 cells per kg body weight, preferably 10 s to 10 s cells/kg body weight including all integer values of cell numbers within those ranges.
  • the cells or population of cells can be administrated in one or more doses.
  • said effective amount of cells are administrated as a single dose.
  • said effective amount of cells are administrated as more than one dose over a period time. Timing of administration is within the judgment of managing physician and depends on the clinical condition of the patient.
  • the cells or population of cells may be obtained from any source, such as a blood bank or a donor. While individual needs vary, determination of optimal ranges of effective amounts of a given cell type for a particular disease or conditions within the skill of the art.
  • An effective amount means an amount which provides a therapeutic or prophylactic benefit.
  • the dosage administrated will be dependent upon the age, health and weight of the recipient, kind of concurrent treatment, if any, frequency of treatment and the nature of the effect desired.
  • said effective amount of cells or composition comprising those cells are administrated parenterally.
  • Said administration can be an intravenous administration.
  • Said administration can be directly done by injection within a tumor.
  • cells are administered to a patient in conjunction with (e.g., before, simultaneously or following) any number of relevant treatment modalities, including but not limited to treatment with agents such as antiviral therapy, cidofovir and interleukin-2, Cytarabine (also known as A A-C) or nataliziimab treatment for MS patients or efaliztimab treatment for psoriasis patients or other treatments for PML patients.
  • agents such as antiviral therapy, cidofovir and interleukin-2, Cytarabine (also known as A A-C) or nataliziimab treatment for MS patients or efaliztimab treatment for psoriasis patients or other treatments for PML patients.
  • the T cells of the invention may be used in combination with chemotherapy, radiation, immunosuppressive agents, such as cyclosporin, azathioprine, methotrexate, mycophenolate, and FK506, antibodies, or other immunoablative agents such as CAMPATH, anti-CD3 antibodies or other antibody therapies, cytoxin, fludaribine, cyclosporin, FK506, rapamycin, mycoplienolic acid, steroids, FR901228, cytokines, and irradiation.
  • immunosuppressive agents such as cyclosporin, azathioprine, methotrexate, mycophenolate, and FK506, antibodies
  • immunoablative agents such as CAMPATH, anti-CD3 antibodies or other antibody therapies
  • cytoxin fludaribine
  • cyclosporin FK506, rapamycin
  • mycoplienolic acid steroids
  • steroids FR901228
  • cytokines irradiation
  • the cell compositions of the present invention are administered to a patient in conjunction with (e.g., before, simultaneously or following) bone marrow transplantation, T cell ablative therapy using either chemotherapy agents such as, fludarabine, external-beam radiation therapy (XRT), cyclophosphamide, or antibodies such as OKT3 or CAMPATH,
  • the cell compositions of the present invention are administered following B-cell ablative therapy such as agents that react with CD20, e.g., Rituxan.
  • subjects may undergo standard treatment with high dose chemotherapy followed by peripheral blood stem cell transplantation.
  • subjects receive an infusion of the expanded immune cells of the present invention.
  • expanded cells are administered before or following surgery.
  • Preferred indications for the therapeutic use of the anti GD3 CAR according to the present inventions are melanoma, neuroblastoma, Glioma, breast carcinoma, ovarian epithelial tumors, neuroendocrine tumors and T-cell acute lymphoblastic leukemia.
  • Other definitions are melanoma, neuroblastoma, Glioma, breast carcinoma, ovarian epithelial tumors, neuroendocrine tumors and T-cell acute lymphoblastic leukemia.
  • - Amino acid residues in a polypeptide sequence are designated herein according to the one- letter code, in which, for example, Q means Gin or Glutamine residue, R means Arg or Arginine residue and D means Asp or Aspartic acid residue.
  • - Amino acid substitution means the replacement of one amino acid residue with another, for instance the replacement of an Arginine residue with a Glutamine residue in a peptide sequence is an amino acid substitution.
  • nucleosides are designated as follows: one-letter code is used for designating the base of a nucleoside: a is adenine, t is thymine, c is cytosine, and g is guanine.
  • r represents g or a (purine nucleotides)
  • k represents g or t
  • s represents g or c
  • w represents a or t
  • m represents a or c
  • y represents t or c (pyrimidine nucleotides)
  • d represents g, a or t
  • v represents g, a or c
  • b represents g, t or c
  • h represents a, t or c
  • n represents g, a, t or c.
  • nucleic acid or “polynucleotides” refers to nucleotides and/or polynucleotides, such as deoxyribonucleic acid (DNA) or ribonucleic acid (RNA), oligonucleotides, fragments generated by the polymerase chain reaction (PCR), and fragments generated by any of ligation, scission, endonuclease action, and exonuclease action.
  • DNA deoxyribonucleic acid
  • RNA ribonucleic acid
  • PCR polymerase chain reaction
  • Nucleic acid molecules can be composed of monomers that are naturally-occurring nucleotides (such as DNA and RNA), or analogs of naturally-occurring nucleotides (e.g., enantiomeric forms of naturally-occurring nucleotides), or a combination of both.
  • Modified nucleotides can have alterations in sugar moieties and/or in pyrimidine or purine base moieties.
  • Sugar modifications include, for example, replacement of one or more hydroxyl groups with halogens, alkyl groups, amines, and azido groups, or sugars can be functionalized as ethers or esters.
  • sugar moiety can be replaced with sterically and electronically similar structures, such as aza-sugars and carbocyclic sugar analogs.
  • modifications in a base moiety include alkylated purines and pyrimidines, acylated purines or pyrimidines, or other well-known heterocyclic substitutes.
  • Nucleic acid monomers can be linked by phosphodiester bonds or analogs of such linkages. Nucleic acids can be either single stranded or double stranded.
  • CAR chimeric antigen receptor
  • a component present on the target cell for example an antibody-based specificity for a desired antigen (e.g., tumor antigen) with a T cell receptor-activating intracellular domain to generate a chimeric protein that exhibits a specific anti-target cellular immune activity.
  • CAR consists of an extracellular single chain antibody (scFvFc), fused to the intracellular signaling domain of the T cell antigen receptor complex zeta chain (scFvFc ⁇ ) and have the ability, when expressed in T cells, to redirect antigen recognition based on the monoclonal antibody's specificity.
  • CAR may sometimes comprise multiple transmembrane polypeptides (multi-chain CARs) as described in WO2014039523.
  • CAR used in the present invention is a CAR directing against GD3 antigen and can comprise as non-limiting example the amino acid sequences : SEQ ID NO: 19 to 30.
  • exonuclease refers to any wild-type or variant enzyme capable of catalyzing the hydrolysis (cleavage) of bonds between nucleic acids within a DNA or RNA molecule, preferably a DNA molecule. Endonucleases do not cleave the DNA or RNA molecule irrespective of its sequence, but recognize and cleave the DNA or RNA molecule at specific polynucleotide sequences, further referred to as "target sequences" or "target sites”. Endonucleases can be classified as rare-cutting endonucleases when having typically a polynucleotide recognition site greater than 12 base pairs (bp) in length, more preferably of 14-55 bp.
  • Rare-cutting endonucleases can for example be a homing endonuclease (Paques and Duchateau 2007), a chimeric Zinc-Finger nuclease (ZFN) resulting from the fusion of engineered zinc-finger domains with the catalytic domain of a restriction enzyme such as Fokl (Porteus and Carroll 2005), a Cas9 endonuclease from CRISPR system (Gasiunas, Barrangou et al. 2012; Jinek, Chylinski et al. 2012; Cong, Ran et al. 2013; Mali, Yang et al.
  • a chemical or peptidic cleaver is conjugated either to a polymer of nucleic acids or to another DNA recognizing a specific target sequence, thereby targeting the cleavage activity to a specific sequence.
  • Chemical endonucleases also encompass synthetic nucleases like conjugates of orthophenanthroline, a DNA cleaving molecule, and triplex-forming oligonucleotides (TFOs), known to bind specific DNA sequences (Kalish and Glazer 2005). Such chemical endonucleases are comprised in the term "endonuclease" according to the present invention.
  • TALE-nuclease TALEN
  • TALEN Transcription Activator Like Effector
  • the catalytic domain is preferably a nuclease domain and more preferably a domain having endonuclease activity, like for instance l-Tevl, ColE7, NucA and Fok-I.
  • the TALE domain can be fused to a meganuclease like for instance l-Crel and l-Onul or functional variant thereof.
  • said nuclease is a monomeric TALE-Nuclease.
  • a monomeric TALE-Nuclease is a TALE-Nuclease that does not require dimerization for specific recognition and cleavage, such as the fusions of engineered TAL repeats with the catalytic domain of l-Tevl described in WO2012138927.
  • Transcription Activator like Effector are proteins from the bacterial species Xanthomonas comprise a plurality of repeated sequences, each repeat comprising di-residues in position 12 and 13 (RVD) that are specific to each nucleotide base of the nucleic acid targeted sequence.
  • Binding domains with similar modular base- per-base nucleic acid binding properties can also be derived from new modular proteins recently discovered by the applicant in a different bacterial species.
  • the new modular proteins have the advantage of displaying more sequence variability than TAL repeats.
  • RVDs associated with recognition of the different nucleotides are HD for recognizing C, NG for recognizing T, Nl for recognizing A, NN for recognizing G or A, NS for recognizing A, C, G or T, HG for recognizing T, IG for recognizing T, NK for recognizing G, HA for recognizing C, ND for recognizing C, HI for recognizing C, HN for recognizing G, NA for recognizing G, SN for recognizing G or A and YG for recognizing T, TL for recognizing A, VT for recognizing A or G and SW for recognizing A.
  • critical amino acids 12 and 13 can be mutated towards other amino acid residues in order to modulate their specificity towards nucleotides A, T, C and G and in particular to enhance this specificity.
  • TALE- nuclease have been already described and used to stimulate gene targeting and gene modifications (Boch, Scholze et al. 2009; Moscou and Bogdanove 2009; Christian, Cermak et al. 2010; Li, Huang et al. 2011).
  • Custom-made TAL-nucleases are commercially available under the trade name TALENTM (Cellectis, 8 rue de la Croix Jarry, 75013 Paris, France).
  • the rare-cutting endonuclease according to the present invention can also be a Cas9 endonuclease.
  • a new genome engineering tool has been developed based on the RNA- guided Cas9 nuclease (Gasiunas, Barrangou et al. 2012; Jinek, Chylinski et al. 2012; Cong, Ran et al. 2013; Mali, Yang et al. 2013) from the type II prokaryotic CRISPR (Clustered Regularly Interspaced Short palindromic Repeats) adaptive immune system (see for review (Sorek, Lawrence et al. 2013)).
  • CRISPR Clustered Regularly Interspaced Short palindromic Repeats
  • CRISPR Associated (Cas) system was first discovered in bacteria and functions as a defense against foreign DNA, either viral or plasmid.
  • CRISPR-mediated genome engineering first proceeds by the selection of target sequence often flanked by a short sequence motif, referred as the proto- spacer adjacent motif (PAM).
  • PAM proto- spacer adjacent motif
  • a specific crRNA complementary to this target sequence is engineered.
  • Trans-activating crRNA (tracrRNA) required in the CRISPR type II systems paired to the crRNA and bound to the provided Cas9 protein.
  • Cas9 acts as a molecular anchor facilitating the base pairing of tracRNA with cRNA (Deltcheva, Chylinski et al. 2011).
  • the dual tracrRNAxrRNA structure acts as guide RNA that directs the endonuclease Cas9 to the cognate target sequence.
  • Target recognition by the Cas9-tracrRNA:crRNA complex is initiated by scanning the target sequence for homology between the target sequence and the crRNA.
  • DNA targeting requires the presence of a short motif adjacent to the protospacer (protospacer adjacent motif - PAM).
  • Cas9 subsequently introduces a blunt double strand break 3 bases upstream of the PAM motif (Garneau, Dupuis et al. 2010).
  • Rare-cutting endonuclease can be a homing endonuclease, also known under the name of meganuclease. Such homing endonucleases are well-known to the art (Stoddard 2005). Homing endonucleases recognize a DNA target sequence and generate a single- or double-strand break. Homing endonucleases are highly specific, recognizing DNA target sites ranging from 12 to 45 base pairs (bp) in length, usually ranging from 14 to 40 bp in length.
  • the homing endonuclease according to the invention may for example correspond to a LAGLIDADG endonuclease, to a HNH endonuclease, or to a GIY-YIG endonuclease.
  • Preferred homing endonuclease according to the present invention can be an ⁇ -Crel variant.
  • delivery vector or “ delivery vectors” is intended any delivery vector which can be used in the present invention to put into cell contact ( i.e “contacting") or deliver inside cells or subcellular compartments (i.e “introducing") agents/chemicals and molecules (proteins or nucleic acids) needed in the present invention. It includes, but is not limited to liposomal delivery vectors, viral delivery vectors, drug delivery vectors, chemical carriers, polymeric carriers, lipoplexes, polyplexes, dendrimers, microbubbles (ultrasound contrast agents), nanoparticles, emulsions or other appropriate transfer vectors.
  • delivery vector or “delivery vectors” is also intended delivery methods to perform transfection.
  • vector refers to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked.
  • a “vector” in the present invention includes, but is not limited to, a viral vector, a plasmid, a RNA vector or a linear or circular DNA or RNA molecule which may consists of a chromosomal, non-chromosomal, semi-synthetic or synthetic nucleic acids.
  • Preferred vectors are those capable of autonomous replication (episomal vector) and/or expression of nucleic acids to which they are linked (expression vectors). Large numbers of suitable vectors are known to those of skill in the art and commercially available.
  • Viral vectors include retrovirus, adenovirus, parvovirus (e. g. adenoassociated viruses), coronavirus, negative strand RNA viruses such as orthomyxovirus (e. g., influenza virus), rhabdovirus (e. g., rabies and vesicular stomatitis virus), paramyxovirus (e. g. measles and Sendai), positive strand RNA viruses such as picornavirus and alphavirus, and double-stranded DNA viruses including adenovirus, herpesvirus (e. g., Herpes Simplex virus types 1 and 2, Epstein-Barr virus, cytomega- lovirus), and poxvirus (e.
  • orthomyxovirus e. g., influenza virus
  • rhabdovirus e. g., rabies and vesicular stomatitis virus
  • paramyxovirus e. g. measles and Sendai
  • viruses include Norwalk virus, togavirus, flavivirus, reoviruses, papovavirus, hepadnavirus, and hepatitis virus, for example.
  • retroviruses include: avian leukosis-sarcoma, mammalian C-type, B-type viruses, D type viruses, HTLV-BLV group, lentivirus, spumavirus (Coffin, J. M., Retroviridae: The viruses and their replication, In Fundamental Virology, Third Edition, B. N. Fields, et al., Eds., Lippincott-Raven Publishers, Philadelphia, 1996).
  • lentiviral vector HIV-Based lentiviral vectors that are very promising for gene delivery because of their relatively large packaging capacity, reduced immunogenicity and their ability to stably transduce with high efficiency a large range of different cell types.
  • Lentiviral vectors are usually generated following transient transfection of three (packaging, envelope and transfer) or more plasmids into producer cells.
  • lentiviral vectors enter the target cell through the interaction of viral surface glycoproteins with receptors on the cell surface.
  • the viral RNA undergoes reverse transcription, which is mediated by the viral reverse transcriptase complex.
  • the product of reverse transcription is a double-stranded linear viral DNA, which is the substrate for viral integration in the DNA of infected cells.
  • integrative lentiviral vectors or LV
  • NILV non-integrative lentiviral vectors
  • Delivery vectors and vectors can be associated or combined with any cellular permeabilization techniques such as sonoporation or electroporation or derivatives of these techniques.
  • cell or cells any eukaryotic living cells, primary cells and cell lines derived from these organisms for in vitro cultures.
  • primary cell or “primary cells” are intended cells taken directly from living tissue (i.e. biopsy material) and established for growth in vitro, that have undergone very few population doublings and are therefore more representative of the main functional components and characteristics of tissues from which they are derived from, in comparison to continuous tumorigenic or artificially immortalized cell lines.
  • cell lines can be selected from the group consisting of CHO-K1 cells; HEK293 cells; Caco2 cells; U2-OS cells; NIH 3T3 cells; NSO cells; SP2 cells; CHO-S cells; DG44 cells; K- 562 cells, U-937 cells; MRC5 cells; IMR90 cells; Jurkat cells; HepG2 cells; HeLa cells; HT-1080 cells; HCT-116 cells; Hu-h7 cells; Huvec cells; Molt 4 cells.
  • All these cell lines can be modified by the method of the present invention to provide cell line models to produce, express, quantify, detect, study a gene or a protein of interest; these models can also be used to screen biologically active molecules of interest in research and production and various fields such as chemical, biofuels, therapeutics and agronomy as non-limiting examples.
  • - by "mutation” is intended the substitution, deletion, insertion of up to one, two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen, fifteen, twenty, twenty five, thirty, fourty, fifty, or more nucleotides/amino acids in a polynucleotide (cDNA, gene) or a polypeptide sequence.
  • the mutation can affect the coding sequence of a gene or its regulatory sequence. It may also affect the structure of the genomic sequence or the structure/stability of the encoded m NA.
  • variant(s) it is intended a repeat variant, a variant, a DNA binding variant, a TALE- nuclease variant, a polypeptide variant obtained by mutation or replacement of at least one residue in the amino acid sequence of the parent molecule.
  • - by "functional variant” is intended a catalytically active mutant of a protein or a protein domain; such mutant may have the same activity compared to its parent protein or protein domain or additional properties, or higher or lower activity.
  • identity refers to sequence identity between two nucleic acid molecules or polypeptides. Identity can be determined by comparing a position in each sequence which may be aligned for purposes of comparison. When a position in the compared sequence is occupied by the same base, then the molecules are identical at that position. A degree of similarity or identity between nucleic acid or amino acid sequences is a function of the number of identical or matching nucleotides at positions shared by the nucleic acid sequences.
  • Various alignment algorithms and/or programs may be used to calculate the identity between two sequences, including FASTA, or BLAST which are available as a part of the GCG sequence analysis package (University of Wisconsin, Madison, Wis.), and can be used with, e.g., default setting.
  • polypeptides having at least 70%, 85%, 90%, 95%, 98% or 99% identity to specific polypeptides described herein and preferably exhibiting substantially the same functions, as well as polynucleotide encoding such polypeptides are contemplated.
  • a similarity score will be based on use of BLOSUM62.
  • BLASTP is used, the percent similarity is based on the BLASTP positives score and the percent sequence identity is based on the BLASTP identities score.
  • BLASTP "Identities" shows the number and fraction of total residues in the high scoring sequence pairs which are identical; and BLASTP “Positives” shows the number and fraction of residues for which the alignment scores have positive values and which are similar to each other.
  • amino acid sequences having these degrees of identity or similarity or any intermediate degree of identity of similarity to the amino acid sequences disclosed herein are contemplated and encompassed by this disclosure.
  • the polynucleotide sequences of similar polypeptides are deduced using the genetic code and may be obtained by conventional means, in particular by reverse translating its amino acid sequence using the genetic code.
  • signal-transducing domain or "co-stimulatory ligand” refers to a molecule on an antigen presenting cell that specifically binds a cognate co-stimulatory molecule on a T-cell, thereby providing a signal which, in addition to the primary signal provided by, for instance, binding of a TCR/CD3 complex with an MHC molecule loaded with peptide, mediates a T cell response, including, but not limited to, proliferation activation, differentiation and the like.
  • a co-stimulatory ligand can include but is not limited to CD7, B7-1 (CD80), B7-2 (CD86), PD-L1, PD-L2, 4-1BBL, OX40L, inducible costimulatory igand (ICOS-L), intercellular adhesion molecule (ICAM, CD30L, CD40, CD70, CD83, HLA- G, MICA, MICB, HVEM, lymphotoxin beta receptor, 3/TR6, ILT3, ILT4, an agonist or antibody that binds Toll ligand receptor and a ligand that specifically binds with B7-H3.
  • a co-stimulatory ligand also encompasses, inter alia, an antibody that specifically binds with a co-stimulatory molecule present on a T cell, such as but not limited to, CD27, CD28, 4-IBB, OX40, CD30, CD40, PD-1, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LTGHT, NKG2C, B7-H3, a ligand that specifically binds with CD83.
  • an antibody that specifically binds with a co-stimulatory molecule present on a T cell such as but not limited to, CD27, CD28, 4-IBB, OX40, CD30, CD40, PD-1, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LTGHT, NKG2C, B7-H3, a ligand that specifically binds with CD83.
  • a "co-stimulatory molecule” refers to the cognate binding partner on a Tcell that specifically binds with a co-stimulatory ligand, thereby mediating a co-stimulatory response by the cell, such as, but not limited to proliferation.
  • Co-stimulatory molecules include, but are not limited to an MHC class I molecule, BTLA and Toll ligand receptor.
  • a "co-stimulatory signal” as used herein refers to a signal, which in combination with primary signal, such as TCR/CD3 ligation, leads to T cell proliferation and/or upregulation or downregulation of key molecules.
  • extracellular ligand-binding domain is defined as an oligo- or polypeptide that is capable of binding a ligand.
  • the domain will be capable of interacting with a cell surface molecule.
  • the extracellular ligand-binding domain may be chosen to recognize a ligand that acts as a cell surface marker on target cells associated with a particular disease state.
  • cell surface markers that may act as ligands include those associated with viral, bacterial and parasitic infections, autoimmune disease and cancer cells.
  • subject or “patient” as used herein includes all members of the animal kingdom including non-human primates and humans.
  • T lymphocytes were then purified using the EasySep human T cell enrichment kit (Stemcell Technologies), and activated with Dynabeads Human T-Activator CD3/CD28 (Life Technologies) in X-vivo 15 medium (Lonza) supplemented with 20 ng/ml IL-2 (Miltenyi) and 5% human AB serum (Seralab).
  • SK-MEL-28, A2058, G-361, MeWo and MCF-7 cell lines were obtained from the American Type Culture Collection.
  • MeWo and SK-MEL-28 cells were cultured in EMEM supplemented with 10% heat -inactivated FCS, 2mmol/L L-glutamine and 100 units/ml penicillin, and 100 ⁇ / ⁇ streptomycin.
  • A2058 cells were cultured in DMEM supplemented with 10% heat -inactivated FCS, 2mmol/L L- glutamine and 100 units/ml penicillin, and 100 ⁇ / ⁇ streptomycin.
  • G-361 cells were cultured in McCoy's 5a supplemented with 10% heat -inactivated FCS, 2mmol/L L-glutamine and 100 units/ml penicillin, and 100 ⁇ g/mL streptomycin.
  • MCF-7 cells were cultured in DMEM supplemented with 10% heat -inactivated FCS, 2mmol/L L-glutamine and 100 units/ml penicillin, and 100 ⁇ g/mL streptomycin and O.Olmg/ml human insulin.
  • the number of GD3 surface molecules on different human cells was determined by saturation binding using the monoclonal anti-GD3 24 (abll779 - Abeam) and the Dako QiFIKIT according to the manufacturer's instructions.
  • the DNA encoding the scCARs was synthesized by GenScript. Construction of in vitro transcription mRNA vectors for scCARs
  • the DNA encoding the scCARs was cloned in the plasmid pCLS9632 between the T7 promoter and the BGH poly A.
  • Anti-GD3 scCARs components and constructions
  • Table 3 Sequence of the different CAR components
  • G4Sx3 linker SEQID NO.10 GGGGSGGGGSGGGGS
  • amino acid of the anti-GD3 scCARs are presented in the following SEQ ID NO.19 to 30.
  • Framed sequences correspond to preferred VH and VL sequences.
  • MALPVTALLLPLALLLHAARPI DVQLVESGGGLVQPGGSRKLSCAASGFTFSNFGMHWVRQAPEKGLEWVAYISSG
  • MALPVTALLLPLALLLHAARPI DVQLVESGGGLVQPGGSRKLSCAASGFTFSNFGMHWVRQAPEKGLEWVAYISSG
  • RNAs were purified with RNeasy columns (Qiagen), eluted in cytoporation medium T (Harvard Apparatus), and quantified by measuring absorbance at 260 nm using a Nanodrop ND-1000 spectrophotometer. Quality of the RNA was verified on a denaturing formaldehyde/MOPS agarose gel.
  • T lymphocytes were transfected by electrotransfer of messenger RNA using an AgilePulse MAX system (Harvard Apparatus). Following removal of activation beads, cells were pelleted, resuspended in cytoporation medium T at 25xl0 6 cells/ml.
  • 5xl0 6 cells were mixed with 15 ⁇ g of the mRNA encoding the scCAR into a 0.4 cm cuvette.
  • the electroporation consisted of two 0.1 ms pulses at 1200 V followed by four 0.2ms pulses at 130V.
  • T cells were first stained with either biotin-labeled polyclonal goat anti- mouse (Fab) 2 antibodies (Jackson Immunoresearch) or biotin-labeled protein L (GenScript), and then stained with phycoerythrin-labeled streptavidin (BD pharmingen), and finally analysed using the MACSQuant flow cytometer (Miltenyi).
  • Fab polyclonal goat anti- mouse
  • GenScript biotin-labeled protein L
  • BD pharmingen phycoerythrin-labeled streptavidin
  • 5 x 10 4 T cells were co-cultured with 5 ⁇ 10 4 GD3-positive or GD3-negative cells in 0.1 ml per well in a 96-well plate.
  • APC-labeled anti-CD107a (BD Biosciences) was added at the beginning of the co-culture in addition to ⁇ g/ml of anti-CD49d (BD Biosciences), ⁇ g/ml of anti-CD28 (Miltenyi), and lx Monensin solution (eBioscience).
  • cytotoxic T cells correspond to CD8+CD107a+ cells.
  • 5 x 10 4 T cells were co-cultured with 5 x 10 4 GD3-positive or GD3-negative cells in 0.1 ml per well in a 96-well plate. After a 24 hours incubation, the culture supernatants were collected and analysed for IFNg production using ELISA (R&D Systems).
  • the anti-GD3 scCARs designed were tested in human primay T cells using a two-step screening method (Figure 5).
  • the first step of the screening process primary human T cells previously activated for 4-5 days with anti-CD28/CD3 beads and IL-2 were electroporated with mRNA encoding the 12 anti-GD3 scCARs designed. 1 day post electroporation, scCARs expression was assessed by flow cytometry and western blot, and scCAR-modified T cells activity was assessed by measuring T cells degranulation. The scCARs that were detected by western blot and that induced significant specific degranulation of T cells (>20%) upon co-culture with at least one GD3 positive cell line were selected to pass through the second step of the screening process.
  • scCARs In the second step of the screening process, primary human T cells previously activated for 11- 12 days with anti-CD28/CD3 beads and IL-2 were electroporated with mRNA encoding the anti-GD3 scCARs selected after the first screening step. 1-2 days post electroporation, scCARs expression was assessed by flow cytometry, and scCAR-modified T cells activity was assessed by measuring effector functions of T cells. The scCARs that triggered significant specific degranulation of T cells (>20%), significant specific lysis of target cells (>20%) and significant production of IFNg by T cells (>1500pg/ml) upon co-culture with at least one GD3 positive cell line were selected as potential scCAR candidates.
  • scCAR-modified T cells To assess scCAR activity, the degranulation of scCAR-modified T cells upon co-culture with GD3-positive (SK-MEL-28 and MeWo) or GD3-negative (MCF-7) cells was analyzed.
  • the surface expression of anti-GD3 scCARs on T cells was assessed by flow cytometry using anti-Fab or protein L. It was observed that the scCARs BW2121-v3 and R24-v2 were detected in one experiment out of four using anti-Fab and in none of the experiments using protein L. The scCAR R24- v3 was detected neither with the anti-Fab nor with the protein L .
  • Example 4 Proliferation of TCRalpha inactivated cells expressing a GD3-CAR
  • TALE-nuclease targeting two 17-bp long sequences were designed and produced as described in WO2013176915. Each half target is recognized by repeats of the half TALE-nucleases listed in Table 11.
  • Table 11 TAL-nucleases targeting TCRalpha gene
  • TALE-nuclease construct was subcloned using restriction enzyme digestion in a mammalian expression vector under the control of the T7 promoter.
  • mRNA encoding TALE-nuclease cleaving TRAC genomic sequence were synthesized from plasmid carrying the coding sequence downstream from the T7 promoter.
  • T cells preactivated during 72 hours with anti-CD3/CD28 coated beads were transfected with each of the 2 mRNAs encoding both half TRAC_T01 TALE-nucleases.
  • different groups of T cells from the same donor were respectively transduced with a lentiviral vector encoding one of the GD3 CAR previously described (SEQ ID NO: 19 to 30).
  • CD3 NEG cells were purified using anti-CD3 magnetic beads and 5 days post- transduction cells were reactivated with soluble anti-CD28 (5 ⁇ g/ml).
  • the expression of the activation marker CD25 are analyzed by FACS 7 days post transduction.
  • the purified cells transduced with the lentiviral vector encoding GD3 CAR assayed for CD25 expression at their surface in order to assess their activation in comparison with the non-transduced cells.
  • Increased CD25 expression is expected both in CD28 reactivation or no reactivation conditions.
  • This lentiviral vector was used to transduce CD3/CD28-stimulated peripheral blood mononuclear cells (PBMCs) from healthy donors, and stably modified T cells were expanded in G-Rex (Fig. 13).
  • PBMCs peripheral blood mononuclear cells
  • Example 6 GD3 CAR T cells activate multiple effector functions when cocultured with GD3- positive target cells
  • interferon ⁇ IFN- ⁇
  • CD107a the cell surface expression of the degranulation marker CD107a
  • lytic activity the lytic activity following coculture with various tumor cell lines.
  • GD3 CAR T cells produced IFNy, expressed CD107a at the cell surface and display lytic activity when cocultured with GD3 positive target cells (G361) but not when cocultured with GD3 negative cells (MCF-7) (Fig. 14, 15 and 16).
  • TAL nucleases hybrid proteins composed of TAL effectors and Fokl DNA-cleavage domain. Nucleic Acids Res 39(1): 359-72.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Immunology (AREA)
  • Genetics & Genomics (AREA)
  • General Health & Medical Sciences (AREA)
  • Zoology (AREA)
  • Biochemistry (AREA)
  • Cell Biology (AREA)
  • Medicinal Chemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Engineering & Computer Science (AREA)
  • Toxicology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Biomedical Technology (AREA)
  • Biotechnology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Wood Science & Technology (AREA)
  • General Engineering & Computer Science (AREA)
  • Microbiology (AREA)
  • Hematology (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Veterinary Medicine (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
EP16734198.1A 2015-05-20 2016-05-20 Anti-gd3 specific chimeric antigen receptors for cancer immunotherapy Pending EP3298046A1 (en)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
DKPA201570296 2015-05-20
PCT/EP2016/061485 WO2016185035A1 (en) 2015-05-20 2016-05-20 Anti-gd3 specific chimeric antigen receptors for cancer immunotherapy

Publications (1)

Publication Number Publication Date
EP3298046A1 true EP3298046A1 (en) 2018-03-28

Family

ID=53188832

Family Applications (1)

Application Number Title Priority Date Filing Date
EP16734198.1A Pending EP3298046A1 (en) 2015-05-20 2016-05-20 Anti-gd3 specific chimeric antigen receptors for cancer immunotherapy

Country Status (6)

Country Link
US (1) US10752670B2 (es)
EP (1) EP3298046A1 (es)
AR (1) AR104718A1 (es)
AU (1) AU2016263513A1 (es)
TW (1) TW201706300A (es)
WO (1) WO2016185035A1 (es)

Cited By (14)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10704021B2 (en) 2012-03-15 2020-07-07 Flodesign Sonics, Inc. Acoustic perfusion devices
US10724029B2 (en) 2012-03-15 2020-07-28 Flodesign Sonics, Inc. Acoustophoretic separation technology using multi-dimensional standing waves
US10785574B2 (en) 2017-12-14 2020-09-22 Flodesign Sonics, Inc. Acoustic transducer driver and controller
US10967298B2 (en) 2012-03-15 2021-04-06 Flodesign Sonics, Inc. Driver and control for variable impedence load
US10975368B2 (en) 2014-01-08 2021-04-13 Flodesign Sonics, Inc. Acoustophoresis device with dual acoustophoretic chamber
US11007457B2 (en) 2012-03-15 2021-05-18 Flodesign Sonics, Inc. Electronic configuration and control for acoustic standing wave generation
US11021699B2 (en) 2015-04-29 2021-06-01 FioDesign Sonics, Inc. Separation using angled acoustic waves
US11085035B2 (en) 2016-05-03 2021-08-10 Flodesign Sonics, Inc. Therapeutic cell washing, concentration, and separation utilizing acoustophoresis
US11214789B2 (en) 2016-05-03 2022-01-04 Flodesign Sonics, Inc. Concentration and washing of particles with acoustics
US11377651B2 (en) 2016-10-19 2022-07-05 Flodesign Sonics, Inc. Cell therapy processes utilizing acoustophoresis
US11420136B2 (en) 2016-10-19 2022-08-23 Flodesign Sonics, Inc. Affinity cell extraction by acoustics
US11459540B2 (en) 2015-07-28 2022-10-04 Flodesign Sonics, Inc. Expanded bed affinity selection
US11474085B2 (en) 2015-07-28 2022-10-18 Flodesign Sonics, Inc. Expanded bed affinity selection
US11708572B2 (en) 2015-04-29 2023-07-25 Flodesign Sonics, Inc. Acoustic cell separation techniques and processes

Families Citing this family (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA3058425A1 (en) * 2017-03-28 2018-10-04 The Trustees Of The University Of Pennsylvania Methods to protect transplanted tissue from rejection
EP3765054A4 (en) * 2018-01-19 2022-01-12 The Trustees Of The University Of Pennsylvania COMPOSITIONS AND METHODS FOR TARGETING GAMMA DELTA T CELLS WITH CHIMERIC ANTIGEN RECEPTORS
CN111886243A (zh) * 2018-02-11 2020-11-03 纪念斯隆-凯特琳癌症中心 非-hla限制性t细胞受体及其用途
BR112022003471A2 (pt) * 2019-08-27 2022-05-24 Janssen Biotech Inc Sistema receptor de antígeno quimérico e usos do mesmo
WO2021076980A1 (en) * 2019-10-16 2021-04-22 Northwestern University Materials and methods for treating vitiligo
TW202241935A (zh) 2020-12-18 2022-11-01 美商世紀治療股份有限公司 具有可調適受體專一性之嵌合抗原受體系統
EP4313130A1 (en) * 2021-03-31 2024-02-07 Memorial Sloan-Kettering Cancer Center Antigen recognizing receptors targeting gd3 ganglioside and uses thereof
WO2022266075A1 (en) 2021-06-14 2022-12-22 Caribou Biosciences, Inc. Methods and materials for treating cancer using car constructs with an intracellular domain comprising a stap domain and a kinase domain or a stap domain and a phosphatase domain

Family Cites Families (52)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4683195A (en) 1986-01-30 1987-07-28 Cetus Corporation Process for amplifying, detecting, and/or-cloning nucleic acid sequences
GB8607679D0 (en) 1986-03-27 1986-04-30 Winter G P Recombinant dna product
US5225539A (en) 1986-03-27 1993-07-06 Medical Research Council Recombinant altered antibodies and methods of making altered antibodies
GB8611832D0 (en) 1986-05-15 1986-06-25 Holland I B Polypeptide
US5037743A (en) 1988-08-05 1991-08-06 Zymogenetics, Inc. BAR1 secretion signal
US5858358A (en) 1992-04-07 1999-01-12 The United States Of America As Represented By The Secretary Of The Navy Methods for selectively stimulating proliferation of T cells
US6905680B2 (en) 1988-11-23 2005-06-14 Genetics Institute, Inc. Methods of treating HIV infected subjects
US6352694B1 (en) 1994-06-03 2002-03-05 Genetics Institute, Inc. Methods for inducing a population of T cells to proliferate using agents which recognize TCR/CD3 and ligands which stimulate an accessory molecule on the surface of the T cells
US6534055B1 (en) 1988-11-23 2003-03-18 Genetics Institute, Inc. Methods for selectively stimulating proliferation of T cells
US5530101A (en) 1988-12-28 1996-06-25 Protein Design Labs, Inc. Humanized immunoglobulins
GB8928874D0 (en) 1989-12-21 1990-02-28 Celltech Ltd Humanised antibodies
EP0519596B1 (en) 1991-05-17 2005-02-23 Merck & Co. Inc. A method for reducing the immunogenicity of antibody variable domains
EP1400536A1 (en) 1991-06-14 2004-03-24 Genentech Inc. Method for making humanized antibodies
US5766886A (en) 1991-12-13 1998-06-16 Xoma Corporation Modified antibody variable domains
GB9203459D0 (en) 1992-02-19 1992-04-08 Scotgen Ltd Antibodies with germ-line variable regions
DE4208795A1 (de) * 1992-03-19 1993-09-23 Behringwerke Ag Monoklonaler anti-gangliosid-antikoerper, seine herstellung und verwendung als tumortherapeutikum
US5639641A (en) 1992-09-09 1997-06-17 Immunogen Inc. Resurfacing of rodent antibodies
US7175843B2 (en) 1994-06-03 2007-02-13 Genetics Institute, Llc Methods for selectively stimulating proliferation of T cells
US7067318B2 (en) 1995-06-07 2006-06-27 The Regents Of The University Of Michigan Methods for transfecting T cells
US6692964B1 (en) 1995-05-04 2004-02-17 The United States Of America As Represented By The Secretary Of The Navy Methods for transfecting T cells
US6010613A (en) 1995-12-08 2000-01-04 Cyto Pulse Sciences, Inc. Method of treating materials with pulsed electrical fields
US6797514B2 (en) 2000-02-24 2004-09-28 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
AU4328801A (en) 2000-02-24 2001-09-03 Xcyte Therapies Inc Simultaneous stimulation and concentration of cells
US6867041B2 (en) 2000-02-24 2005-03-15 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
US7572631B2 (en) 2000-02-24 2009-08-11 Invitrogen Corporation Activation and expansion of T cells
CA2427858A1 (en) 2000-11-03 2002-05-10 University Of Vermont And State Agricultural College Compositions for inhibiting grb7
US20020132983A1 (en) * 2000-11-30 2002-09-19 Junghans Richard P. Antibodies as chimeric effector cell receptors against tumor antigens
US20070031438A1 (en) * 2001-12-10 2007-02-08 Junghans Richard P Antibodies as chimeric effector cell receptors against tumor antigens
US9982251B2 (en) 2003-03-14 2018-05-29 Cellectis S.A. Large volume ex vivo electroporation method
US20050048617A1 (en) 2003-08-18 2005-03-03 Medimmune, Inc. Humanization of antibodies
EP1660534A2 (en) 2003-08-22 2006-05-31 MedImmune, Inc. Humanization of antibodies
AU2007226696C1 (en) 2006-03-10 2016-02-04 Wyeth Llc Anti-5T4 antibodies and uses thereof
WO2008101234A2 (en) * 2007-02-16 2008-08-21 Sloan-Kettering Institute For Cancer Research Anti ganglioside gd3 antibodies and uses thereof
EP2331566B1 (en) * 2008-08-26 2015-10-07 City of Hope Method and compositions for enhanced anti-tumor effector functioning of t cells
WO2011068136A1 (ja) * 2009-12-01 2011-06-09 協和発酵キリン株式会社 ガングリオシドgd3に特異的に結合する抗体を含む医薬
WO2012012695A2 (en) 2010-07-23 2012-01-26 Fred Hutchinson Cancer Research Center A method for the treatment of obesity
EP2614151B1 (en) 2010-09-08 2019-07-24 Chemotherapeutisches Forschungsinstitut Georg-Speyer-Haus Interleukin 15 as selectable marker for gene transfer in lymphocytes
KR20230133410A (ko) * 2010-12-09 2023-09-19 더 트러스티스 오브 더 유니버시티 오브 펜실바니아 암을 치료하기 위한 키메릭 항원 수용체 변형 t 세포의 용도
US9217040B2 (en) 2011-01-14 2015-12-22 The Regents Of The University Of California Therapeutic antibodies against ROR-1 protein and methods for use of same
BR112013024395B1 (pt) 2011-03-23 2021-10-26 Fred Hutchinson Cancer Research Center Composições adotivas de imunoterapia celular e método para fabricação da dita composição
US20140115726A1 (en) 2011-04-05 2014-04-24 Cellectis New tale-protein scaffolds and uses thereof
US9833476B2 (en) 2011-08-31 2017-12-05 The Trustees Of Dartmouth College NKP30 receptor targeted therapeutics
EP2756521A4 (en) * 2011-09-16 2015-04-22 Univ Pennsylvania RNA-MANIPULATED T-CELLS FOR THE TREATMENT OF CANCER
US9708384B2 (en) 2011-09-22 2017-07-18 The Trustees Of The University Of Pennsylvania Universal immune receptor expressed by T cells for the targeting of diverse and multiple antigens
WO2013063419A2 (en) 2011-10-28 2013-05-02 The Trustees Of The University Of Pennsylvania A fully human, anti-mesothelin specific chimeric immune receptor for redirected mesothelin-expressing cell targeting
AU2013221672B2 (en) 2012-02-13 2017-11-09 Seattle Children's Hospital D/B/A Seattle Children's Research Institute Bispecific chimeric antigen receptors and therapeutic uses thereof
KR102247979B1 (ko) 2012-05-25 2021-05-04 셀렉티스 면역요법을 위한 동종이형 및 면역억제제 저항성인 t 세포의 조작 방법
KR102135239B1 (ko) 2012-08-20 2020-07-17 프레드 헛친슨 켄서 리서치 센터 세포 면역요법을 위한 방법 및 조성물
EP2888283B1 (en) 2012-08-24 2018-09-19 The Regents of The University of California Antibodies and vaccines for use in treating ror1 cancers and inhibiting metastasis
WO2014039523A1 (en) 2012-09-04 2014-03-13 Cellectis Multi-chain chimeric antigen receptor and uses thereof
CA2910666A1 (en) * 2013-05-03 2014-11-06 Ohio State Innovation Foundation Cs1-specific chimeric antigen receptor engineered immune effector cells
AU2015295349B2 (en) 2014-07-29 2020-09-24 Cellectis ROR1(NTRKR1)specific chimeric antigen receptors for cancer immunotherapy

Cited By (14)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11007457B2 (en) 2012-03-15 2021-05-18 Flodesign Sonics, Inc. Electronic configuration and control for acoustic standing wave generation
US10724029B2 (en) 2012-03-15 2020-07-28 Flodesign Sonics, Inc. Acoustophoretic separation technology using multi-dimensional standing waves
US10704021B2 (en) 2012-03-15 2020-07-07 Flodesign Sonics, Inc. Acoustic perfusion devices
US10967298B2 (en) 2012-03-15 2021-04-06 Flodesign Sonics, Inc. Driver and control for variable impedence load
US10975368B2 (en) 2014-01-08 2021-04-13 Flodesign Sonics, Inc. Acoustophoresis device with dual acoustophoretic chamber
US11021699B2 (en) 2015-04-29 2021-06-01 FioDesign Sonics, Inc. Separation using angled acoustic waves
US11708572B2 (en) 2015-04-29 2023-07-25 Flodesign Sonics, Inc. Acoustic cell separation techniques and processes
US11459540B2 (en) 2015-07-28 2022-10-04 Flodesign Sonics, Inc. Expanded bed affinity selection
US11474085B2 (en) 2015-07-28 2022-10-18 Flodesign Sonics, Inc. Expanded bed affinity selection
US11085035B2 (en) 2016-05-03 2021-08-10 Flodesign Sonics, Inc. Therapeutic cell washing, concentration, and separation utilizing acoustophoresis
US11214789B2 (en) 2016-05-03 2022-01-04 Flodesign Sonics, Inc. Concentration and washing of particles with acoustics
US11377651B2 (en) 2016-10-19 2022-07-05 Flodesign Sonics, Inc. Cell therapy processes utilizing acoustophoresis
US11420136B2 (en) 2016-10-19 2022-08-23 Flodesign Sonics, Inc. Affinity cell extraction by acoustics
US10785574B2 (en) 2017-12-14 2020-09-22 Flodesign Sonics, Inc. Acoustic transducer driver and controller

Also Published As

Publication number Publication date
WO2016185035A1 (en) 2016-11-24
AR104718A1 (es) 2017-08-09
AU2016263513A1 (en) 2017-11-23
US10752670B2 (en) 2020-08-25
TW201706300A (zh) 2017-02-16
US20180291079A1 (en) 2018-10-11

Similar Documents

Publication Publication Date Title
US10752670B2 (en) Anti-GD3 specific chimeric antigen receptors for cancer immunotherapy
US11987639B2 (en) Trophoblast glycoprotein (5T4, TPBG) specific chimeric antigen receptors for cancer immunotherapy
EP3453406B1 (en) Ror1 (ntrkr1) specific chimeric antigen receptors for cancer immunotherapy
US11690873B2 (en) Universal chimeric antigen receptor T cells specific for CD22
AU2015239069B2 (en) CD33 specific Chimeric Antigen Receptors for cancer immunotherapy

Legal Events

Date Code Title Description
STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE INTERNATIONAL PUBLICATION HAS BEEN MADE

PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: REQUEST FOR EXAMINATION WAS MADE

17P Request for examination filed

Effective date: 20171208

AK Designated contracting states

Kind code of ref document: A1

Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO RS SE SI SK SM TR

AX Request for extension of the european patent

Extension state: BA ME

DAV Request for validation of the european patent (deleted)
DAX Request for extension of the european patent (deleted)
STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: EXAMINATION IS IN PROGRESS

17Q First examination report despatched

Effective date: 20180926

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: EXAMINATION IS IN PROGRESS

RIN1 Information on inventor provided before grant (corrected)

Inventor name: SMITH, JULIANNE

Inventor name: SCHIFFER-MANNIOUI, CECILE

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: EXAMINATION IS IN PROGRESS