EP2603521A2 - Molécules d'anticorps dirigées contre des isoformes oncogènes du récepteur 2 du facteur de croissance des fibroblastes et leurs utilisations - Google Patents

Molécules d'anticorps dirigées contre des isoformes oncogènes du récepteur 2 du facteur de croissance des fibroblastes et leurs utilisations

Info

Publication number
EP2603521A2
EP2603521A2 EP11817134.7A EP11817134A EP2603521A2 EP 2603521 A2 EP2603521 A2 EP 2603521A2 EP 11817134 A EP11817134 A EP 11817134A EP 2603521 A2 EP2603521 A2 EP 2603521A2
Authority
EP
European Patent Office
Prior art keywords
seq
isoform
atto
fgfr2
amino acid
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Withdrawn
Application number
EP11817134.7A
Other languages
German (de)
English (en)
Other versions
EP2603521A4 (fr
Inventor
Xiao-Jia Chang
Ullrich S. Schwertschlag
Katherine Jane Turner
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Attogen Inc
Original Assignee
Attogen Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Attogen Inc filed Critical Attogen Inc
Publication of EP2603521A2 publication Critical patent/EP2603521A2/fr
Publication of EP2603521A4 publication Critical patent/EP2603521A4/fr
Withdrawn legal-status Critical Current

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2863—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622—Single chain antibody (scFv)
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding

Definitions

  • prostate cancer is one of the most common malignancies in men, with an increasing incidence.
  • CaP prostate cancer
  • about 10% of newly diagnosed patients have some evidence of locally advanced CaP and 5% already have distant metastasis at the time of diagnoses (Draisma et al., (2003) J. Natl. Cancer Inst. 95:868- 878; Thompson et al., (2003) N. Engl. J. Med. 349, 215-224; Makinen et al., (2003) Clin.
  • the present invention features, at least in part, isoform-specific inhibitors that inhibit or reduce one or more isoform-associated activities, wherein the isoform-specific inhibitors include but are not limited to, binding molecules (also referred to herein as "isoform-binding molecules") that specifically interact with, e.g., bind to, one or more isoforms (e.g., isoform polypeptides or nucleic acids encoding the same) that arise from, e.g., one or more of: alternative splicing, frameshifting, translational and/or post-translational events, thereby resulting in different transcription or translation products.
  • binding molecules also referred to herein as "isoform-binding molecules”
  • isoforms e.g., isoform polypeptides or nucleic acids encoding the same
  • the isoform-specific inhibitors specifically bind to, and/or inhibit the activity of, one or more isoforms expressed and/or associated with oncogenic or malignant phenotypes (referred to herein as "oncogenic isoforms").
  • the isoform-specific inhibitor can be an oncogenic isoform-binding molecule, e.g., an antibody molecule or a nucleic acid inhibitor that specifically interacts with, e.g., binds to, one or more oncogenic isoforms (e.g., oncogenic isoform polypeptides or nucleic acids encoding the same).
  • the isoform-specific inhibitor is a soluble receptor polypeptide or a fusion form thereof, or a peptide or a functional variant thereof that reduces or inhibits one or more isoform- (e.g., oncogenic isoform-) associated activities.
  • the oncogenic isoforms can arise from, e.g., alternative splicing, frameshifting, translational and/or post-translational events, of various proto-oncogene expression products in a cell, e.g., a hyperproliferative cell (e.g., a cancerous or tumor cell).
  • a hyperproliferative cell e.g., a cancerous or tumor cell.
  • the isoform-binding molecules described herein specifically bind to such oncogenic isoforms, and do not substantially bind to the proto-oncogene from which the isoform is derived.
  • the isoform-binding molecule e.g., an antibody molecule
  • FGFR2 fibroblast growth factor receptor 2
  • the isoform-binding molecules described herein specifically bind to an oncogenic isoform of fibroblast growth factor receptor 1 (FGFR1) (e.g., an oncogenic FGFR1L); RON receptor tyrosine kinase (c-met-related tyrosine kinase) (e.g., an oncogenic RON receptor tyrosine kinase comprising a deletion of exons 5 and 6); KIT receptor tyrosine kinase (e.g., an oncogenic KIT receptor tyrosine kinase comprising a deletion in exon 11); platelet-derived growth factor (PDGF) (e.g., an oncogenic PDGF isoform having a deletion in exon 6); or PDGF-receptor alpha (e.g., an oncogenic PDGF-receptor alpha comprising a deletion of exons 7 and 8).
  • FGFR1 fibroblast growth factor receptor 1
  • the present invention provides, in part, isoform-specific inhibitors (e.g., antibody molecules, soluble receptor polypeptides and fusion forms thereof, peptides and functional variants thereof, and nucleic acid inhibitors), pharmaceutical compositions thereof, as well as nucleic acids, recombinant expression vectors and host cells for making such isoform- binding molecules.
  • isoform-specific inhibitors selectively bind to and/or reduce, inhibit or otherwise block an interaction of an oncogenic isoform with a ligand or co-receptor, thereby reducing or inhibiting oncogenic activity.
  • the isoform-specific inhibitors compete for binding of a cognate ligand (e.g., FGF8b) to the isoform (e.g., FGFR2-IIIc).
  • a cognate ligand e.g., FGF8b
  • the isoform-specific inhibitors act as dominant negative competitors, e.g., a dominant negative competitor that binds to the isoform but does not produce intracellular signal.
  • the isoform-binding molecules may selectively target a cytotoxic or cytostatic agent to a hyperproliferative cell, e.g., a cancer or tumor cell.
  • the isoform-specific inhibitors disclosed herein can be used to treat, prevent and/or diagnose cancerous or malignant conditions and/or disorders, such as cancers or tumors
  • the isoform-binding molecules of the invention to detect oncogenic isoforms, to reduce the activity and/or or kill a hyperproliferative cell expressing an oncogenic isoform in vitro, ex vivo or in vivo are also encompassed by the invention. Diagnostic and/or screening methods and kits for evaluating the function or expression of an oncogenic isoform are also disclosed.
  • the invention features an isoform- specific inhibitor ⁇ e.g., an antibody molecule, a soluble receptor polypeptide or a fusion form thereof), which interacts with, or more preferably specifically binds to, one or more isoform polypeptides or fragments thereof.
  • an isoform-specific inhibitor e.g., an antibody molecule, a soluble receptor polypeptide or a fusion form thereof
  • Typical isoform-binding molecules bind to one or more isoform polypeptides or fragments thereof, with high affinity, e.g., with an affinity constant of at least about 10 7 M- " 1 , typically about 108 M- " 1 , and more typically, about 10 9 M “1 to 10 10 M “1 or stronger; and reduce and/or inhibit one or more activities of the isoforms, e.g., oncogenic isoforms, in a hyperproliferative ⁇ e.g., cancerous or malignant) cell and/or tissue.
  • the binding molecule may selectively and specifically reduce or inhibit an oncogenic isoform-associated activity chosen from one or more of: (i) binding of a ligand or co-receptor ⁇ e.g., FGF ligand, e.g., FGF8b, FGF2, FGF17 or FGF18 to FGFR2 isoform IIIc); (ii) receptor dimerization ⁇ e.g., FGFR2 isoform IIIc dimerization); (iii) isoform signaling, e.g., FGFR2 isoform IIIc signaling; (iv) hyperproliferative ⁇ e.g., cancerous or tumor) cell proliferation, growth and/or survival, for example, by induction of apoptosis of the hyperproliferative cell; and/or (v) angiogenesis and/or vascularization of a tumor.
  • FGF ligand e.g., FGF8b, FGF2, FGF17 or FGF18
  • receptor dimerization
  • the inhibitor may exert its effects directly in the hyperproliferative ⁇ e.g., cancerous or malignant) cell and/or tissue ⁇ e.g., inducing cell killing or apoptosis directly).
  • the inhibitor can exert its effects by acting on proximal cells, e.g., cells in the vicinity, of the hyperproliferative ⁇ e.g., cancerous or malignant) cell and/or tissue.
  • the inhibitor may reduce the angiogenesis and/or vascularization of a tumor tissue.
  • the isoform-binding molecule is an antibody molecule that binds to a mammalian, e.g., human, isoform polypeptide or a fragment thereof.
  • the antibody molecule binds to an isoform polypeptide or fragment expressed and/or associated with a mammalian, e.g., human, isoform polypeptide or a fragment thereof.
  • the antibody molecule binds to an isoform polypeptide or fragment expressed and/or associated with a
  • hyperproliferative cell e.g., a cancerous or tumor cell.
  • the antibody molecule binds specifically to an epitope, e.g., a linear or conformational epitope, located or expressed primarily on the surface of a hyperproliferative cell, e.g., a cancerous or tumor cell.
  • the epitope recognized by the antibody molecule is expressed or associated with a hyperproliferative disease, e.g., a cancerous or malignant disease.
  • the epitope recognized by the antibody molecule is expressed or associated with an exon sequence predominantly expressed or associated with one or more cancerous or tumor cells or disorders; the epitope may be located at the junctional region between two exons that are predominantly joined together in one or more cancerous or tumor cells or disorders, e.g., as a result of an in-frame exon deletion or the use of an alternatively spliced exon.
  • Exemplary isoform polypeptides or fragments recognized by isoform-binding molecules of the invention include, but are not limited to, oncogenic isoforms of FGFR2, FGFRl, RON receptor tyrosine kinase, KIT receptor tyrosine kinase, PDGF and PDGF-receptor alpha.
  • the antibody molecule binds to an isoform, e.g., an oncogenic
  • the antibody molecule can bind specifically to FGFR2 isoform IIIc or a fragment thereof, e.g., does not substantially bind to other non-oncogenic
  • FGF receptors such as other alternative splice variants of FGFR2 (e.g., FGFR2
  • FGFR2 isoform 14 (SEQ ID NO: 29), FGFR2 isoform 15 (SEQ ID NO: 30), FGFR isoform 17
  • the antibody molecule binds preferentially to FGFR2 isoform IIIc or a
  • FGFR2 isoform Illb e.g., about amino acids 314 to 351 of human FGFR2 isoform Illb (HSGINSSNAEVLALFNVTEADAGEYICKVSNYIGQANQ; SEQ ID NO: 1
  • the antibody molecule binds
  • amino acids e.g., at least one epitope
  • the anti- FGFR2-IIIc antibody molecule binds to one, two, three, four, five, six, seven, eight, nine, ten, twelve, fourteen, sixteen, eighteen, twenty, twenty- two or more of: alanine at position 1, alanine at position 2, valine at position 4, threonine at position 6, threonine at position 7, aspartate at position 8, lysine at position 9, isoleucine at position 11, glutamate at position 12, valine at position 13, tyrosine at position 15, isoleucine at position 16, arginine at position 17, phenylalanine at position 21, glutamate at position 22, threonine at position 28, leucine at position 30, alanine at position 31, glycine at position 32, serine at position 34, isoleucine at position 37, serine at position 38, phenylalanine at position 39, or histidine at position 40 of SEQ ID NO: 84 (corresponding to the highlighted amino acid residues in
  • AAGVNTTDKEIEVLYIRNVTFEDAGEYTCLAGNSIGISFH (SEP ID NO: 84)); or one or more of: threonine at position 1, leucine at position 3, alanine at position 4, glycine at position 5, serine at position 7, isoleucine at position 10, serine at position 11, phenylalanine at position 12, or histidine at position 13 of SEQ ID NO: 86 (corresponding to the highlighted amino acid residues in TCLAGNSIGISFH; SEQ ID NO: 86).
  • the anti-FGFR2-IIIc antibody molecule binds to, e.g., selectively binds to, mammalian, e.g., human FGFR2-IIIc (e.g., an epitope located in the extracellular domain of human FGFR2-IIIc at about amino acids 301 to 360 of FGFR2-IIIc (SEQ ID NO:2), or a sequence that is at least 85%, 90%, 95%, 99% or more identical thereto).
  • the anti-FGFR2-IIIc antibody molecule binds to one or more amino acid residues chosen from (e.g., an epitope comprising amino acid residues) residues 314-353
  • the anti-FGFR2-IIIc antibody molecule binds to a synthetic, recombinant or native epitope on the extracellular domain of human FGFR2-IIIc.
  • the anti- FGFR2-IIIc antibody molecule binds to the native FGFR2-IIIc present in a prostate cancer cell, e.g., a human prostate cancer cell (e.g., DU145 human prostate cancer cell line), or a rat prostate cancer cell line (e.g., AT3B- 1 rat prostate cancer cell line).
  • a human prostate cancer cell e.g., DU145 human prostate cancer cell line
  • a rat prostate cancer cell line e.g., AT3B- 1 rat prostate cancer cell line
  • the anti-FGFR2-IIIc antibody molecule preferentially to FGFR2 isoform IIIc or a fragment thereof, but does not substantially bind to (e.g., shows less than 10%, 8%, 5%, 4%, 3%, 2%, 1% cross-reactivity with) FGFR2 isoform Illb, e.g., the extracellular domain of human FGFR2 isoform Illb (e.g., about amino acids 314 to 351 of human FGFR2 isoform Illb (HSGINSSNAEVLALFNVTEADAGEYICKVSNYIGQANQ; SEQ ID NO: 56); about amino acids 314 to 328 of human FGFR2 isoform Illb (HSGINSSNAEVLALF; SEQ ID NO: 57); or about amino acids 340 to 351 of human FGFR2 isoform Illb (CKVSNYIGQANQ; SEQ ID NO: 58).
  • the extracellular domain of human FGFR2 isoform Illb e.
  • the anti-FGFR2-IIIc antibody molecule shows a preferential binding to human FGFR2-IIIc as any of the monoclonal antibodies shown in FIGS. 24A-24B, 25A-25B, 27A-27B, 28, 29A-29F, 30A-30F, 32-39, and 41-44.
  • the anti-FGFR2-IIIc antibody molecule shows the same or similar binding selectivity as any of clones B7 (also referred to herein as "Atto-MuMab-03"), C5, D2, D10, E3, E8, F3, F10 or G9 of FIGS.
  • the anti-FGFR2- IIIc antibody molecule shows the same or similar binding selectivity as Atto-MuMab-01 or Atto- MuMab-02 (VH and VL shown in FIGs. 33, 34A-34B, 35, and 36A-36B).
  • the anti-FGFR2-IIIc antibody molecule shows the same or similar binding selectivity as human clones 1, 6 or 8 of FIGS. 25A-25B, 27A-27B, 28-29, 30A-30F, 37-39, and/or 41-44 (Atto-HuMab-01, Atto-HuMab-06, Atto-HuMab-08, respectively).
  • the FGFR2-IIIc antibody molecule binds specifically to human FGFR2-IIIc, and competitively inhibits the binding of a second antibody molecule to FGFR2-IIIc, wherein the second antibody molecule can be an antibody molecule chosen from, e.g., Atto-MuMab-01, Atto-MuMab-02, Atto-MuMab-03, Atto-HuMab-01, Atto-HuMab-06, or Atto-HuMab-08.
  • the second antibody molecule can be an antibody molecule chosen from, e.g., Atto-MuMab-01, Atto-MuMab-02, Atto-MuMab-03, Atto-HuMab-01, Atto-HuMab-06, or Atto-HuMab-08.
  • FIG. 28 An amino acid sequence alignment of human scFv Clone-6 (Atto-HuMab-06) and Clone- 8 (Atto-HuMab-08) is shown in FIG. 28.
  • the locations of the complementarity determining regions (CDRs) of the light and heavy chain variable regions are underlined and labeled as VL- CDR-1, -2, and -3, and VH-CDR-1, -2, and -3, respectively.
  • FIG. 38 An amino acid sequence alignment of human scFv Clone- 1 (Atto-HuMab-01) and Clone- 6 (Atto-HuMab-06) is shown in FIG. 38.
  • the locations of the complementarity determining regions (CDRs) of the light and heavy chain variable regions are underlined and labeled as VL- CDR-1, -2, and -3, and VH-CDR-1, -2, and -3, respectively.
  • CDRs complementarity determining regions
  • the nucleotide and amino acid sequence for the full length coding region of the light chain variable domain and the heavy chain variable domain of human scFv Clone 8 (Atto- HuMab-08) is shown in FIGS. 29A-29B, respectively.
  • the nucleotide and amino acid sequence of the light chain variable domain of the human scFv Clone 8 (Atto-HuMab-08) is shown in FIGS. 29C-29D, respectively.
  • the nucleotide and amino acid sequence of the heavy chain variable domain of the human scFv Clone 8 (Atto-HuMab-08) is shown in FIGS. 29E-29F, respectively.
  • FIGS. 30A-30B The nucleotide and amino acid sequence for the full length coding region of the light chain variable domain and the heavy chain variable domain of human scFv Clone 6 (Atto- HuMab-06) is shown in FIGS. 30A-30B, respectively.
  • the nucleotide and amino acid sequence, respectively, of the light chain variable domain of the human scFv Clone 6 (Atto-HuMab-06) is shown in FIGS. 30C-30D.
  • FIGS. 30E-30F The nucleotide and amino acid sequence, respectively, of the heavy chain variable domain of the human scFv Clone 6 (Atto-HuMab-06) is shown in FIGS. 30E-30F.
  • the relative location of the complementarity determining regions (CDRs) is underlined in the aforesaid Figures.
  • FIG. 35 The amino acid sequence for the light and heavy chain variable domains of Atto-MuMab- 02 is shown in FIG. 35 (SEQ ID NO: 90 and 88, respectively). The relative locations of the CDRs in the heavy and light chain variable regions are indicated in FIG. 35.
  • the nucleotide sequences encoding the heavy and light chain variable domains of Atto-MuMab-02 are shown in FIGS. 34A and 34B (SEQ ID NO: 87 and 89), respectively.
  • FIGS. 37A-37B The amino acid and nucleotide sequences for the full length coding region of the light chain variable domain and the heavy chain variable domain of human scFv Clone 1 (Atto- HuMab-01) are shown in FIGS. 37A-37B (SEQ ID NOs: 190-191), respectively.
  • the amino acid sequence of the light chain variable domain of the human scFv Clone 1 (Atto-HuMab-01) is shown in FIGS. 38-39)(corresponding to amino acids 1-111 of the upper amino acid sequence, prior to the linker region).
  • the amino acid sequence of the heavy chain variable domain of the human scFv Clone 1 (Atto-HuMab-01) is shown in FIGS.
  • FIG. 40 is a table depicting a comparison of the CDR regions (heavy and light chain CDRs) among Atto-HuMab-01, -06, and -08).
  • the anti-FGFR2-IIIc antibody molecule has one or more biological properties of any of clones clones B7 (Atto-MuMab-03), C5, D2, D10, E3, E8, F3, F10 or G9 of FIGS. 24A-24B or 32; or any of human clones 1 (Atto-HuMab-01), 2, 6 (Atto- HuMab-06), 7 or 8 (Atto-HuMab-08) of FIGS.
  • Atto-MuMab-01, Atto-MuMab-02, Atto-MuMab-03, Atto-HuMab-01, Atto-HuMab-06, or Atto-HuMab-08 including but not limited to:
  • the antibody molecule binds to the same or a similar epitope on human FGFR2-IIIc as antibody Atto-MuMab-01, Atto-MuMab-02, Atto-MuMab-03, Atto-HuMab-01, Atto-HuMab-06, or Atto-HuMab-08 (e.g., the anti- FGFR2-IIIc antibody molecule competes for binding with monoclonal antibodies Atto-MuMab-01, Atto-MuMab-02, Atto-MuMab-03, Atto-HuMab-01, Atto-HuMab-06, or Atto-HuMab-08);
  • (iii) binds preferentially to at least one amino acid residue present in human FGFR2-IIIc, but not in human FGFR2-IIIb (e.g., one, two, three, four, five, six, seven, eight, nine, ten, twelve, fourteen, sixteen, eighteen, twenty, twenty-two or more of: alanine at position 1, alanine at position 2, valine at position 4, threonine at position 6, threonine at position 7, aspartate at position 8, lysine at position 9, isoleucine at position 11, glutamate at position 12, valine at position 13, tyrosine at position 15, isoleucine at position 16, arginine at position 17,
  • AAGVNTTDKEIEVLYIRNVTFEDAGEYTCLAGNSIGISFH (SEP ID NO: 84)); or one, two, three, four, five, six or more of: threonine at position 1, leucine at position 3, alanine at position 4, glycine at position 5, serine at position 7, isoleucine at position 10, serine at position 11, phenylalanine at position 12, or histidine at position 13 of SEQ ID NO: 86 (corresponding to the highlighted amino acid residues in TCLAGNSIGISFH; SEQ ID NO: 86); (iv) binds to recombinant, synthetic or native human FGFR2-IIIc;
  • a prostate or liver cancer cell e.g., a human prostate cancer cell (e.g., DU145 human prostate cancer cell line), or liver cell line HepG2;
  • (vi) shows the same or similar binding selectivity to human FGFR2-IIIc as monoclonal antibody Atto-MuMab-01 , Atto-MuMab-02, Atto-MuMab-03, Atto-HuMab-01 , Atto-HuMab-06, or Atto-HuMab-08;
  • (vii) shows the same or similar binding affinity as monoclonal antibody Atto-MuMab-01, Atto-MuMab-02, Atto-MuMab-03, Atto-HuMab-01, Atto-HuMab-06, or Atto-HuMab-08; and/or
  • (viii) shows the same or similar binding kinetics as monoclonal antibody Atto-MuMab- 01, Atto-MuMab-02, Atto-MuMab-03, Atto-HuMab-01, Atto-HuMab-06, or Atto-HuMab-08.
  • the anti-FGFR2-IIIc antibody molecule is the monoclonal antibody
  • Atto-MuMab-01 Atto-MuMab-01, Atto-MuMab-02, Atto-MuMab-03, Atto-HuMab-01, Atto-HuMab-06, or Atto- HuMab-08.
  • the anti-FGFR2-IIIc antibody molecule binds to FGFR2-IIIc with high affinity, e.g., with a Kd less than 10 "7 M, 10 ⁇ 8 , 10 "9 , 10 "10 , 10 “11 M or better.
  • a Kd less than 10 "7 M, 10 ⁇ 8 , 10 "9 , 10 "10 , 10 "11 M or better.
  • the anti- FGFR2-IIIc antibodies or fragments thereof can reduce one or more
  • FGFR2-IIIc-associated activities with an IC50 of at least about 10 ⁇ 8 , 10 "9 , 10 "10 , 10 “11 M or better.
  • the anti- FGFR2-IIIc antibodies or fragments thereof associate with
  • SPR surface plasmon resonance
  • the affinity and binding kinetics of the anti- FGFR2-IIIc antibody or fragment thereof can be tested using, e.g., biosensor technology
  • the anti-FGFR2-IIIc antibody molecule is a full antibody or fragment thereof (e.g., a Fab, F(ab') 2 , Fv, or a single chain Fv fragment (scFv)).
  • the anti- FGFR2-IIIc antibody molecule is a monoclonal antibody or an antibody with single specificity.
  • the anti-FGFR2-IIIc antibody molecule can also be a human, humanized, chimeric, camelid, shark, or in vitro -generated antibody molecules.
  • the anti-FGFR2-IIIc antibody molecule thereof is a humanized antibody molecule.
  • the heavy and light chains of the anti-FGFR2-IIIc antibody molecule can be full-length (e.g., an antibody can include at least one, and preferably two, complete heavy chains, and at least one, and preferably two, complete light chains) or can include an antigen- binding fragment (e.g., a Fab, F(ab') 2 , Fv, a single chain Fv fragment, a single domain antibody, a diabody (dAb), a bivalent or bispecific antibody or fragment thereof, a single domain variant thereof, or a camelid antibody).
  • an antibody can include at least one, and preferably two, complete heavy chains, and at least one, and preferably two, complete light chains
  • an antigen- binding fragment e.g., a Fab, F(ab') 2 , Fv, a single chain Fv fragment, a single domain antibody, a diabody (dAb), a bivalent or bispecific antibody or fragment thereof, a single domain variant thereof, or a camelid antibody.
  • the antibody molecule has a heavy chain constant region (Fc) chosen from, e.g., the heavy chain constant regions of IgGl, IgG2, IgG3, IgG4, IgM, IgAl, IgA2, IgD, and IgE; particularly, chosen from, e.g., the heavy chain constant regions of IgGl, IgG2, IgG3, and IgG4, more particularly, the heavy chain constant region of IgGl or IgG2 (e.g., human IgGl or IgG2).
  • the heavy chain constant region is human IgGl .
  • the anti- FGFR2-IIIc antibody molecule has a light chain constant region chosen from, e.g., the light chain constant regions of kappa or lambda, preferably kappa (e.g., human kappa).
  • the constant region is altered, e.g., mutated, to modify the properties of the anti-FGFR2-IIIc antibody molecule (e.g., to increase or decrease one or more of: Fc receptor binding, antibody glycosylation, the number of cysteine residues, effector cell function, or complement function).
  • the constant region is mutated at positions 296 (M to Y), 298 (S to T), 300 (T to E), 477 (H to K) and 478 (N to F) of SEQ ID NO: 55 to alter Fc receptor binding.
  • the anti-FGFR2-IIIc is covalently linked to a cell-surface protein (e.g., phage) or soluble secreted form (e.g., scFv or fusion thereof).
  • a cell-surface protein e.g., phage
  • soluble secreted form e.g., scFv or fusion thereof.
  • the anti-FGFR2- IIIc is secreted as a single chain Fv or is fused to an Fc constant region (e.g., to form a monomeric or dimeric chain construct of a human IgGl Fc fusion).
  • the anti-FGFR2-IIIc antibody molecule comprises at least one antigen- binding region, e.g., a variable region, from an antibody chosen from, e.g., Atto-MuMab-01, Atto- MuMab-02, Atto-MuMab-03, Atto-HuMab-01, Atto-HuMab-06, or Atto-HuMab-08.
  • a variable region from an antibody chosen from, e.g., Atto-MuMab-01, Atto- MuMab-02, Atto-MuMab-03, Atto-HuMab-01, Atto-HuMab-06, or Atto-HuMab-08.
  • the anti-FGFR2-IIIc antibody molecule includes at least one, two, three or four variable regions from an antibody chosen from, e.g., Atto-MuMab-01, Atto-MuMab-02, Atto-MuMab-03, Atto- HuMab-01, Atto-HuMab-06, or Atto-HuMab-08.
  • the anti-FGFR2-IIIc antibody molecule includes at least one or two heavy chain variable regions from an antibody chosen from, e.g., Atto-MuMab-01, Atto-MuMab-02, Atto-MuMab-03, Atto-HuMab-01, Atto-HuMab-06, or Atto- HuMab-08.
  • the anti-FGFR2-IIIc antibody molecule includes at least one or two light chain variable regions from an antibody chosen from, e.g., Atto-MuMab-01, Atto-MuMab-02, Atto-MuMab-03, Atto-HuMab-01, Atto-HuMab-06, or Atto-HuMab-08.
  • the anti-FGFR2-IIIc antibody molecule includes at least one, two, or three complementarity determining regions (CDRs) from a heavy chain variable region of an antibody chosen from, e.g., Atto-MuMab-01, Atto-MuMab-02, Atto-MuMab-03, Atto-HuMab-01, Atto-HuMab-06, or Atto-HuMab-08, or at least particularly the amino acids from those CDRs that contact FGFR2-IIIc.
  • CDRs complementarity determining regions
  • the anti-FGFR2-IIIc antibody molecule includes at least one, two, or three CDRs from a light chain variable region of an antibody chosen from, e.g., Atto-MuMab-01, Atto-MuMab-02, Atto-MuMab-03, Atto- HuMab-01, Atto-HuMab-06, or Atto-HuMab-08, or at least includes the amino acids from those CDRs that contact FGFR2-IIIc.
  • the anti-FGFR2-IIIc antibody molecule includes at least one, two, three, four, five, or six CDRs from the heavy and light chain variable regions of an antibody chosen from, e.g., Atto-MuMab-01, Atto-MuMab-02, Atto-MuMab-03, Atto-HuMab-01, Atto- HuMab-06, or Atto-HuMab-08.
  • the anti-FGFR2-IIIc antibody molecule includes all six CDR's from Atto-
  • the protein may include any CDR described herein.
  • the anti-FGFR2-IIIc antibody molecule includes at least one, two, or three Chothia hypervariable loops from a heavy chain variable region of an antibody chosen from, e.g., Atto-MuMab-01, Atto-MuMab-02, Atto-MuMab-03, Atto-HuMab-01, Atto-HuMab-06, or Atto- HuMab-08, or at least particularly the amino acids from those hypervariable loops that contact FGFR2- IIIc.
  • the anti-FGFR2-IIIc antibody molecule includes at least one, two, or three hypervariable loops from a light chain variable region of an antibody chosen from, e.g., Atto-
  • MuMab-01, Atto-MuMab-02, Atto-MuMab-03, Atto-HuMab-01, Atto-HuMab-06, or Atto-HuMab-08 or at least includes the amino acids from those hypervariable loops that contact FGFR2-IIIc.
  • the anti-FGFR2-IIIc antibody molecule includes at least one, two, three, four, five, or six hypervariable loops from the heavy and light chain variable regions of an antibody chosen from, e.g., Atto-MuMab-01, Atto-MuMab-02, Atto-MuMab-03, Atto-HuMab-01, Atto-HuMab-06, or Atto- HuMab-08.
  • the anti-FGFR2-IIIc antibody molecule includes all six hypervariable loops from FGFR2-IIIc or closely related hypervariable loops, e.g., hypervariable loops which are identical or which have at least one amino acid alteration, but not more than two, three or four alterations (e.g., substitutions, deletions, or insertions, e.g., conservative substitutions).
  • the anti-FGFR2-IIIc antibody molecule may include any hypervariable loop described herein.
  • the anti-FGFR2-IIIc antibody molecule includes at least one, two, or three hypervariable loops that have the same canonical structures as the corresponding hypervariable loop of Atto-MuMab-01, Atto-MuMab-02, Atto-MuMab-03, Atto-HuMab-01, Atto-HuMab-06, or Atto- HuMab-08, e.g., the same canonical structures as at least loop 1 and/or loop 2 of the heavy and/or light chain variable domains of Atto-MuMab-01 , Atto-MuMab-02, Atto-MuMab-03, Atto-HuMab-01 , Atto- HuMab-06, or Atto-HuMab-08.
  • the light or the heavy chain variable framework ⁇ e.g., the region
  • a light or heavy chain variable framework including at least 80%, 85%, 87% 90%, 92%, 93%, 95%, 97%, 98%, or preferably 100% of the amino acid residues from a human light or heavy chain variable framework, e.g., a light or heavy chain variable framework residue from a human mature antibody, a human germline sequence, or a human consensus sequence;
  • a light or heavy chain variable framework including from 20% to 80%, 40% to 60%, 60% to 90%, or 70% to 95% of the amino acid residues from a human light or heavy chain variable framework, e.g., a light or heavy chain variable framework residue from a human mature antibody, a human germline sequence, or a human consensus sequence;
  • a non-human framework ⁇ e.g., a rodent framework
  • a non-human framework that has been modified e.g., a rodent framework
  • the light or heavy chain variable framework region (particularly FR1, FR2 and/or FR3) includes a light or heavy chain variable framework sequence at least 70, 75, 80, 85, 87, 88, 90, 92, 94, 95, 96, 97, 98, 99% identical or identical to the frameworks of a VH segment of a human germline gene.
  • the heavy or light chain variable domain of the of the anti-FGFR2-IIIc antibody molecule includes an amino acid sequence, which is at least 80%, 85%, 90%, 92%, 95%, 97%, 98%, 99% or higher identical to a variable region of an antibody described herein, e.g., Atto-MuMab-01, Atto-MuMab-02, Atto-MuMab-03, Atto-HuMab-01, Atto-HuMab-06, or Atto-HuMab-08; or which differs at least 1 or 5 residues, but less than 40, 30, 20, or 10 residues, from a variable region of an antibody described herein, e.g., Atto-MuMab-01, Atto-MuMab-02, Atto-MuMab-03, Atto-HuMab-01, Atto-HuMab-06, or Atto-HuMab-08.
  • an amino acid sequence which is at least 80%, 85%
  • the heavy or light chain variable region of the of the anti-FGFR2-IIIc antibody molecule includes an amino acid sequence encoded by a nucleic acid sequence described herein or a nucleic acid that hybridizes to a nucleic acid sequence described herein (e.g., a specific nucleic acid sequence or a nucleic acid sequence that encodes an amino acid sequence described herein) or its complement, e.g., under low stringency, medium stringency, or high stringency, or other hybridization condition described herein.
  • the anti-FGFR2-IIIc antibody molecule comprises at least one, two, three, or four antigen-binding regions, e.g., variable regions, having an amino acid sequence as set forth in FIGS.28, 29B, 29D, 29F, 30B, 30D, 30F, 35, 36A, 36B, 37A, 38, or 39, or a sequence substantially identical thereto (e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, or which differs by no more than 1, 2, 5, 10, or 15 amino acid residues from the sequences shown in FIGS. 28, 29B, 29D, 29F, 30B, 30D, 30F, 35, 36A, 36B, 37A, 38, or 39.
  • variable regions having an amino acid sequence as set forth in FIGS.28, 29B, 29D, 29F, 30B, 30D, 30F, 35, 36A, 36B, 37A, 38, or 39, or a sequence substantially identical thereto (e.g., a sequence at
  • the anti- FGFR2-IIIc antibody molecule includes a VH and/or VL domain encoded by a nucleic acid having a nucleotide sequence as set forth in FIGS. 29A, 29C, 29E, 30A, 30C, 30E, 34A, 34B, or 37B, or a sequence substantially identical thereto (e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, or which differs by no more than 3, 6, 15, 30, or 45 nucleotides from the sequences shown in FIGS. 29A, 29C, 29E, 30A, 30C, 30E, 34A, 34B, or 37B.
  • a sequence substantially identical thereto e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, or which differs by no more than 3, 6, 15, 30, or 45 nucleotides from the sequences shown in FIGS. 29A, 29C, 29E, 30A, 30C, 30E, 34A,
  • the anti-FGFR2-IIIc antibody molecule comprises at least one, two, or three CDRs from a heavy chain variable region having an amino acid sequence as set forth in FIG. 28, 29F, 30F, 35, or 38-40, or a sequence substantially homologous thereto (e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and/or having one, two, three or more
  • the anti- FGFR2-IIIc antibody molecule comprises at least one, two, or three CDRs from a light chain variable region having an amino acid sequence as set forth in FIG. 28, 29D, 30D, 35, or 38-40,, or a sequence substantially homologous thereto (e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and/or having one, two, three or more substitutions, insertions or deletions, e.g., conserved substitutions).
  • the anti- FGFR2-IIIc antibody molecule comprises at least one, two, three, four, five or six CDRs from heavy and light chain variable regions having an amino acid sequence as set forth in FIG. 28, 29D, 29F, 30D, 30F, 35, or 38-40), or a sequence substantially homologous thereto (e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and/or having one, two, three or more substitutions, insertions or deletions, e.g., conserved substitutions).
  • the anti-FGFR2-IIIc antibody molecule comprises at least one, two, or three CDRs from a heavy chain variable region having an amino acid sequence of Atto-HuMab-01 (e.g., SEQ ID NOs: 147- 149, corresponding to CDRs 1-3, respectively), Atto-HuMab-06 (e.g., SEQ ID NOs: 147, 158,159, corresponding to CDRs 1-3, respectively), or Atto-HuMab-08 (e.g., SEQ ID NOs: 147-149, corresponding to CDRs 1-3, respectively), as set forth in FIG.
  • Atto-HuMab-01 e.g., SEQ ID NOs: 147- 149, corresponding to CDRs 1-3, respectively
  • Atto-HuMab-06 e.g., SEQ ID NOs: 147, 158,159, corresponding to CDRs 1-3, respectively
  • Atto-HuMab-08 e.g., S
  • a sequence substantially homologous thereto e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and/or having one, two, three or more substitutions, insertions or deletions, e.g., conserved
  • the anti-FGFR2-IIIc antibody molecule comprises at least one, two, or three CDRs from a light chain variable region having an amino acid sequence of Atto-HuMab-01 (e.g., SEQ ID NOs: 144- 146, corresponding to CDRs 1-3, respectively), Atto-HuMab-06 (e.g., SEQ ID NOs: 155- 157, corresponding to CDRs 1-3, respectively), or Atto-HuMab-08 (e.g., SEQ ID NOs: 155, 156, 146, corresponding to CDRs 1-3, respectively), as set forth in FIG.
  • Atto-HuMab-01 e.g., SEQ ID NOs: 144- 146, corresponding to CDRs 1-3, respectively
  • Atto-HuMab-06 e.g., SEQ ID NOs: 155- 157, corresponding to CDRs 1-3, respectively
  • Atto-HuMab-08 e.g., S
  • a sequence substantially homologous thereto e.g., a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and/or having one, two, three or more substitutions, insertions or deletions, e.g., conserved
  • the anti-FGFR2-IIIc antibody molecule comprises at least one, two, or three CDRs from a heavy chain variable region having an amino acid sequence chosen from:
  • RIIPIXiG X 2 ANYAQKFQGR, wherein ⁇ is F or L, and X 2 is T or I in CDR2 (SEQ ID NO:
  • the anti-FGFR2-IIIc antibody molecule comprises at least one, two, or three CDRs from a light chain variable region having an amino acid sequence chosen from:
  • XiNN X 2 RPSG X 3 in CDR2 wherein ⁇ is S or D, X 2 is Q or K, and X 3 is V or I (SEQ ID NO: 151), or Xi X 2 WD X 3 SLX 4 X 5 VV, wherein Xi is A or G, X 2 is A or T, X 3 is D or S, X 4 is N or S, and X 5 is G or A, in CDR3 (SEQ ID NO: 152).
  • the anti-FGFR2-IIIc antibody molecule comprises:
  • RIIPIXiG X 2 ANYAQKFQGR, wherein Xi is F or L, and X 2 is T or I in CDR2 (SEQ ID NO:
  • Xi is A or G
  • X 2 is A or T
  • X 3 is D or S
  • X 4 is N or S
  • X 5 is G or A, in CDR3 (SEQ ID NO: 152).
  • the anti-FGFR2-IIIc antibody molecule comprises all six CDRs
  • the invention also features nucleic acids comprising nucleotide sequences that encode heavy and light chain variable regions and CDRs of the anti- FGFR2-IIIc antibody molecules, as described herein.
  • the invention features a first and second nucleic acid encoding heavy and light chain variable regions, respectively, of an anti- FGFR2-IIIc antibody molecule chosen from one or more of, e.g., Atto-MuMab-01, Atto- MuMab-02, Atto-MuMab-03, Atto-HuMab-01, Atto-HuMab-06, or Atto-HuMab-08, as
  • the nucleic acid can comprise a nucleotide sequence as set forth in Figures 29A, 29C, 29E, 30A, 30C, 30E, 34A, 34B, or 37B, or a sequence substantially
  • the nucleic acid can comprise a nucleotide sequence encoding at least one, two, or three CDRs from a heavy chain variable region having an amino acid sequence as set forth in FIG. 28, 29F, 30F, 35, or 38- 40, or a sequence substantially homologous thereto (e.g. , a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and/or having one, two, three or more substitutions, insertions or deletions, e.g. , conserved substitutions).
  • the nucleic acid can comprise a nucleotide sequence encoding at least one, two, or three CDRs from a light chain variable region having an amino acid sequence as set forth in FIG. 28, 29D, 30D, 35, or 38-40, or a sequence substantially homologous thereto (e.g. , a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and/or having one, two, three or more substitutions, insertions or deletions, e.g. , conserved substitutions).
  • the nucleic acid can comprise a nucleotide sequence encoding at least one, two, three, four, five, or six CDRs from heavy and light chain variable regions having an amino acid sequence as set forth in FIG. 28, 29D, 29F, 30D, 30F, 35, or 38-40, or a sequence substantially homologous thereto (e.g. , a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, and/or having one, two, three or more substitutions, insertions or deletions, e.g. , conserved substitutions).
  • the application features host cells and vectors containing the nucleic acids described herein.
  • the nucleic acids may be present in a single vector or separate vectors present in the same host cell or separate host cell.
  • the epitope of FGFR2-IIIc e.g., human FGFR2-IIIc, recognized by one or more of, e.g., Atto-MuMab-01 or Atto-MuMab-02, is featured.
  • the epitope of the anti- FGFR2-IIIc antibody molecule includes at least one amino acid residue of 314-353 of FGFR2 IIIc (AAGVNTTDKEIEVLYIRNVTFEDAGEYTCLAGNSIGISFH (SEP ID NO: 84)); or at least one amino acid residue of TCLAGNS IGIS FH (SEQ ID NO: 86).
  • the epitope of human FGFR2-IIIc comprises one, two, three, four, five, six, seven, eight, nine, ten, twelve, fourteen, sixteen, eighteen, twenty, twenty-two or more of: alanine at position 1, alanine at position 2, valine at position 4, threonine at position 6, threonine at position 7, aspartate at position 8, lysine at position 9, isoleucine at position 11, glutamate at position 12, valine at position 13, tyrosine at position 15, isoleucine at position 16, arginine at position 17,
  • SEQ ID NO: 84 (corresponding to the highlighted amino acid residues in AAGVNTTDKEIEVLYIRNVTFEDAGEYTCLAGNSIGISFH (SEP ID NO: 84)); or one or more of: threonine at position 1, leucine at position 3, alanine at position 4, glycine at position 5, serine at position 7, isoleucine at position 10, serine at position 11, phenylalanine at position 12, or histidine at position 13 of SEQ ID NO: 86 (corresponding to the highlighted amino acid
  • the antibody molecule inhibits, reduces or neutralizes one or more activities of the isoforms, e.g., oncogenic isoforms, in a hyperproliferative (e.g., cancerous or tumor) cell and/or tissue.
  • a hyperproliferative e.g., cancerous or tumor
  • the antibody molecule may selectively and specifically reduce or inhibit an oncogenic isoform-associated activity chosen from one or more of: (i) binding of a ligand or co-receptor (e.g., FGF ligand (e.g., FGF8b, FGF2, FGF17 or FGF18)) to FGFR2 isoform IIIc); (ii) receptor dimerization (e.g., FGFR2 isoform IIIc dimerization); (iii) receptor signaling, e.g., FGFR2 isoform IIIc signaling; (iv) hyperproliferative (e.g., cancerous or tumor) cell proliferation, growth and/or survival, for example, by induction of apoptosis of the hyperproliferative cell; and/or (v) angiogenesis and/or vascularization of a tumor.
  • the antibody molecule is conjugated to one or more cytotoxic or cytostatic agents or moieties, e.g., a
  • the conjugated antibody molecule Upon binding of the conjugated antibody molecule to an epitope located on an exon sequence or a junctional region predominantly expressed and/or associated with one or more cancerous or tumor cells or disorders (e.g., an epitope as described herein), the conjugated antibody molecule selectively targets or delivers the cytotoxic or cytostatic agent to the hyperproliferative (e.g., cancerous or tumor) cell and/or tissue.
  • a biological protein e.g., a protein toxin
  • a particle e.g., a recombinant viral particle, e.g., via a viral coat protein.
  • the antibody molecule can be used alone in unconjugated form to thereby reduce an activity (e.g., cell growth or proliferation) and/or kill the hyperproliferative (e.g., cancerous or tumor) cell and/or tissue by, e.g., antibody-dependent cell killing mechanisms, such as complement-mediated cell lysis and/or effector cell-mediated cell killing.
  • the antibody molecule can disrupt a cellular interaction, e.g., binding of the isoform, e.g., the oncogenic isoform, to a cognate receptor or ligand, thereby reducing or blocking the activity of the hyperproliferative (e.g., cancerous or tumor) cell and/or tissue.
  • the antibody molecule that selectively binds to exon IIIc of FGFR2 can reduce or inhibit the interaction of FGFR2 isoform IIIc to one or more of its ligands, e.g., one or more of: FGF8b, FGF2, FGF17 or FGF18, thus reducing the proliferation and/or survival of FGFR2 isoform Illc-expressing cells.
  • the antibody molecules, soluble or fusion proteins, peptides, and nucleic acid inhibitors described herein can be functionally linked or derivatized (e.g., by chemical coupling, genetic fusion, non-covalent association or otherwise) to one or more other molecular entities, such as an antibody (e.g., a bispecific or a multispecific antibody), toxins, radioisotopes, cytotoxic or cytostatic agents, a label, among others.
  • the antibody molecules, soluble or fusion proteins, peptides, and nucleic acid inhibitors described herein can be coupled to a label, such as a fluorescent label, a biologically active enzyme label, a radioisotope (e.g., a radioactive ion), a nuclear magnetic resonance active label, a luminescent label, or a chromophore.
  • a label such as a fluorescent label, a biologically active enzyme label, a radioisotope (e.g., a radioactive ion), a nuclear magnetic resonance active label, a luminescent label, or a chromophore.
  • the antibody molecules, soluble or fusion proteins and peptides described herein can be coupled to a therapeutic agent, e.g., a cytotoxic moiety (e.g., a therapeutic drug; a radioisotope: molecules of plant, fungal, or bacterial origin: or biological proteins (e.g., protein toxins); or particles (e.g., recombinant viral particles, e.g., via a viral coat protein); or mixtures thereof.
  • the therapeutic agent can be an intracellularly active drug or other agent, such as short-range radiation emitters, including, for example, short-rage, high-energy a-emitters, as described herein.
  • the antibody molecules, soluble or fusion proteins and peptides described herein can be coupled to a molecule of plant or bacterial origin (or derivative thereof), e.g., a maytansinoid, a taxane, or a
  • a radioisotope can be an ⁇ -, ⁇ -, or ⁇ -emitter, or an ⁇ -and ⁇ -emitter. Radioisotopes
  • Y yttrium
  • Lu lutetium
  • Ac actinium
  • Radioisotopes useful as labels include iodine ( I or I, indium ( l u In), technetium (“ mTc), phosphorus ( 32 P), carbon ( 14 C), and tritium ( 3 H).
  • I or I indium ( l u In)
  • mTc technetium
  • phosphorus 32 P
  • carbon 14 C
  • tritium 3 H
  • the antibody molecules, soluble or fusion proteins and peptides described herein can also be linked to another antibody to form, e.g., a bispecific or a multispecific antibody.
  • compositions e.g., pharmaceutically acceptable salts, e.g., pharmaceutically acceptable salts, and pharmaceutically acceptable salts.
  • compositions which include a pharmaceutically acceptable carrier, excipient or stabilizer, and at least one of the isoform-specific inhibitors described herein.
  • the isoform- specific inhibitor is conjugated to a label or a therapeutic agent.
  • the compositions e.g., the pharmaceutical compositions, comprise a combination of two or more of the aforesaid the isoform-specific inhibitors, or different antibody molecules.
  • a composition, e.g., pharmaceutical composition which comprises an isoform-specific inhibitor as described herein, in combination with other growth factor inhibitors, such as antibodies against FGF 1-23, FGF receptors 1-4, VEGF, EGF or EGF receptor, PSMA antibody, or Her-2/neu, etc.
  • Combinations of an isoform- specific inhibitor and a drug e.g., a therapeutic agent (e.g. , a
  • cytototoxic or cytostatic drug e.g., DM1, calicheamicin, or taxanes
  • an immunomodulatory agent e.g., IL- 1, 2, 4, 6, or 12, interferon alpha or gamma, or immune cell growth factors such as GM-CSF
  • the invention also features nucleic acid sequences that encode the isoform-binding
  • the invention features, a first and
  • nucleic acids comprising nucleotide sequences encoding the soluble receptors, fusions, peptides and
  • the invention features host cells and vectors containing the nucleic acids of the invention.
  • the host cell can be a eukaryotic cell, e.g. , a mammalian cell, an insect cell, a yeast cell, or a prokaryotic cell, e.g. , E. coli.
  • a eukaryotic cell e.g. , a mammalian cell, an insect cell, a yeast cell, or a prokaryotic cell, e.g. , E. coli.
  • the mammalian cell can be a cultured cell or a cell line.
  • exemplary mammalian cells include lymphocytic cell lines (e.g., NSO), Chinese hamster ovary cells (CHO), COS cells,
  • oocyte cells and cells from a transgenic animal, e.g., mammary epithelial cell.
  • a transgenic animal e.g., mammary epithelial cell.
  • nucleic acids encoding the isoform binding molecule described herein can be expressed in a transgenic animal, e.g., mammary epithelial cell.
  • the nucleic acids are placed under the control of a tissue-specific promoter (e.g., a mammary specific promoter) and the antibody is produced in the tissue-specific promoter (e.g., a mammary specific promoter) and the antibody is produced in the tissue-specific promoter (e.g., a mammary specific promoter) and the antibody is produced in the tissue-specific promoter (e.g., a mammary specific promoter) and the antibody is produced in the
  • the isoform binding molecule is secreted into the milk of the transgenic animal, such as a transgenic cow, pig, horse, sheep, goat or rodent.
  • the invention features a method of providing an isoform binding antibody molecule that specifically binds to an isoform (e.g., an oncogenic isoform) polypeptide.
  • the method includes: providing a isoform-specific antigen (e.g., an antigen comprising at least a portion of an epitope as described herein); obtaining an antibody molecule that specifically binds to the isoform polypeptide; and evaluating if the antibody molecule specifically binds to the isoform polypeptide (e.g., evaluating if there is a decrease in binding between the antibody molecule and the isoform polypeptide in the present of one or more of the epitopes described herein), or evaluating efficacy of the antibody molecule in modulating, e.g., inhibiting, the activity of the isoform (e.g., an oncogenic isoform) polypeptide.
  • the method can further include administering the antibody molecule to a subject, e.g., a human or non-human
  • Isoform-specific epitopes e.g., isolated epitopes, as described herein are also provided.
  • the epitopes can be linear or conformational protein of the isoform (e.g., oncogenic) isoform, e.g., from about 2 to 80, about 4 to 75, about 5 to 70, about 10 to 60, about 10 to 50, about 10 to 40, about 10 to 30, about 10 to 20, amino acid
  • the epitope consists of, or includes, an amino acid sequence located at the junctional region between two exons that are predominantly joined together in protein isoforms expressed or associated with one or more cancerous or tumor cells or disorders, e.g., as a result of an in-frame exon deletion or the use of an alternatively spliced exon.
  • the epitope can consist of, or include, an amino acid sequence identical to the
  • the epitope of FGFR2-IIIc e.g., human FGFR2-IIIc, can include or consist of at least one amino acid residue of 314-353 of
  • the epitope of human FGFR2-IIIc comprises one, two, three, four, five, six, seven, eight, nine, ten, twelve, fourteen, sixteen, eighteen, twenty, twenty-two or more of: alanine at position 1, alanine at position 2, valine at position 4, threonine at position 6, threonine at position 7,
  • AAGVNTTDKEIEVLYIRNVTFEDAGEYTCLAGNSIGISFH (SEP ID NO: 84)); or one or more of: threonine at position 1, leucine at position 3, alanine at position 4, glycine at position 5, serine at position 7, isoleucine at position 10, serine at position 11, phenylalanine at position 12, or histidine at position 13 of SEQ ID NO: 86 (corresponding to the highlighted amino acid residues in TCLAGNSIGISFH; SEQ ID NO: 86).
  • the invention also features a method of reducing the activity (e.g., cell growth or proliferation), or inducing the killing (e.g., inducing apoptosis of), a hyperproliferative cell, e.g., a cancerous or tumor cell (e.g., a cancerous or tumor cell expressing an oncogenic isoform, such as FGFR2-IIIC and exon deleted-isoforms of FGFR1, RON, ⁇ , PDGF and PDGFR-alpha, as described herein).
  • a hyperproliferative cell e.g., a cancerous or tumor cell (e.g., a cancerous or tumor cell expressing an oncogenic isoform, such as FGFR2-IIIC and exon deleted-isoforms of FGFR1, RON, ⁇ , PDGF and PDGFR-alpha, as described herein).
  • the method includes contacting the hyperproliferative cell, or a cell (e.g., a vascular cell) in proximity to the hyperproliferative cell, with one or more isoform-specific inhibitors as described herein, e.g., an isoform-specific antibody molecule described herein, in an amount sufficient to reduce the expression or activity of the isoform, e.g., the oncogenic isoform, thereby reducing the activity of, or killing, the hyperproliferative cell.
  • one or more isoform-specific inhibitors as described herein, e.g., an isoform-specific antibody molecule described herein
  • the isoform-specific inhibitors as described herein can be used in conjugated or unconjugated form, alone as a monotherapy or in combination with one or more therapeutic agents, to thereby kill, or reduce the activity, e.g., inhibit cell growth of, the hyperproliferative cell.
  • the isoform-binding molecule is an antibody molecule that specifically binds to FGFR2-IIIc, e.g., an antibody molecule that specifically binds to an amino acid sequence identical to the alternative spliced form of Exon III, e.g., from about amino acids 301 to 360 of FGFR2-IIIC (SEQ ID NO:2); about amino acids 314 to 324 of FGFR2-IIIc
  • YIRNVTFEDA SEQ ID NO:6
  • amino acids 350 to 353 of FGFR2-IIIc ISFH, SEQ ID NO:8
  • amino acid sequence encoded by a nucleotide sequence of SEQ ID NOs: 1, 3, 5 or 7 or an amino acid or nucleotide sequence substantially identical thereto.
  • the hyperproliferative cell is a cancerous or tumor cell from the prostate, breast, pancreas, ovary, brain (glioblastoma), gastric cancers, lung squamous cell carcinoma, non-small cell lung carcinoma, thyroid cancer, endometrial carcinoma, hematopoietic cancers, and skeletal disorders, such as craniofacial dysostosis 1, Crouzon syndrome, Pfeiffer syndrome, Jackson-Weiss syndrome and Apert syndrome.
  • hyperproliferative cells e.g., cancerous or metastatic cells (e.g., prostatic, renal, urothelial (e.g., bladder), testicular, ovarian, breast, colon, rectal, lung (e.g., non-small cell lung carcinoma), liver, brain, neural (e.g., neuroendocrine), glial (e.g., glioblastoma), pancreatic, melanoma (e.g., malignant melanoma), or soft tissue sarcoma cancerous or metastatic cells) can be cultured in vitro in culture medium and the contacting step can be effected by adding the isoform binding molecule, to the culture medium.
  • the method can be performed on
  • hyperproliferative cells present in a subject as part of an in vivo (e.g., therapeutic or
  • Methods of the invention can be used, for example, to treat or prevent a
  • hyperproliferative disorder e.g., a cancer (primary, recurring or metastasizing) of, e.g. prostate, breast, pancreas and brain (glioblastoma), by administering to a subject an isoform- specific inhibitor described herein, in an amount effective to treat or prevent such disorder.
  • the cancer is an adenocarcinoma or carcinoma of the prostate and/or testicular tumors.
  • the cancer is hormone-resistant or refractory prostate cancer.
  • the cancer is an androgen-resistant or refractory prostate cancer associated with elevated expression of FGFR2-IIIc.
  • the cancer shows elevated level or expression of FGFR2-IIIc protein or mRNA compared to a reference value (e.g., a non-cancerous prostatic tissue), optionally, accompanied by a reduction in one or more epithelial markers (e.g., reduction in the level or expression of epithelial cell surface adhesion molecules (Ep-CAM) and/or gain of mesenchymal markers.
  • a reference value e.g., a non-cancerous prostatic tissue
  • epithelial markers e.g., reduction in the level or expression of epithelial cell surface adhesion molecules (Ep-CAM) and/or gain of mesenchymal markers.
  • the cancer is a metastatic cancer showing elevated levels of prostate-derived circulating tumor cells (e.g., prostate-derived circulating FGFR2IIIc-expressing prostatic tumor cells).
  • Methods and compositions disclosed herein are particularly useful for treating metastatic lesions associated with prostate cancer.
  • the patient will have undergone one or more of prost
  • the cancer treated with the isoform-specific inhibitor(s) described herein includes, but is not limited to, solid tumors, soft tissue tumors, and metastatic lesions.
  • solid tumors include malignancies, e.g., sarcomas, adenocarcinomas, and carcinomas, of the various organ systems, such as those affecting lung, breast, lymphoid, gastrointestinal (e.g., colon), genitals and genitourinary tract (e.g., renal, urothelial, bladder cells), pharynx, CNS (e.g., brain, neural or glial cells), skin (e.g., melanoma), and pancreas, as well as adenocarcinomas which include malignancies such as most colon cancers, rectal cancer, renal-cell carcinoma, liver cancer, non-small cell-carcinoma of the lung, cancer of the small intestine and cancer of the esophagus.
  • malignancies e.g., s
  • Methods and compositions disclosed herein are particularly useful for treating metastatic lesions associated with the aforementioned cancers.
  • the patient will have undergone one or more of surgical removal of a tissue, chemotherapy, or other anti-cancer therapy and the primary or sole target will be metastatic lesions, e.g., metastases in the bone marrow or lymph nodes.
  • metastatic lesions e.g., metastases in the bone marrow or lymph nodes.
  • a reduction in expression or activity of an FGFR2-IIIc oncogenic isoform can be used to prevent and/or treat hormone-refractory prostate cancer, breast cancer, bladder cancer, thyroid cancer, or other form of cancer.
  • the subject is treated to prevent a hyperproliferative disorder, e.g., a hyperproliferative disorder as described herein.
  • the subject can be a mammal, e.g., a primate, preferably a higher primate, e.g., a human (e.g., a patient having, or at risk of, a
  • the subject is a patient having prostate cancer (e.g., a patient suffering from recurrent or metastatic prostate cancer).
  • the subject can be one at risk for the disorder, e.g., a subject having a relative afflicted with the disorder, e.g., a subject with one or more of a grandparent, parent, uncle or aunt, sibling, or child who has or had the disorder, or a subject having a genetic trait associated with risk for the disorder.
  • the subject can be symptomatic or asymptomatic.
  • the subject can suffer from symptomatic or asymptomatic prostatic cancer, e.g., hormone -resistant or refractory prostate cancer.
  • the subject suffers from metastatic prostate cancer.
  • the subject has elevated levels of prostate-derived circulating tumor cells (e.g., prostate-derived circulating FGFR2IIIc-expressing prostatic tumor cells).
  • the subject has abnormal levels of one or more markers for a cancer, e.g., prostatic cancer.
  • the subject has abnormal levels of prostate-specific antigen (PSA), prostate specific membrane antigen (PSMA), prostate stem cell antigen (PSCA), androgen receptor (AR), chromogranin, synaptophysin, MIB-1, and/or cc-methylacyl-CoA racemase (AMACR).
  • PSA prostate-specific antigen
  • PSMA prostate specific membrane antigen
  • PSCA prostate stem cell antigen
  • AR rogen receptor
  • chromogranin chromogranin
  • synaptophysin MIB-1
  • MIB-1 cc-methylacyl-CoA racemase
  • the isoform- specific inhibitors described herein can be administered to the subject systemically (e.g., orally, parenterally, subcutaneously, intravenously, rectally, intramuscularly, intraperitoneally, intranasally, transdermally, or by inhalation or intracavitary installation), topically, or by application to mucous membranes, such as the nose, throat and bronchial tubes.
  • the methods of the invention can further include the step of monitoring the subject, e.g., for a change (e.g., an increase or decrease) in one or more of: tumor size; levels of a cancer marker (e.g., level or expression of FGFR2IIIc; levels of circulating prostate-derived FGFR2IIIc-expressing cells, epithelial cell markers (Ep-CAM), FGF ligands (e.g., FGF8), stromal derived factor a (SDFa), VEGF (e.g., VEGF121), mesenchymal markers, PSA, PSMA, PSCA, AR, chromogranin, synaptophysin, MIB- 1, AMACR, alkaline phosphatase, and/or serum hemoglobin for a patient with prostate cancer); the rate of appearance of new lesions, e.g., in a bone scan; the appearance of new disease-related symptoms; the size of soft tissue mass,
  • a cancer marker e.g., level or
  • the subject can be monitored in one or more of the following periods: prior to beginning of treatment; during the treatment; or after one or more elements of the treatment have been administered. Monitoring can be used to evaluate the need for further treatment with the same isoform-binding molecule or for additional treatment with additional agents. Generally, a decrease in one or more of the parameters described above is indicative of the improved condition of the subject, although with serum hemoglobin levels, an increase can be associated with the improved condition of the subject.
  • the methods of the invention can further include the step of analyzing a nucleic acid or protein from the subject, e.g., analyzing the genotype of the subject.
  • a nucleic acid encoding the isoform e.g., the oncogenic isoform, and/or an upstream or downstream component(s) of the isoform signaling, e.g., an extracellular or intracellular activator or inhibitor of the isoform, is analyzed.
  • the analysis can be used, e.g., to evaluate the suitability of, or to choose between alternative treatments, e.g., a particular dosage, mode of delivery, time of delivery, inclusion of adjunctive therapy, e.g., administration in combination with a second agent, or generally to determine the subject's probable drug response phenotype or genotype.
  • the nucleic acid or protein can be analyzed at any stage of treatment, but preferably, prior to administration of the isoform- specific inhibitor to thereby determine appropriate dosage(s) and treatment regimen(s) of the isoform- specific inhibitor (e.g., amount per treatment or frequency of treatments) for prophylactic or therapeutic treatment of the subject.
  • the isoform-specific inhibitor e.g., the isoform- specific binding agent
  • the isoform-specific inhibitor can be used alone in unconjugated form to thereby reduce the activity or induce the killing of the isoform- expressing hyperproliferative or cancerous cells by, e.g., antibody-dependent cell killing mechanisms such as complement-mediated cell lysis and/or effector cell-mediated cell killing.
  • the isoform- specific inhibitor can be bound to a substance, e.g., a cytotoxic agent or moiety (e.g., a therapeutic drug; a compound emitting radiation; molecules of plant, fungal, or bacterial origin; or a biological protein (e.g., a protein toxin) or particle (e.g., a recombinant viral particle, e.g., via a viral coat protein).
  • a cytotoxic agent or moiety e.g., a therapeutic drug; a compound emitting radiation; molecules of plant, fungal, or bacterial origin; or a biological protein (e.g., a protein toxin) or particle (e.g., a recombinant viral particle, e.g., via a viral coat protein).
  • the isoform- specific inhibitor can be coupled to a radioactive isotope such as an ⁇ -, ⁇ -, or ⁇ -emitter, or a ⁇ -and ⁇ - emitter.
  • the isoform- binding molecule can be coupled to a biological protein, a molecule of plant or bacterial origin (or derivative thereof), e.g., a maytansinoid (e.g., maytansinol or DM1), as well as a taxane (e.g., taxol or taxotere), or calicheamicin.
  • a maytansinoid e.g., maytansinol or DM1
  • a taxane e.g., taxol or taxotere
  • calicheamicin e.g., calicheamicin.
  • the maytansinoid can be, for example, maytansinol or a maytansinol analogue.
  • examples of maytansinol analogues include those having a modified aromatic ring (e.g., C- 19-decloro, C-20-demethoxy, C-20-acyloxy) and those having
  • the calicheamicin can be, for example, a bromo-complex calicheamicin (e.g., an alpha, beta or gamma bromo-complex), an iodo-complex calicheamicin (e.g., an alpha, beta or gamma iodo-complex), or analogs and mimics thereof.
  • a bromo-complex calicheamicin e.g., an alpha, beta or gamma bromo-complex
  • an iodo-complex calicheamicin e.g., an alpha, beta or gamma iodo-complex
  • analogs and mimics thereof e.g., an alpha, beta or gamma iodo-complex
  • Bromo-complex calicheamicins include a i-BR, a 2 -BR, a 3 -BR, (X4-BR, ⁇ -BR, p 2 -BR and y ⁇ BR.
  • Iodo-complex calicheamicins include l, a 2 -I, a 3 -I, ⁇ - ⁇ , ⁇ 2 - ⁇ , ⁇ - ⁇ and BR.
  • Calicheamicin and mutants, analogs and mimics thereof are described, for example, in U.S. Pat. No. 4,970, 198, issued Nov. 13, 1990, U.S. Pat. No. 5,264,586, issued Nov. 23, 1993, U.S. Pat. No. 5,550, 246, issued Aug.
  • Maytansinol can be coupled to antibodies using, e.g., an N-succinimidyl 3-(2- pyridyldithio)proprionate (also known as N-succinimidyl 4-(2-pyridyldithio)pentanoate or SPP), 4-succinimidyl-oxycarbonyl-a-(2-pyridyldithio)-toluene (SMPT), N-succinimidyl-3-(2- pyridyldithio)butyrate (SDPB), 2-iminothiolane, or S-acetylsuccinic anhydride.
  • N-succinimidyl 3-(2- pyridyldithio)proprionate also known as N-succinimidyl 4-(2-pyridyldithio)pentanoate or SPP
  • SPP 4-succinimidyl-oxycarbonyl-a-
  • the methods and compositions of the invention can be used in combination with other therapeutic modalities.
  • the methods of the invention include administering to the subject an isoform- specific inhibitor as described herein, in combination with a cytotoxic agent, in an amount effective to treat or prevent said disorder.
  • the binding molecule and the cytotoxic agent can be administered simultaneously or sequentially.
  • the methods and compositions of the invention are used in combination with surgical and/or radiation procedures.
  • the methods can be used in combination with immunodulatory agents, e.g., IL- 1, 2, 4, 6, or 12, or interferon alpha or gamma, or immune cell growth factors such as GM-CSF.
  • Exemplary cytotoxic agents that can be administered in combination with the isoform-specific inhibitor include antimicrotubule agents, topoisomerase inhibitors, antimetabolites, mitotic inhibitors, alkylating agents, intercalating agents, agents capable of interfering with a signal transduction pathway, agents that promote apoptosis and radiation.
  • the isoform-specific inhibitor can be used in combination with existing therapeutic modalities, e.g., prostatectomy (partial or radical), radiation therapy, hormonal therapy, androgen ablation therapy, and cytotoxic chemotherapy.
  • existing therapeutic modalities e.g., prostatectomy (partial or radical), radiation therapy, hormonal therapy, androgen ablation therapy, and cytotoxic chemotherapy.
  • hormonal therapy works to reduce the levels of androgens in a patient, and can involve administering a leuteinizing hormone-releasing hormone (LHRH) analog or agonist (e.g., Lupron, Zoladex, leuprolide, buserelin, or goserelin), as well as antagonists (e.g., Abarelix).
  • LHRH leuteinizing hormone-releasing hormone
  • Non-steroidal anti-androgens e.g., flutamide, bicalutimade, or nilutamide
  • hydrocortisone prednisone, or dexamethasone
  • ketoconazole and/or aminogluthethimide
  • inhibitors of 5a-reductase e.g., finisteride
  • herbal preparations e.g., PC-SPES
  • hormonal therapy can be performed intermittently or using combinations of any of the above treatments, e.g., combined use of leuprolide and flutamide.
  • the isoform-specific inhibitor and other therapeutic modalities can be administered during periods of active disorder, or during a period of remission or less active disease.
  • the isoform- specific inhibitor and other therapeutic modalities can be administered before treatment, concurrently with treatment, posttreatment, or during remission of the disorder.
  • the invention features methods for detecting the presence of an isoform (e.g., an oncogenic isoform as described herein) polypeptide or gene expression product in a sample in vitro (e.g., a biological sample, e.g., serum, semen or urine, or a tissue biopsy, e.g., from a hyperproliferative or cancerous lesion).
  • a sample in vitro e.g., a biological sample, e.g., serum, semen or urine, or a tissue biopsy, e.g., from a hyperproliferative or cancerous lesion.
  • the subject method can be used to evaluate (e.g., monitor treatment or progression of, diagnose and/or stage a disorder described herein, e.g., a hyperproliferative or cancerous disorder, in a subject).
  • the method includes: (i) contacting the sample (and optionally, a reference, e.g., a control sample) with an isoform binding molecule (e.g., an antibody molecule), as described herein, under conditions that allow interaction of the isoform binding molecule and the polypeptide or gene expression product to occur, and (ii) detecting formation of a complex between the isoform binding molecule, and the sample (and optionally, the reference, e.g., control, sample). Formation of the complex is indicative of the presence of the polypeptide or gene expression product, and can indicate the suitability or need for a treatment described herein.
  • an isoform binding molecule e.g., an antibody molecule
  • a statistically significant change in the formation of the complex in the sample relative to the reference sample, e.g., the control sample, is indicative of the presence of the isoform, e.g., the oncogenic isoform, in the sample.
  • the methods can include the use of more than one isoform-binding molecules, e.g., two antibody molecules that bind to different epitopes on the same oncogenic isoform (e.g., FGFR2 isoform IIIc) or different oncogenic isoform.
  • the method can involve an immunohistochemistry, immunocytochemistry, FACS, antibody molecule complexed magnetic beads, ELISA assays, PCR-techniques (e.g., RT-PCR), e.g. , as described in the appended Examples.
  • the invention provides a method for detecting the presence of an isoform (e.g., an oncogenic isoform as described herein) polypeptide or gene expression product in vivo (e.g., in vivo imaging in a subject).
  • the method can be used to evaluate (e.g., monitor treatment or progression of, diagnose and/or stage a disorder described herein, e.g., a
  • the method includes: (i) administering to a subject an isoform binding molecule (e.g., an antibody molecule as described herein), under conditions that allow interaction of the isoform binding molecule and the polypeptide or gene expression product to occur; and (ii) detecting formation of a complex between the isoform binding molecule and the polypeptide or gene expression product.
  • an isoform binding molecule e.g., an antibody molecule as described herein
  • a method of evaluating e.g., monitoring treatment or progression of, diagnosing and/or staging a hyperproliferative or cancerous disorder as described herein, in a subject.
  • the method includes: (i) identifying a subject having, or at risk of having, the disorder, (ii) obtaining a sample of a tissue or cell affected with the disorder, (iii) contacting said sample or a control sample with an isoform binding molecule as described herein, e.g., an antibody molecule as described herein, under conditions that allow an interaction of the binding molecule and the isoform polypeptide or gene product to occur, and (iv) detecting formation of a complex.
  • a statistically significant increase in the formation of the complex with respect to a reference sample, e.g., a control sample is indicative of the disorder or the stage of the disorder.
  • the isoform binding molecule used in the in vivo and in vitro diagnostic methods is directly or indirectly labeled with a detectable substance to facilitate detection of the bound or unbound binding agent.
  • detectable substances include various biologically active enzymes, prosthetic groups, fluorescent materials, luminescent materials, paramagnetic (e.g., nuclear magnetic resonance active) materials, and radioactive materials.
  • the isoform binding molecule is coupled to a radioactive ion, e.
  • the detection/diagnostic methods described herein can further include the step of monitoring the subject, e.g., for a change (e.g., an increase or decrease) in one or more of: tumor size; levels of a cancer marker (e.g., level or expression of FGFR2IIIc; levels of circulating prostate-derived FGFR2IIIc-expressing cells, epithelial cell markers (Ep-CAM), FGF ligands (e.g., FGF8), stromal derived factor alpha (SDFalpha, VEGF (e.g., VEGF121), mesenchymal markers, PSA, PSMA, PSCA, AR, chromogranin, synaptophysin, MIB-1, AMACR, alkaline phosphatase, and/or serum hemoglobin for a patient with prostate cancer); the rate of appearance of new lesions, e.g., in a bone scan; the appearance of new disease-related symptoms; the size of soft tissue mass, e.g., a
  • Monitoring can be used to evaluate the need for further treatment with the same isoform-binding molecule or for additional treatment with additional agents. Generally, a decrease in one or more of the parameters described above is indicative of the improved condition of the subject,
  • the invention features diagnostic or therapeutic kits that include the isoform-specific inhibitors described herein and instructions for use.
  • the articles “a” and “an” refer to one or to more than one (e.g., to at least one) of the grammatical object of the article.
  • proteins and “polypeptides” are used interchangeably herein.
  • “About” and “approximately” shall generally mean an acceptable degree of error for the quantity measured given the nature or precision of the measurements. Exemplary degrees of error are within 20 percent (%), typically, within 10%, and more typically, within 5% of a given value or range of values.
  • FIG. 1 depicts the isoform structure of FGFR2 receptor tyrosine kinase. Top: Isoform Illb is expressed on normal prostate epithelial cells. Bottom: Isoform IIIc is expressed in hormone- refractory prostate cancer.
  • FIG. 2 depicts the sequence alignment of IIIc (SEQ ID NO: 2) and Illb isoforms (SEQ ID NO: 65).
  • FIG. 3 A depicts the amino acid sequence of human FGFR2 IIIc (SEQ ID NO: 19).
  • FIG. 3B depicts the nucleotide sequence of human FGFR2 IIIc (SEQ ID NO: 20).
  • FIG. 4A depicts the nucleotide sequence of FGFR2 Exon-IIIc (SEQ ID NO: 1).
  • FIG. 4B depicts the nucleotide sequence of FGFR2 Exon-IIIb (SEQ ID NO: 64).
  • FIG. 5A depicts the amino acid (SEQ ID NO: 4) and nucleotide (SEQ ID NO: 3) sequences of peptide IIIc-314.
  • FIG. 5B depicts the amino acid (SEQ ID NO: 6) and nucleotide (SEQ ID NO: 5) sequences of peptide IIIc-328.
  • FIG. 5C depicts the amino acid (SEQ ID NO: 8) and nucleotide (SEQ ID NO: 7) sequences of peptide IIIc-350.
  • FIG. 6A depicts the amino acid (SEQ ID NO: 56) and nucleotide (SEQ ID NO: 60) sequences of Illb (Loop3-C) fragment: amino acids 314-351.
  • FIG. 6B depicts the amino acid (SEQ ID NO: 57) and nucleotide (SEQ ID NO: 61) sequences of Illb epitope: amino acids 314-328.
  • FIG. 6C depicts the amino acid (SEQ ID NO: 58) and nucleotide (SEQ ID NO: 62) sequences of Illb epitope: amino acids 340-351.
  • FIG. 7 depicts the isoform structure of FGFR1.
  • FIG. 8 depicts the nucleotide (SEQ ID NO: 9) and amino acid (SEQ ID NO: 10) sequences of FGFR1L epitope sequence at the junction.
  • FIG. 9 depicts the nucleotide (SEQ ID NO: 11) and amino acid (SEQ ID NO: 12) sequences of RONA160 epitope at the junction between exon 4 and exon 7.
  • FIG. 10 depicts the nucleotide (SEQ ID NO: 13) and amino acid (SEQ ID NO: 14) sequences of the epitope designed for antibody targeting KIT isoform.
  • FIG. 11 depicts the nucleotide (SEQ ID NO: 15) and amino acid (SEQ ID NO: 16) sequences of the epitope designed for antibody targeting PDGF isoform.
  • FIG. 12 depicts the nucleotide (SEQ ID NO: 17) and amino acid (SEQ ID NO: 18) sequences of the epitope of PDGFR-alpha isoform.
  • FIG. 13A depicts the structure of the soluble FGFR2 IIIc-Fc fusion protein.
  • FIG. 13B depicts the nucleotide sequence (SEQ ID NO: 54) of the soluble FGFR2 IIIc-Fc fusion protein.
  • FIG. 13C depicts the amino acid sequence (SEQ ID NO: 55) of the soluble FGFR2 IIIc-
  • FIG. 13D depicts a Western blot of SDS-PAGE analysis of CHO stable cell lines expressing the recombinant fusion protein of soluble FGFR2 IIIc-Fc.
  • FIG 13E is a bar graph depicting soluble receptor binding of FGFR2 beta-ECD to the FGF8b ligand.
  • FIG 13F is a linear graph depicting inhibition of binding of the FGFR2IIIc to the FGF8b ligand in the presense of murine antibody Atto-MuMab-03.
  • FIG. 14 depicts sequence alignments of FGFR2 receptor Ig-like loop-3 regions from human and rat.
  • the C-terminal half of loop-3 is encoded by either exon-8 to give rise to IIIc (shown in bold) (residues 6-53 of SEQ ID NO: 2 and SEQ ID NO: 67), or exon-9 to give rise to Illb (italic) (residues 6-51 of SEQ ID NO: 65 and SEQ ID NO: 68).
  • Human and rat sequences are 100% identical in these regions.
  • FIG. 15 depicts the dual targeting strategy for FGFR2 receptor.
  • Antibody Ab-1 targets the extracellular ligand binding site of the receptor; and TKI (e.g., R04383596 or Pazopanib) targets the intracellular tyrosine kinase domain.
  • TKI e.g., R04383596 or Pazopanib
  • FIG. 16 depicts the isoform specific primers for PCR analysis of FGFR2 IIIc and Illb.
  • FIG. 17A depicts the amino acid sequence of human FGFR2 gene (SEQ ID NO: 32).
  • FIGs. 17B - 17C depict the amino acid (SEQ ID NO: 21) and nucleotide sequences (SEQ ID NO: 63) of human FGFR2 Illb, respectively.
  • FIGs. 17D - 170 depict the amino acid sequence of human FGFR2 isoform 4 (SEQ ID NO: 22), isoform 7 (SEQ ID NO: 23), isoform 9 (SEQ ID NO: 24), isoform 10 (SEQ ID NO: 25), isoform 11 (SEQ ID NO: 26), isoform 12 (SEQ ID NO: 27), isoform 13 (SEQ ID NO: 28), isoform 14 (SEQ ID NO: 29), isoform 15 (SEQ ID NO: 30), isoform 17 (SEQ ID NO: 31), isoform 18 (SEQ ID NO: 52), and isoform 19 (SEQ ID NO: 53), respectively.
  • FIG. 18A depicts the amino acid sequence of human FGFR1 gene (SEQ ID NO: 33).
  • FIGs. 18B - 18H depict the amino acid sequences of human FGFR1 isoform 1 (SEQ ID NO: 33).
  • FIG. 19A depicts the amino acid sequence of human RON gene (SEQ ID NO: 34).
  • FIG. 19B depicts the amino acid sequence of human non-oncogenic RON isoform (SEQ ID NO: 34).
  • FIG. 20A depicts the amino acid sequence of human KIT gene (SEQ ID NO: 35).
  • FIG. 20B depicts the amino acid sequence of human KIT variant with deletion in exon 11 (SEQ ID NO: 46).
  • FIG. 20C depict the amino acid sequence of full-length human KIT (SEQ ID NO: 47).
  • FIG. 21 A depicts the amino acid sequence of human PDGF gene (SEQ ID NO: 36).
  • FIG. 21B depicts the amino acid sequence of human PDGF isoform 2 (SEQ ID NO: 48).
  • FIG. 21C depict the amino acid sequence of full-length human PDGF (SEQ ID NO: 49).
  • FIG. 22A depicts the amino acid sequence of human PDGFR alpha gene (SEQ ID NO:
  • FIG. 22B depicts the amino acid sequence of human PDGFR alpha isoform 1(SEQ ID NO: 1
  • FIG. 22C depict the amino acid sequence of human PDGFR alpha isoform with deletion in exons 7-8 (SEQ ID NO: 51).
  • FIG. 23 depicts the amino acid sequence of human FGF8 (SEQ ID NO: 66).
  • FIG. 24A is a bar graph depicting selective binding of monoclonal antibody clones B7,
  • Clone B7 has been designated herein as "Atto-MuMab-03."
  • FIG. 24B is a table depicting the OD values and standard deviation of binding of the indicated monoclonal antibody clones to FGFR2IIIc-Fc (including Atto-MuMab-03) compared to binding to FGFR2IIIb.
  • FIG. 25A is a bar graph depicting the selective binding of a panel of human antibody scFv clones 1-8 to the loop-3 region of FGFR2IIIc isoform containing 128-amino acid (amino acid 235- 353) (mFc), compared to binding to irrelevant human ovalbumin (OA) and human ferritin (Fer) controls.
  • OA ovalbumin
  • Fer human ferritin
  • FIG. 25B is a table depicting the OD values and standard deviation of binding of the indicated panel of human antibody scFv clones to the 128 amino acid-fragment of FGFR2IIIc
  • FIG. 26 is a photograph of DNA fingerprints of thirty different human antibody scFv clones against FGFR2IIIc.
  • FIG. 27A is a bar graph depicting the binding selectivity of the indicated human antibody scFv clones to FGFR2 isoform IIIc versus FGFR2IIIb.
  • FIG. 27B is a table depicting the OD values and standard deviation of binding of the indicated human scFv clones to isoform IIIc versus FGFR2IIIb.
  • FIG. 28 depicts an amino acid sequence alignment of human scFv Clone-6 (SEQ ID NO:
  • CDRs complementarity determining regions
  • FIGS. 29A-29B depict the nucleotide (SEQ ID NO: 162) and amino acid (SEQ ID NO:
  • FIGS. 29C-29D depict the nucleotide (SEQ ID NO: 164) and amino acid (SEQ ID NO: 163) sequence, respectively, of the light chain variable domain of the human scFv Clone 8 (Atto- HuMab-08).
  • the CDR sequences (SEQ ID NOS: 184-186, corresponding to the nucleotide sequences of CDRs 1-3, respectively; SEQ ID NOS: 155, 156 and 146, corresponding to the amino acid sequences of CDRs 1-3, respectively) are underlined.
  • FIGS. 29E-29F depict the nucleotide (SEQ ID NO: 166) and amino acid (SEQ ID NO: 165) sequence, respectively, of the heavy chain variable domain of the human scFv Clone 8 (Atto-HuMab-08).
  • the CDR sequences (SEQ ID NOS: 187-189, corresponding to the nucleotide sequences of CDRs 1-3, respectively; SEQ ID NOS: 147-149, corresponding to the amino acid sequences of CDRs 1-3, respectively) are underlined.
  • FIGS. 30A-30B depict the nucleotide (SEQ ID NO: 167) and amino acid (SEQ ID NO: 160) sequence, respectively, for the full length coding region of the light chain variable domain and the heavy chain variable domain of human scFv Clone 6 (Atto-HuMab-06). The linker sequence is shaded.
  • FIGS. 30C-30D depict the nucleotide (SEQ ID NO: 169) and amino acid (SEQ ID NO: 168) sequence, respectively, of the light chain variable domain of the human scFv Clone 6 (Atto- HuMab-06).
  • the CDR sequences (SEQ ID NOS: 178-180, corresponding to the nucleotide sequences of CDRs 1-3, respectively; SEQ ID NOS: 155-157, corresponding to the amino acid sequences of CDRs 1-3, respectively) are underlined.
  • 30E-30F depict the nucleotide (SEQ ID NO: 171) and amino acid (SEQ ID NO: 170) sequence, respectively, of the heavy chain variable domain of the human scFv Clone 6 (Atto-HuMab-06).
  • the CDR sequences (SEQ ID NOS: 181-183, corresponding to the nucleotide sequences of CDRs 1-3, respectively; SEQ ID NOS: 147, 158 and 159, corresponding to the amino acid sequences of CDRs 1-3, respectively) are underlined.
  • FIG 31 is a table depicting the phage clone recovery yield in library screening.
  • FIG 32 is photograph of a Western blot depicting binding of the monoclonal antibody Atto-MuMab-03 to endogenous FGFR2IIIc in tumor cells.
  • FIG. 33 depicts a Western blot showing the binding of mAb Atto-MuMab-01 to the endogenous FGFR2 IIIc protein in the prostate cancer cell line, DU145.
  • Lane 1 DU145 cell lysate from 50,000 cells;
  • Lane 2 mAb IP from lysate of 500,000 DU145 cells;
  • Lane 3 blank;
  • Lane 4 Positive control of FGFR2IIIc-Fc (100 ng).
  • FIG. 34A depicts the nucleotide sequence of Atto-MuMab-02 heavy chain variable region (SEQ ID NO: 87; 358 bp).
  • the nucleotide sequences of CDRs (SEQ ID NOS: 91, 93 and 95, corresponding to CDRs 1-3, respectively) and framework regions are shown as underlined and in italic, respectively.
  • FIG. 34B depicts the nucleotide sequence of Atto-MuMab-02 light chain variable region (SEQ ID NO: 89; 324 bp).
  • the nucleotide sequences of CDRs (SEQ ID NOS: 97, 99 and 101, corresponding to CDRs 1-3, respectively) and framework regions are shown as underlined and in italic, respectively.
  • FIG. 35 depicts the amino acid sequences of Atto-MuMab-02 light chain variable region (SEQ ID NO: 90; 21-LC) and heavy chain variable region (SEQ ID NO: 88; 21-HC).
  • SEQ ID NOS: 98, 100 and 102 correspond to VL CDRs 1-3, respectively.
  • SEQ ID NOS: 92, 94 and 96 correspond to VH CDRs 1-3, respectively.
  • FIG. 36A depicts the amino acid sequence alignment of Atto-MuMab-02 heavy chain variable region with mouse immunoglobulin mu chain.
  • 21HC Atto-MuMab-02
  • immunoglobulin heavy chain variable region (SEQ ID NO: 88); subject: immunoglobulin mu chain [Mus musculus] (SEQ ID NO: 142; GenBank: AAA88255.1).
  • FIG. 36B depicts the amino acid sequence alignment of Atto-MuMab-02 light chain variable region with mouse anti-human melanoma immunoglobulin light chain.
  • 21LC Atto- MuMab-02 immunoglobulin light chain variable region (residues 1-106 of SEQ ID NO: 90); subject: anti-human melanoma immunoglobulin light chain [Mus musculus] (SEQ ID NO: 143; GenBank: AA049727.1).
  • FIGS. 37A-37B depicts the amino acid (SEQ ID NO: 190) and nucleotide (SEQ ID NO: 191) sequences, respectively, for the full length coding region of the light chain variable domain and the heavy chain variable domain of human scFv Clone 1 (scFv-1, also referred to herein as "Atto-HuMab-01").
  • the linker sequence is shaded.
  • the CDR sequences are underlined.
  • SEQ ID NOS: 144-146 correspond to the amino acid sequences of VL CDRs 1-3, respectively.
  • SEQ ID NOS: 147-149 correspond to the amino acid sequences of VH CDRs 1-3, respectively.
  • SEQ ID NOS: 172-174 correspond to the nucleotide sequences of VL CDRs 1-3, respectively.
  • SEQ ID NOS: 175-177 correspond to the nucleotide sequences of VH CDRs 1-3, respectively.
  • FIG. 38 depicts an amino acid sequence alignment of human scFv Clone 1 (scFv-1, SEQ ID NO: 142) and Clone 6 (scFv-6, SEQ ID NO: 160).
  • the locations of the complementarity determining regions (CDRs) of the light and heavy chain variable regions are underlined and labeled as VL-CDR-1, -2, and -3, and VH-CDR-1, -2, and -3, respectively.
  • the linker sequence is shaded.
  • Clone-1 and Clone-6 are also referred to herein as "Atto-HuMab-01" and "Atto- HuMab-06,” respectively.
  • FIG. 39 depicts an amino acid sequence alignment of human scFv Clone 1 (scFv-1, SEQ ID NO: 142) and Clone 8 (scFv-8; SEQ ID NO: 161).
  • the locations of the complementarity determining regions (CDRs) of the light and heavy chain variable regions are underlined and labeled as VL-CDR-1, -2, and -3, and VH-CDR-1, -2, and -3, respectively.
  • the linker sequence is shaded.
  • Clone-1 and Clone-8 are also referred to herein as "Atto-HuMab-01" and "Atto- HuMab-08,” respectively.
  • FIG. 40 is a table depicting a comparison of the CDR region homology among human scFv clones scFv-1, scFv-6 and scFv-8. Unique amino acid residues are underlined. Amino acid residues that share sequence homology among two of the three clones are shown in italics. Amino acid residues homologous among all three clones are shown in regular font.
  • FIG. 41 depicts images of immunocytochemical (ICC) staining showing the binding of human scFv Clone 1 (scFv-1) to FGFR2IIIc-expressing CHO cells.
  • FIG. 42 depicts graphs showing the binding of Fc-fusion of human scFv Clone 1 (dcFv- 01) to FGFR2IIIc-expressing CHO cells as determined by fluorescence activated cell sorting (FACS).
  • FIG. 43 depicts images of immunocytochemical (ICC) staining showing the binding of Fc-fusion of human scFv Clone 1 (dcFv-01) to rat prostate cance cell line AT3B- 1.
  • ICC immunocytochemical
  • FIG. 44 depicts graphs showing the binding of Fc-fusion of human scFv Clone 1 (dcFv- 01) to rat prostate cance cell line AT3B-1 as determined by fluorescence activated cell sorting (FACS).
  • the present invention provides, at least in part, isoform-specific inhibitors that inhibit or reduce one or more isoform-associated activities.
  • the isoforms e.g. , polypeptide or nucleic acid isoforms
  • oncogenic isoforms e.g., oncogenic or malignant phenotypes
  • the isoforms can arise from, e.g., one or more of: alternative splicing, frameshifting, translational and/or post- translational events, thereby resulting in different transcription or translation products.
  • the isoform-specific inhibitor is an isoform-binding molecule, e.g., an antibody molecule, or a nucleic acid inhibitor.
  • the isoform-specific inhibitor is a soluble receptor polypeptide and a fusion form thereof, or a peptide and a functional variant thereof.
  • the isoform-specific inhibitor can be an oncogenic isoform-binding molecule, e.g., an antibody molecule or a nucleic acid inhibitor that specifically interacts with, e.g., binds to, one or more oncogenic isoforms (e.g., oncogenic isoform polypeptides or nucleic acids encoding the same).
  • the isoform-specific inhibitor is a soluble receptor polypeptide or a fusion form thereof, or a peptide or a functional variant thereof that reduces or inhibits one or more isoform- (e.g., oncogenic isoform-) associated activities.
  • the soluble receptor or fusion reduce or inhibit (e.g., competitively inhibit) an interaction of the isoform (e.g., the oncogenic isoform) polypeptide and its cognate ligand or receptor.
  • the oncogenic isoforms can arise from, e.g., alternative splicing, frameshifting, translational and/or post-translational events, of various proto-oncogene expression products in a cell, e.g., a hyperproliferative cell (e.g., a cancerous or tumor cell).
  • a hyperproliferative cell e.g., a cancerous or tumor cell.
  • the isoform-binding molecules described herein bind to such oncogenic isoforms, but do not substantially bind a predominantly non-oncogenic sequence of the proto-oncogene from which the isoform is derived.
  • isoform in the context of a protein or polypeptide as used herein refers to polymers of amino acids of any length that can be derived from one or more of alternative splicing, frameshifting, translational and/or post-translational events.
  • Alternative splicing events include processes (during transcription) by which one or more alternative exons (i.e., portion of a gene that codes for a protein) within a given RNA molecule are combined (by RNA Polymerase molecules) to yield different mRNAs from the same gene.
  • Each such mRNA is known as a "gene transcript”.
  • a single gene can encode several different mRNA transcripts, caused by cell- or tissue- specific combination of different exons.
  • FGFR1-3 fibroblast growth factor receptor 1-3
  • a frequent splicing event involving FGFR1 and 2 results in receptors containing three immunoglobulin (ig) domains, commonly referred to the a isoform, or only Immunoglobulin II (Igll) and Iglll, referred to as the ⁇ isoform.
  • the a isoform has been identified for FGFR3 and FGFR4.
  • FGF receptors with alternative Iglll domains are generated by splicing events of FGFR1-3 involving the C-terminal half of the Iglll domain encoded by two mutually exclusive alternative exons derived from the FGFR2 gene (reviewed in Galzie, Z. et al. (1997) Biochem. Cell. Biol. 75:669- 685; Burke, D. et al. (1998) Trends Biochem Sci 23:59-62).
  • FGFR2-IIIc uses the alternative exon III, which encodes a different sequence than that of isoform FGFR2-IIIb.
  • alternative splicing include frameshifting (i.e., different set of triplet codons in the mRNA/transcript is translated by the ribosome) or varying translation start or stop site (on the mRNA during its translation), resulting in a given intron remaining in the mRNA transcript.
  • frameshifting i.e., different set of triplet codons in the mRNA/transcript is translated by the ribosome
  • translation start or stop site on the mRNA during its translation
  • an "oncogenic isoform” refers to any protein, polypeptide, mRNA, or cDNA that can be derived from one or more of alternative splicing, frameshifting, translational and/or post- translational events, whose presence or abnormal level is associated with cancer or malignant phenotype. For example, it may be found at an abnormal level in cells derived from disease- affected tissues, as compared to a reference value, e.g., a tissue or cells of a non disease control. It may be a protein isoform that is expressed at an abnormally high level, where the altered expression correlates with the occurrence and/or progression of the cancer.
  • An oncogenic isoform may also be the expression product of a gene possessing mutation(s) or genetic variation that is directly responsible or is in linkage disequilibrium with other gene(s) that are responsible for the etiology of cancer.
  • exemplary oncogenic isoforms include, but are not limited to, FGFR2 (e.g., an oncogenic FGFR2 isoform IIIc), FGFR1 (e.g., an oncogenic FGFR1L), RON receptor tyrosine kinase (e.g., an oncogenic RON receptor tyrosine kinase comprising a deletion of exons 5 and 6), KIT receptor tyrosine kinase (e.g., an oncogenic KIT receptor tyrosine kinase comprising a deletion in exon 11), and PDGF-receptor alpha (e.g., an oncogenic PDGF-receptor alpha comprising a deletion of exon
  • non-oncogenic isoform or “non-oncogenic protooncogene” refers to a protein, polypeptide, mRNA, or cDNA that is found predominantly in non-cancerous cells or tissues. Such isoforms and protooncogenes may be expressed in malignant conditions, but is not typically associated with the malignant phenotype.
  • compositions and methods of the present invention encompass polypeptides and nucleic acids having the sequences specified, or sequences substantially identical or similar thereto, e.g., sequences at least 85%, 90%, 95% identical or higher to the sequence specified.
  • substantially identical is used herein to refer to a first amino acid that contains a sufficient or minimum number of amino acid residues that are i) identical to, or ii) conservative substitutions of aligned amino acid residues in a second amino acid sequence such that the first and second amino acid sequences can have a common structural domain and/or common functional activity.
  • amino acid sequences that contain a common structural domain having at least about 85%, 90%.
  • nucleotide sequence in the context of nucleotide sequence, the term “substantially identical” is used herein to refer to a first nucleic acid sequence that contains a sufficient or minimum number of nucleotides that are identical to aligned nucleotides in a second nucleic acid sequence such that the first and second nucleotide sequences encode a polypeptide having common functional activity, or encode a common structural polypeptide domain or a common functional polypeptide activity.
  • nucleotide sequences having at least about 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity to a reference sequence, e.g., SEQ ID NO: 1, 3, or 5 are termed substantially identical.
  • the term “functional variant” refers polypeptides that have a substantially identical amino acid sequence to the naturally- occurring sequence, or are encoded by a substantially identical nucleotide sequence, and are capable of having one or more activities of the naturally-occurring sequence
  • the sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second amino acid or nucleic acid sequence for optimal alignment and non-homologous sequences can be disregarded for comparison purposes).
  • the length of a reference sequence aligned for comparison purposes is at least 30%, preferably at least 40%, more preferably at least 50%, 60%, and even more preferably at least 70%, 80%, 90%, 100% of the length of the reference sequence.
  • the amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared.
  • amino acid or nucleic acid “identity” is equivalent to amino acid or nucleic acid “homology”
  • the percent identity between the two sequences is a function of the number of identical positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which need to be introduced for optimal alignment of the two sequences.
  • the comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm.
  • the percent identity between two amino acid sequences is determined using the Needleman and Wunsch ((1970) J. Mol. Biol. 48:444-453 ) algorithm which has been incorporated into the GAP program in the GCG software package (available at http://www.gcg.com), using either a
  • Blossum 62 matrix or a PAM250 matrix and a gap weight of 16, 14, 12, 10, 8, 6, or 4 and a length weight of 1, 2, 3, 4, 5, or 6.
  • the percent identity between two nucleotide sequences is determined using the GAP program in the GCG software package (available at http://www.gcg.com), using a NWSgapdna.CMP matrix and a gap weight of 40, 50, 60, 70, or 80 and a length weight of 1, 2, 3, 4, 5, or 6.
  • a particularly preferred set of parameters are a Blossum 62 scoring matrix with a gap penalty of 12, a gap extend penalty of 4, and a frameshift gap penalty of 5.
  • the percent identity between two amino acid or nucleotide sequences can be determined using the algorithm of E. Meyers and W. Miller ((1989) CABIOS, 4: 11-17) which has been incorporated into the ALIGN program (version 2.0), using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4.
  • nucleic acid and protein sequences described herein can be used as a "query sequence" to perform a search against public databases to, for example, identify other family members or related sequences. Such searches can be performed using the NBLAST and
  • Gapped BLAST can be utilized as described in Altschul et al., (1997) Nucleic Acids Res. 25:3389-3402.
  • hybridizes under low stringency, medium stringency, high stringency, or very high stringency conditions describes conditions for hybridization and washing.
  • Guidance for performing hybridization reactions can be found in Current Protocols in Molecular Biology, John Wiley & Sons, N.Y. (1989), 6.3.1-6.3.6, which is incorporated by reference. Aqueous and nonaqueous methods are described in that reference and either can be used.
  • Specific hybridization conditions referred to herein are as follows: 1) low stringency hybridization conditions in 6X sodium chloride/sodium citrate (SSC) at about 45°C, followed by two washes in 0.2X SSC, 0.1% SDS at least at 50°C (the temperature of the washes can be increased to 55°C for low stringency conditions); 2) medium stringency hybridization conditions in 6X SSC at about 45°C, followed by one or more washes in 0.2X SSC, 0.1% SDS at 60°C; 3) high stringency hybridization conditions in 6X SSC at about 45°C, followed by one or more washes in 0.2X SSC, 0.1% SDS at 65°C; and preferably 4) very high stringency hybridization conditions are 0.5M sodium phosphate, 7% SDS at 65°C, followed by one or more washes at 0.2X SSC, 1% SDS at 65°C. Very high stringency conditions (4) are the preferred conditions and the ones that should be used unless otherwise specified.
  • molecules of the present invention may have additional conservative or non-essential amino acid substitutions, which do not have a substantial effect on their functions.
  • amino acid is intended to embrace all molecules, whether natural or synthetic, which include both an amino functionality and an acid functionality and capable of being included in a polymer of naturally- occurring amino acids.
  • exemplary amino acids include naturally- occurring amino acids; analogs, derivatives and congeners thereof; amino acid analogs having variant side chains; and all stereoisomers of any of any of the foregoing.
  • amino acid includes both the D- or L- optical isomers and peptidomimetics.
  • a “conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain.
  • Families of amino acid residues having similar side chains have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
  • polypeptide refers to two or more amino acids linked by a peptide bond between the alpha- carboxyl group of one amino acid and the alpha-amino group of the next amino acid.
  • the polypeptide can be isolated from natural sources, can be a produced by recombinant techniques from a eukaryotic or prokaryotic host, or can be a product of synthetic procedures.
  • nucleic acid refers to any organic acid sequence.
  • nucleotide sequence refers to any organic acid sequence.
  • polynucleotide sequence and “polynucleotide” are used interchangeably. They refer to a polymeric form of nucleotides of any length, either deoxyribonucleotides or ribonucleotides, or analogs thereof.
  • the polynucleotide may be either single- stranded or double- stranded, and if single- stranded may be the coding strand or non-coding (antisense) strand.
  • Polynucleotides may have any three-dimensional structure, and may perform any function, known or unknown.
  • polynucleotides coding or non-coding regions of a gene or gene fragment, loci (locus) defined from linkage analysis, exons, introns, messenger RNA (mRNA), transfer RNA, ribosomal RNA, ribozymes, cDNA, recombinant polynucleotides, branched polynucleotides, plasmids, vectors, isolated DNA of any sequence, isolated RNA of any sequence, nucleic acid probes, and primers.
  • a polynucleotide may comprise modified nucleotides, such as methylated nucleotides and nucleotide analogs.
  • nucleotide structure may be imparted before or after assembly of the polymer.
  • sequence of nucleotides may be interrupted by non-nucleotide components.
  • a polynucleotide may be further modified after polymerization, such as by conjugation with a labeling component.
  • the nucleic acid may be a recombinant polynucleotide, or a polynucleotide of genomic, cDNA, semisynthetic, or synthetic origin which either does not occur in nature or is linked to another polynucleotide in a nonnatural arrangement.
  • oligonucleotide refers to a single stranded polynucleotide having less than about 100 nucleotides, less than about 75, 50, 25, or 10 nucleotides.
  • An "oligonucleotide,” as used herein, refers to an oligomer or polymer of a ribonucleic acid (RNA) or deoxyribonucleic acid (DNA) or mimetics thereof. This term includes oligonucleotides composed of naturally occurring nucleobases, sugars and covalent intemucleoside (backbone) linkages as well as oligonucleotides having non-naturally-occurring portions which function similarly. Such modified or substituted oligonucleotides are often preferred over native forms because of desirable properties such as, for example, enhanced cellular uptake, enhanced affinity for nucleic acid target and increased stability in the presence of nucleases.
  • isolated refers to material that is removed from its original or native environment (e.g., the natural environment if it is naturally occurring).
  • a naturally- occurring polynucleotide or polypeptide present in a living animal is not isolated, but the same polynucleotide or polypeptide, separated by human intervention from some or all of the co-existing materials in the natural system, is isolated.
  • Such polynucleotides could be part of a vector and/or such polynucleotides or polypeptides could be part of a composition, and still be isolated in that such vector or composition is not part of the environment in which it is found in nature.
  • the invention provides isolated polypeptides of oncogenic isoforms or epitope thereof, or substantially identical sequences thereto.
  • epitope or “epitope fragment” refers to the region of an antigen to which an antibody molecule binds preferentially and specifically.
  • a monoclonal antibody binds preferentially to a single specific epitope of a molecule that can be molecularly defined.
  • An epitope of a particular protein or protein isoform may be constituted by a limited number of amino acid residues, e.g. 2-30 residues, that are either in a linear or nonlinear organization on the protein or protein isoform.
  • An epitope that is recognized by the antibody may be, e.g., a short peptide of 2-30 amino acids that spans a junction of two domains or two polypeptide fragments of an oncogenic isoform that is not present in the normal isoforms of the protein.
  • An oncogenic isoform may be a translation product of an alternatively spliced RNA variant that either lacks one or more exon(s) or has additional exon(s) relative to the RNA encoding the normal protein.
  • the epitope may comprise, or consist of, residues at positions 15- 16, 15-17, 15- 18, 15-19, 15-20, 15-21, 15-22, 15-23, 15-24, 15-25, 15-26, 15-27, 15-28, 15-29, or 15-30 of any one of SEQ ID NOs: 10, 12, 14, or 18.
  • the epitope may comprise, or consist of, residues at positions 14- 16, 14-17, 14- 18, 14-19, 14-20, 14-21, 14-22, 14-23, 14-24, 14-25, 14-26, 14-27, 14-28, 14-29, or 14-30 of any one of SEQ ID NOs: 10, 12, 14, or 18.
  • the epitope may comprise, or consist of, residues at positions 13-16, 13- 17, 13-18, 13- 19, 13-20, 13-21, 13-22, 13-23, 13-24, 13-25, 13-26, 13-27, 13-28, 13- 29, or 13-30 of any one of SEQ ID NOs: 10, 12, 14, or 18.
  • the epitope may comprise, or consist of, residues at positions 12-16, 12- 17, 12-18, 12- 19, 12-20, 12-21, 12- 22, 12-23, 12-24, 12-25, 12-26, 12-27, 12-28, 12-29, or 12-30 of any one of SEQ ID NOs: 10, 12, 14, or 18.
  • the epitope may comprise, or consist of, residues at positions 11- 16, 11-17, 11- 18, 11-19, 11-20, 11-21, 11-22, 11-23, 11-24, 1 1-25, 11-26, 11-27, 11-28, 11-29, or 11-30 of any one of SEQ ID NOs: 10, 12, 14, or 18.
  • the epitope may comprise, or consist of, residues at positions 10-16, 10- 17, 10-18, 10- 19, 10-20, 10-21, 10-22, 10-23, 10-24, 10-25, 10-26, 10-27, 10-28, 10-29, or 10-30 of any one of SEQ ID NOs: 10, 12, 14, or 18.
  • the epitope may comprise, or consist of, residues at positions 9-16, 9- 17, 9-18, 9- 19, 9-20, 9-21, 9-22, 9-23, 9-24, 9-25, 9-26, 9-27, 9-28, 9-29, or 9-30 of any one of SEQ ID NOs: 10, 12, 14, or 18.
  • the epitope may comprise, or consist of, residues at positions 8-16, 8- 17, 8-18, 8- 19, 8-20, 8-21, 8-22, 8-23, 8-24, 8-25, 8-26, 8-27, 8-28, 8-29, or 8-30 of any one of SEQ ID NOs: 10, 12, 14, or 18.
  • the epitope may comprise, or consist of, residues at positions 7-16, 7- 17, 7- 18, 7-19, 7-20, 7-21, 7-22, 7-23, 7-24, 7-25, 7-26, 7-27, 7-28, 7-29, or 7-30 of any one of SEQ ID NOs: 10, 12, 14, or 18.
  • the epitope may comprise, or consist of, residues at positions 6-16, 6- 17, 6-18, 6- 19, 6-20, 6-21, 6-22, 6-23, 6-24, 6-25, 6-26, 6-27, 6-28, 6-29, or 6-30 of any one of SEQ ID NOs: 10, 12, 14, or 18.
  • the epitope may comprise, or consist of, residues at positions 5-16, 5- 17, 5-18, 5- 19, 5-20, 5-21, 5-22, 5-23, 5-24, 5-25, 5-26, 5-27, 5-28, 5-29, or 5-30 of any one of SEQ ID NOs: 10, 12, 14, or 18.
  • the epitope may comprise, or consist of, residues at positions 4-16, 4- 17, 4- 18, 4-19, 4-20, 4-21, 4-22, 4-23, 4-24, 4-25, 4-26, 4-27, 4-28, 4-29, or 4-30 of any one of SEQ ID NOs: 10, 12, 14, or 18.
  • the epitope may comprise, or consist of, residues at positions 3-16, 3- 17, 3-18, 3- 19, 3-20, 3-21, 3-22, 3-23, 3-24, 3-25, 3-26, 3-27, 3-28, 3-29, or 3-30 of any one of SEQ ID NOs: 10, 12, 14, or 18.
  • the epitope may comprise, or consist of, residues at positions 2-16, 2- 17, 2-18, 2- 19, 2-20, 2-21, 2-22, 2-23, 2-24, 2-25, 2-26, 2-27, 2-28, 2-29, or 2-30 of any one of SEQ ID NOs: 10, 12, 14, or 18.
  • the epitope may comprise, or consist of, residues at positions 1-16, 1- 17, 1- 18, 1-19, 1-20, 1-21, 1-22, 1-23, 1-24, 1-25, 1-26, 1-27, 1-28, 1-29, or 1-30 of any one of SEQ ID NOs: 10, 12, 14, or 18.
  • the "epitope" may be used to raise antibodies that specifically bind the oncogenic isoform (e.g., do not substantially bind to the non-oncogenic isoform derived from the same pro to-oncogene).
  • the invention provides isolated polypeptides of human oncogenic isoforms or epitope thereof.
  • an isoform or epitope thereof is an oncogenic form of a proto-oncogene selected from the group consisting of human FGFR2 (SEQ ID NO: 32), human FGFR1 (SEQ ID NO: 33), human RON Receptor tyrosine kinase (SEQ ID NO: 34), human KIT receptor tyrosine kinase (SEQ ID NO: 35), human PDGF (SEQ ID NO: 36), and human PDGFR-alpha (SEQ ID NO: 37), or a sequence substantially identical thereto.
  • the invention provides isolated rat polypeptides of oncogenic isoforms or epitope thereof.
  • the invention provides isolated mouse
  • polypeptides of human oncogenic isoforms or epitope thereof are polypeptides of human oncogenic isoforms or epitope thereof.
  • the amino acids of human oncogenic isoforms or epitope thereof are polypeptides of human oncogenic isoforms or epitope thereof.
  • isolated polypeptides of human oncogenic isoforms or epitope thereof will be derived from other species, including but not limited to, dogs, pigs, guinea pigs and rabbits.
  • Fibroblast growth factor receptor 2 also known in the art as bacteria-expressed kinase (BEK), keratinocyte growth factor receptor (KGFR), JWS, CEK3, CFDl, ECTl, TK14, TK25, BFR-1, CD332, K-SAM and FLJ98662.
  • FGFR2 is a member of the fibroblast growth factor receptor family and has high affinity for acidic, basic and/or keratinocyte growth factor.
  • FGFR2 is associated with signal transduction leading to mitogenesis and differentiation. Mutations in FGFR2 have been associated with craniofacial dysostosis 1, Crouzon syndrome, Pfeiffer syndrome, Jackson- Weiss syndrome and Apert syndrome.
  • nucleotide acid and protein sequences of human FGFR2 are disclosed, e.g., in Dionne et al.,
  • the unprocessed precursor of human FGFR2 is about 821 amino acids in length and about 90310 Da in molecular weight.
  • the unprocessed precursor of mouse FGFR2 is about 821 amino acids in length and about 90310 Da in molecular weight.
  • the invention provides isolated polypeptides of oncogenic isoforms or epitope thereof encoded by a nucleic acid comprising a segment of nucleotides which arise from an alternative use of Exon III of a nucleic acid encoding a FGFR2.
  • the alternative use of Exon III results in sequence variation in the region of amino acids from 301- 360, when aligned with FGFR2 Illb.
  • the polypeptide consists of, or comprises, a sequence selected from the group of SEQ NOs: 2, 4, 6, and 8.
  • the polypeptide consists of, or comprises, a sequence encoded by a nucleic acid selected from the group consisting of SEQ NOs: 1, 3, 5, and 7, or sequences substantially
  • FGFR1 Fibroblast growth factor receptor 1 is also known in the art as CEK; FLG; FLT2;
  • FGFRl is a member of the fibroblast growth factor receptor family and has high affinity for both acidic and basic fibroblast growth factors. FGFRl is associated with signal transduction leading to mitogenesis and differentiation and is involved in limb induction.
  • the nucleotide acid and protein sequences of human FGFRl are disclosed, e.g., in Isacchi et al., Nucleic Acids Res. 18: 1906-1906 (1990) and Hou et al., Science 251:665-668(1991).
  • the nucleotide and protein sequences of mouse FGFRl are disclosed, e.g., in Harada et al., Biochem. Biophys. Res.
  • the unprocessed precursor of human FGFRl is about 822 amino acids in length and about 90420 Da in molecular weight.
  • the unprocessed precursor of mouse FGFRl is about 822 amino acids in length and about 90420 Da in molecular weight.
  • FGFRl Mutations in FGFRl have been associated with Pfeiffer syndrome, Jackson- Weiss syndrome, Antley-Bixler syndrome, osteoglophonic dysplasia, and autosomal dominant Kallmann syndrome 2. Chromosomal aberrations involving this gene are associated with stem cell myeloproliferative disorder and stem cell leukemia lymphoma syndrome.
  • the invention provides isolated polypeptides of oncogenic isoforms or epitope thereof encoded by a nucleic acid comprising a segment of nucleotides which arise from an alternative deletion of Exons 7 and 8 of a nucleic acid encoding a FGFRl.
  • the alternative deletion of Exons 7 and 8 results in a deletion of 105 amino acids, when aligned with an FGFRl proto-oncogene.
  • polypeptide consists of, or comprises, a sequence of SEQ NO: 10, or a sequence substantially identical to the same.
  • the polypeptide comprises a sequence encoded by a nucleic acid
  • the epitope consists of, or includes, an amino acid sequence
  • Macrophage stimulating 1 receptor c-met-related tyrosine kinase
  • MST1R macrophage stimulating protein
  • PTK8 CD136
  • CDwl36 Macrophage stimulating 1 receptor
  • RON is also known in the art as MST1R, PTK8, CD136 and CDwl36.
  • MSP macrophage stimulating protein
  • RON is a receptor for macrophage stimulating protein (MSP) and has a tyro sine-protein kinase activity. It is involved in development of epithelial tissue, bone and neuroendocrine derivatives.
  • the nucleotide acid and protein sequences of human RON are disclosed, e.g., in Ronsin C. et al., Oncogene 8: 1195-1202(1993); and Collesi C. et al., Mol. Cell. Biol. 16:5518-5526 (1996).
  • the nucleotide acid and protein sequences of mouse RON are disclosed e.g., in Iwama A. et al, Blood 83:3160-3169(1994); Waltz S.E. et al., Oncogene 16:27-42(1998); and Persons D.A. et al, Nat. Genet. 23: 159-165(1999).
  • the unprocessed precursor of human RON is about 1400 amino acids in length and about 152227 Da in molecular weight.
  • the unprocessed precursor of mouse RON is about 1378 amino acids in length and about 150538 Da in molecular weight.
  • the invention provides isolated polypeptides of oncogenic isoforms or epitope fragments thereof encoded by a nucleic acid comprising a segment of nucleotides
  • the alternative deletion of Exons 5 and 6 results in an in-frame deletion of 109 amino acids in the extracellular domain, when aligned with a RON receptor tyrosine kinase proto-oncogene.
  • the polypeptide consists of, or comprises, a polypeptide sequence resulting from the fusion and juxtaposition of Exons 4 and 7.
  • the polypeptide consists of, or comprises, a sequence of SEQ NO: 12, or a sequence substantially identical to the same.
  • the polypeptide consists of, or comprises, a sequence of SEQ NO: 12, or a sequence substantially identical to the same.
  • the epitope consists of, or includes, an amino acid sequence identical to the junctional region between exon 4 and exon 7 of isoform RONA160 (SEQ ID NO:
  • ID NO: 11 or a fragment thereof; or an amino acid or nucleotide sequence substantially identical thereto.
  • KIT Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog
  • nucleotide acid and protein sequences of human KIT are disclosed, e.g., in Yarden et al.,
  • the nucleotide acid and protein sequences of mouse KIT are disclosed e.g., in. Qiu et al., EMBO J. 7: 1003-1011(1988) and Rossi et al., Dev. Biol. 152:203-207(1992).
  • the unprocessed precursor of human KIT is about 976 amino acids in length and about 107360 Da in molecular weight.
  • the unprocessed precursor of mouse KIT is about 107250 amino acids in length and about 150538 Da in molecular weight.
  • KIT KIT-induced gastrointestinal stromal tumors, mast cell disease, acute myelogenous leukemia, and piebaldism.
  • the invention provides isolated polypeptides of oncogenic isoforms or epitope fragments thereof encoded by a nucleic acid comprising a segment of nucleotides which arise from an alternative deletion of Exon 11 of a nucleic acid encoding a KIT receptor tyrosine kinase.
  • the polypeptide consists of, or comprises, a sequence of SEQ NO: 14, or a sequence substantially identical to the same.
  • the polypeptide consists of, or comprises, a sequence encoded by a nucleic acid sequence of SEQ
  • the epitope consists of, or includes, an amino acid sequence identical to the junctional region of KIT between exons 10 and 12 of SEQ ID NO: 14 or a
  • PDGFA Platelet-derived growth factor alpha polypeptide
  • PDGF1 and PDGF-A Platelet-derived growth factor alpha polypeptide
  • PDGFA encoded a member of the platelet-derived growth factor family.
  • PDGFA is a mitogenic factor for cells of mesenchymal origin and is characterized by a motif of eight cysteines.
  • the nucleotide acid and protein sequences of human PDGFA are disclosed, e.g., in Bonthron et al., Proc. Natl. Acad. Sci. U.S.A. 85: 1492-1496(1988) and Betsholtz et al., Nature 320:695-699(1986).
  • the nucleotide acid and protein sequences of mouse PDGFA are disclosed e.g., in. Rorsman et al., Growth Factors 3:13-313(1992) and Mercola et al., Dev. Biol. 138: 114-122(1990).
  • the unprocessed precursor of human PDGFA is about 211 amino acids in length and about 23210 Da in molecular weight.
  • the unprocessed precursor of mouse PDGFA is about 211 amino acids in length and about 23210 Da in molecular weight.
  • knockout mice have shown cellular defects in oligodendrocytes, alveolar smooth muscle cells, and Leydig cells in the testis; knockout mice die either as embryos or shortly after birth.
  • the invention provides isolated polypeptides of oncogenic isoforms or epitope fragments thereof encoded by a nucleic acid comprising a segment of nucleotides
  • the polypeptide consists of, or comprises, a sequence of SEQ NO: 16, or sequence substantially identical to the same.
  • the polypeptide consists of, or comprises, a sequence encoded by a nucleic acid sequence of SEQ NO: 15, or a sequence substantially identical to the same.
  • the epitope consists of, or includes, an amino acid sequence identical to the junctional region of PDGF between exons 5 and 7 of SEQ ID NO: 16 or a
  • Platelet-derived growth factor receptor, alpha polypeptide is also known in the art as CD140A; PDGFR2; MGC74795 and Rhe-PDGFRA.
  • PFGFRA encodes a cell surface tyrosine kinase receptor for members of the platelet-derived growth factor family. These growth factors are mitogens for cells of mesenchymal origin.
  • the nucleotide acid and protein sequences of human PDGFA are disclosed e.g., in Bonthron et al, Pwc. Natl. Acad. Sci. U.S.A. 85: 1492-1496(1988) and Betsholtz et al., Nature 320:695-699(1986).
  • the nucleotide acid and protein sequences of mouse PDGFA are disclosed, e.g., in Stiles et al., Mol. Cell. Biol. 10:6781-6784 (1990) and Carninci et al., Science 309: 1559-1563(2005).
  • the unprocessed precursor of human PDGFA is about 1089 amino acids in length and about 119790 Da in molecular weight.
  • the unprocessed precursor of mouse PDGFA is about 1089 amino acids in length and about 119790 Da in molecular weight.
  • HES hypereosinophilic syndrome
  • the invention provides isolated polypeptides of oncogenic isoforms or epitopes thereof encoded by a nucleic acid comprising a segment of nucleotides which arise from an alternative deletion of Exons 7 and 8 (e.g., amino acids 374-456) of a nucleic acid
  • the polypeptide consists of, or comprises, a sequence of SEQ NO: 18, or a sequence substantially identical to the same.
  • the polypeptide consists of, or comprises, a sequence encoded by a nucleic acid sequence of SEQ NO: 17, or a sequence substantially identical to the same.
  • the epitope consists of, or includes, an amino acid sequence identical to the junctional region of PDGFR-alpha between exons 6 and 9 of SEQ ID NO: 18 or a fragment thereof, or an amino acid sequence encoded by a nucleotide sequence of SEQ ID NO: 17 or a fragment thereof; or an amino acid or nucleotide sequence substantially identical thereto.
  • an isolated polypeptide of an oncogenic isoform or epitope thereof may be encoded by a nucleic acid which is substantially identical to a nucleic acid of an oncogenic
  • an isolated polypeptide of an oncogenic isoform or epitope thereof may be substantially identical to an oncogenic isoform or epitope thereof, as provided herein.
  • polypeptide oncogenic isoform or epitope fragment thereof can be isolated from
  • the invention also provides methods of preparing an oncogenic isoform or epitope
  • the invention provides a method of preparing a human oncogenic isoform or
  • the present invention provides, at least in part, isoform-specific inhibitors (e.g., antibody molecules, soluble receptor polypeptides and fusion forms thereof, peptides and functional variants thereof, and nucleic acid inhibitors), which inhibit and/or reduce one or more activities of the isoform, or interact with, or more preferably specifically bind to one or more isoform polypeptides or fragments thereof, or nucleic acids encoding one or more isoform polypeptides or fragments thereof.
  • the isoform-specific inhibitor is an isoform-binding molecule, e.g., an antibody molecule, or a nucleic acid inhibitor.
  • the isoform-specific inhibitor is a soluble receptor polypeptide and a fusion form thereof, or a peptide and a functional variant thereof.
  • the isoform-binding molecules specifically bind to oncogenic isoform polypeptides or fragments thereof, or nucleic acids encoding one or more oncogenic isoform polypeptides or fragments thereof.
  • Typical isoform-specific inhibitors bind to one or more isoform polypeptides or fragments thereof, or nucleic acids encoding one or more isoform polypeptides
  • the isoform-specific inhibitor may selectively and specifically reduce or inhibit an oncogenic isoform-associated activity chosen from one or more of: (i) binding of a ligand or co-receptor (e.g., FGF ligand (e.g., FGF8b, FGF2, FGF17 or FGF18)) to FGFR2 isoform IIIc); (ii) receptor dimerization (e.g., FGFR2 isoform IIIc homo-dimerization or FGFR2 isoform IIIc with another receptor or receptor isoform hetero-dimerization); (iii) isoform signaling, e.g., FGFR2 isoform IIIc signaling; (iv) hyperproliferative (e.g., cancerous or tumor) cell proliferation, growth and/or survival, for example, by induction of apoptosis of the hyperproliferative cell; and/or (v) angiogenesis and/or vascularization of a tumor.
  • the term “specifically binds” refers to a binding interaction that is determinative of the presence of a target (such a specific polypeptide or nucleic acid) in a population of proteins and other biologies.
  • a binding molecule that "specifically binds" an oncogenic isoform is intended to mean that the compound binds an oncogenic isoform of the invention, but does not bind to a non- oncogenic isoform that is derived from the same proto-oncogene.
  • the isoform-binding molecule may show some degree of cross-reactivity between the oncogenic and non-oncogenic isoforms depending on the conditions used, e.g., target protein concentration, salt and buffer conditions used, among others.
  • the term "specifically binds" or “specific binding” refers to a property of the isoform-binding molecule to bind to one or more isoform
  • polypeptides or fragments thereof or nucleic acids encoding one or more isoform polypeptides or
  • isoform-binding molecule binds preferentially to an oncogenic isoform, but does not substantially bind to (e.g., shows less than 10%, 8%, 5%, 4%, 3%, 2%, 1% cross-reactivity with) to its non-oncogenic counterpart.
  • the isoform-binding molecule is an antibody molecule that binds to a mammalian, e.g., human, isoform polypeptide or a fragment thereof (e.g., an Fab, F(ab') 2 , Fv, a single chain Fv fragment, or a camelid variant).
  • a mammalian e.g., human
  • isoform polypeptide or a fragment thereof e.g., an Fab, F(ab') 2 , Fv, a single chain Fv fragment, or a camelid variant.
  • the antibody molecule binds to an isoform polypeptide or fragment expressed and/or associated with a hyperproliferative cell, e.g., a cancerous or tumor cell.
  • the antibody molecule binds specifically to an epitope, e.g., linear or conformational epitope, (e.g., an epitope as described herein) located or expressed primarily on the surface of a hyperproliferative cell, e.g., a cancerous or tumor cell.
  • an epitope e.g., linear or conformational epitope, (e.g., an epitope as described herein) located or expressed primarily on the surface of a hyperproliferative cell, e.g., a cancerous or tumor cell.
  • the epitope recognized by the antibody molecule is expressed or associated with a hyperproliferative disease, e.g., a cancerous or malignant disease.
  • the epitope recognized by the antibody molecule is expressed or associated with an exon sequence predominantly expressed or associated with one or more cancerous or tumor cells or disorders; the epitope may be located at the junctional region between two exons that are predominantly joined together in one or more cancerous or tumor cells or disorders, e.g., as a result of an in-frame exon deletion or the use of an alternatively spliced exon.
  • Exemplary isoform polypeptides or fragments recognized by isoform-binding molecules of the invention include, but are not limited to, oncogenic isoforms of FGFR2, FGFRl, RON receptor tyrosine kinase, KIT receptor tyrosine kinase, PDGF and PDGF-receptor alpha.
  • the oncogenic isoform to which the antibody molecule binds is a human oncogenic isoform.
  • the polypeptide isoform to which the antibody molecule binds is a polypeptide of an oncogenic isoform or epitope thereof listed in Table 1.
  • the antibody molecule specifically binds a polypeptide comprising the amino acid sequence set forth in SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, or 18, or a
  • the antibody molecule substantially identical sequence thereto.
  • the antibody molecule is substantially identical to the antibody molecule
  • the antibody molecule specifically binds to the polypeptide FGFR2-IIIc isoform of SEQ ID NO: 2, 4, 6, or 8, but does not substantially bind to the polypeptide isoform of human FGFR2-IIIb.
  • the antibody molecule binds to the human FGFR2 polypeptide of e.g. , SEQ ID NO: 19, but does not substantially bind to FGFR2-IIIb (e.g., SEQ ID NO: 21) or other isoforms of FGFR2 (e.g. ,
  • the antibody molecule binds specifically to an isoform, e.g., an oncogenic isoform, of FGFR1, e.g., human FGFR1.
  • an isoform e.g., an oncogenic isoform
  • the antibody molecule binds specifically to isoform FGFR1L having a deletion of about 105 amino acids between exons 7 and 8, corresponding to part of immunoglobulin domain II (Ig-II) and part of Ig-III of FGFR1, thus forming a junctional region between 11:111.
  • the antibody molecule binds preferentially to FGFR1L or a fragment thereof, but does not substantially bind to (e.g., shows less than 10%, 8%, 5%, 4%, 3%, 2%, 1% cross-reactivity with) FGFR1 (e.g., non-oncogenic human FGFR1, e.g., FGFR1 isoform 4 (SEQ ID NO: 39), FGFR1 isoform 14 (SEQ ID NO: 40), FGFR1 isoform 16 (SEQ ID NO: 41), FGFR1 isoform 17 (SEQ ID NO: 42), FGFR1 isoform 3 (SEQ ID NO: 43), or FGFR1 isoform 18 (SEQ ID NO: 44).
  • FGFR1 e.g., non-oncogenic human FGFR1, e.g., FGFR1 isoform 4 (SEQ ID NO: 39), FGFR1 isoform 14 (SEQ ID NO: 40), FGFR1 isoform 16
  • the antibody molecule binds specifically to at least one epitope found at the junctional region between Ig-II and Ig-III of SEQ ID NO: 10 or a fragment thereof, or an amino acid sequence encoded by a nucleotide sequence of SEQ ID NO:9 or a fragment thereof; or an amino acid or nucleotide sequence substantially identical thereto.
  • the antibody molecule binds to an isoform, e.g., an oncogenic isoform, of RON receptor tyrosine kinase, e.g., human RON receptor tyrosine kinase.
  • an isoform e.g., an oncogenic isoform
  • the antibody molecule binds specifically to isoform RONA160 having an in-frame deletion of about 109 amino acids skipping exons 5 and 6 of the extracellular domain of RON, thus forming a junctional region between exon 4 and exon 7.
  • the antibody molecule binds preferentially to RONA160 or a fragment thereof, but does not substantially bind to (e.g., shows less than 10%, 8%, 5%, 4%, 3%, 2%, 1 % cross- reactivity with) RON receptor tyrosine kinase (e.g., non-oncogenic human RON receptor tyrosine kinase, e.g., SEQ ID NO: 45).
  • RON receptor tyrosine kinase e.g., non-oncogenic human RON receptor tyrosine kinase, e.g., SEQ ID NO: 45.
  • the antibody molecule binds specifically to at least one epitope found at the junctional region between exon 4 and exon 7 of SEQ ID NO: 12 or a fragment thereof, or an amino acid sequence encoded by a nucleotide sequence of SEQ ID NO: 11 or a fragment thereof; or an amino acid or nucleotide sequence substantially identical thereto.
  • the antibody molecule binds specifically to an isoform, e.g., an oncogenic isoform, of KIT receptor tyrosine kinase, e.g., human KIT receptor tyrosine kinase.
  • an isoform e.g., an oncogenic isoform
  • KIT receptor tyrosine kinase e.g., human KIT receptor tyrosine kinase.
  • the antibody molecule binds specifically to a KIT isoform having a deletion of exon 11.
  • the antibody molecule binds preferentially to exon 11 -deleted KIT isoform (SEQ ID NO: 46) or a fragment thereof, but does not substantially bind to (e.g., shows less than 10%, 8%, 5%, 4%, 3%, 2%, 1% cross-reactivity with) KIT (e.g., non-oncogenic human KIT, e.g., full-length receptor (SEQ ID NO: 47)).
  • KIT e.g., non-oncogenic human KIT, e.g., full-length receptor (SEQ ID NO: 47)
  • the antibody molecule binds specifically to at least one epitope found at the junctional region between exons 10 and 12 of SEQ ID NO: 14 or a fragment thereof, or an amino acid sequence encoded by a nucleotide sequence of SEQ ID NO: 13 or a fragment thereof; or an amino acid or nucleotide sequence substantially identical thereto.
  • the antibody molecule binds specifically to an isoform, e.g., an oncogenic isoform, of PDGF, e.g., human PDGF.
  • an isoform e.g., an oncogenic isoform
  • the antibody molecule binds specifically to a PDGF isoform having an in-frame deletion of exon 6.
  • the antibody molecule binds preferentially to exon 6-deleted PDGF isoform or a fragment thereof, but does not substantially bind to (e.g., shows less than 10%, 8%, 5%, 4%, 3%, 2%, 1% cross-reactivity with) PDGF (e.g., non-oncogenic human PDGF, e.g., PDGF isoform 1 (SEQ ID NO: 49)).
  • PDGF e.g., non-oncogenic human PDGF, e.g., PDGF isoform 1 (SEQ ID NO: 49)
  • the antibody molecule binds specifically to at least one epitope found at the junctional region between exons 5 and 7 of SEQ ID NO: 16 or a fragment thereof, or an amino acid sequence encoded by a nucleotide sequence of SEQ ID NO: 15 or a fragment thereof; or an amino acid or nucleotide sequence substantially identical thereto.
  • the antibody molecule binds specifically to an isoform, e.g., an oncogenic isoform, of PDGF receptor alpha, e.g., human PDGF receptor alpha.
  • an isoform e.g., an oncogenic isoform
  • the antibody molecule binds specifically to a PDGFR-alpha isoform having an in-frame deletion of exons 7 and 8.
  • the antibody molecule binds preferentially to exon 7/8-deleted PDGFR-alpha isoform (SEQ ID NO: 51) or a fragment thereof, but does not substantially bind to (e.g., shows less than 10%, 8%, 5%, 4%, 3%, 2%, 1% cross-reactivity with) PDGFR-alpha (e.g., non-oncogenic human PDGFR-alpha, e.g., PDGFR-alpha isoform 1 (SEQ ID NO: 50)
  • the antibody molecule binds specifically to at least one epitope found at the junctional region between exons 6 and 9 of SEQ ID NO: 18 or a fragment thereof, or an amino acid sequence encoded by a nucleotide sequence of SEQ ID NO: 17 or a fragment thereof; or an amino acid or nucleotide sequence substantially identical thereto.
  • antibody molecule refers to a protein comprising at least one immunoglobulin variable domain sequence.
  • the term antibody molecule includes, for example, full- length, mature antibodies and antigen-binding fragments of an antibody.
  • an antibody molecule can include a heavy (H) chain variable domain sequence (abbreviated herein as VH), and a light (L) chain variable domain sequence (abbreviated herein as VL).
  • an antibody molecule in another example, includes two heavy (H) chain variable domain sequences and two light (L) chain variable domain sequence, thereby forming two antigen binding sites, such as Fab, Fab', F(ab') 2 , Fc, Fd, Fd', Fv, single chain antibodies (scFv for example), single variable domain antibodies, diabodies (Dab) (bivalent and bispecific), and chimeric (e.g., humanized) antibodies, which may be produced by the modification of whole antibodies or those synthesized de novo using recombinant DNA technologies. These functional antibody fragments retain the ability to selectively bind with their respective antigen or receptor.
  • Antibodies and antibody fragments can be from any class of antibodies including, but not limited to, IgG, IgA, IgM, IgD, and IgE, and from any subclass (e.g., IgGl, IgG2, IgG3, and IgG4) of antibodies.
  • the antibodies of the present invention can be monoclonal or polyclonal.
  • the antibody can also be a human, humanized, CDR-grafted, or in vitro generated antibody.
  • the antibody can have a heavy chain constant region chosen from, e.g., IgGl, IgG2, IgG3, or IgG4.
  • the antibody can also have a light chain chosen from, e.g., kappa or lambda.
  • antigen-binding fragments include: (i) a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CHI domains; (ii) a F(ab')2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the VH and CHI domains; (iv) a Fv fragment consisting of the VL and VH domains of a single arm of an antibody, (v) a diabody (dAb) fragment, which consists of a VH domain; (vi) a camelid or camelized variable domain; (vii) a single chain Fv (scFv), see e.g., Bird et al.
  • a Fab fragment a monovalent fragment consisting of the VL, VH, CL and CHI domains
  • a F(ab')2 fragment a bivalent fragment comprising two Fab fragments linked by a
  • antibody includes intact molecules as well as functional fragments thereof. Constant regions of the antibodies can be altered, e.g., mutated, to modify the properties of the antibody (e.g., to increase or decrease one or more of: Fc receptor binding, antibody glycosylation, the number of cysteine residues, effector cell function, or complement function).
  • Antibodies of the present invention can also be single domain antibodies.
  • Single domain antibodies can include antibodies whose complementary determining regions are part of a single domain polypeptide. Examples include, but are not limited to, heavy chain antibodies, antibodies naturally devoid of light chains, single domain antibodies derived from conventional 4-chain antibodies, engineered antibodies and single domain scaffolds other than those derived from antibodies.
  • Single domain antibodies may be any of the art, or any future single domain antibodies.
  • Single domain antibodies may be derived from any species including, but not limited to mouse, human, camel, llama, fish, shark, goat, rabbit, and bovine.
  • a single domain antibody is a naturally occurring single domain antibody known as heavy chain antibody devoid of light chains. Such single domain antibodies are disclosed in WO 9404678, for example. For clarity reasons, this variable domain derived from a heavy chain antibody naturally devoid of light chain is known herein as a VHH or nanobody to distinguish it from the conventional VH of four chain
  • VHHs immunoglobulins.
  • VHH molecule can be derived from antibodies raised in Camelidae species, for example in camel, llama, dromedary, alpaca and guanaco.
  • Other species besides Camelidae may produce heavy chain antibodies naturally devoid of light chain; such VHHs are within the scope of the invention.
  • VH and VL regions can be subdivided into regions of hypervariability, termed
  • CDR complementarity determining regions
  • FR framework regions
  • Each VH and VL typically includes three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
  • an "immunoglobulin variable domain sequence” refers to an amino acid sequence which can form the structure of an immunoglobulin variable domain.
  • the sequence may include all or part of the amino acid sequence of a naturally- occurring variable domain.
  • the sequence may or may not include one, two, or more N- or C-terminal amino acids, or may include other alterations that are compatible with formation of the protein structure.
  • antigen-binding site refers to the part of an antibody molecule that comprises determinants that form an interface that binds to the isoform polypeptide, or an epitope thereof.
  • the antigen-binding site typically includes one or more loops (of at least four amino acids or amino acid mimics) that form an interface that binds to the isoform polypeptide.
  • the antigen-binding site of an antibody molecule includes at least one or two CDRs, or more typically at least three, four, five or six CDRs.
  • monoclonal antibody or “monoclonal antibody composition” as used herein refer to a preparation of antibody molecules of single molecular composition.
  • a monoclonal antibody composition displays a single binding specificity and affinity for a particular epitope.
  • a monoclonal antibody can be made by hybridoma technology or by methods that do not use hybridoma technology (e.g., recombinant methods).
  • An "effectively human” protein is a protein that does not evoke a neutralizing antibody response, e.g., the human anti-murine antibody (HAMA) response.
  • HAMA can be problematic in a number of circumstances, e.g., if the antibody molecule is administered repeatedly, e.g., in treatment of a chronic or recurrent disease condition.
  • a HAMA response can make repeated antibody administration potentially ineffective because of an increased antibody clearance from the serum (see, e.g., Saleh et al., Cancer Immunol. Immunother., 32: 180-190 (1990)) and also because of potential allergic reactions (see, e.g., LoBuglio et al., Hybridoma, 5:5117-5123 (1986)).
  • the anti-isoform antibody can be a polyclonal or a monoclonal antibody.
  • the antibody can be recombinantly produced, e.g., produced by phage display or by combinatorial methods.
  • Phage display and combinatorial methods for generating anti-isoform antibodies are known in the art (as described in, e.g., Ladner et al. U.S. Patent No. 5,223,409; Kang et al. International
  • the anti-isoform antibody is a fully human antibody (e.g., an antibody made in a mouse which has been genetically engineered to produce an antibody from a human
  • the immunoglobulin sequence or a non-human antibody, e.g., a rodent (mouse or rat), goat, primate (e.g., monkey), camel antibody.
  • a rodent mouse or rat
  • primate e.g., monkey
  • camel antibody e.g., camel
  • the non-human antibody is a rodent (mouse or rat antibody).
  • Human monoclonal antibodies can be generated using transgenic mice carrying the human immunoglobulin genes rather than the mouse system. Splenocytes from these transgenic mice immunized with the antigen of interest are used to produce hybridomas that secrete human mAbs with specific affinities for epitopes from a human protein (see, e.g., Wood et al. International Application
  • An anti-isoform antibody can be one in which the variable region, or a portion thereof, e.g., the CDRs, are generated in a non-human organism, e.g., a rat or mouse. Chimeric, CDR-grafted, and humanized antibodies are within the invention. Antibodies generated in a non-human organism, e.g., a rat or mouse, and then modified, e.g., in the variable framework or constant region, to decrease antigenicity in a human are within the invention.
  • Chimeric antibodies can be produced by recombinant DNA techniques known in the art. For example, a gene encoding the Fc constant region of a murine (or other species) monoclonal antibody molecule is digested with restriction enzymes to remove the region encoding the murine Fc, and the equivalent portion of a gene encoding a human Fc constant region is substituted (see Robinson et al., International Patent Publication PCT/US86/02269; Akira, et al, European Patent Application 184,187; Taniguchi, M., European Patent Application 171,496; Morrison et al., European Patent Application 173,494; Neuberger et al., International Application WO 86/01533; Cabilly et al. U.S. Patent No.
  • a humanized or CDR-grafted antibody will have at least one or two but generally all three recipient CDRs (of heavy and or light immuoglobulin chains) replaced with a donor CDR.
  • the antibody may be replaced with at least a portion of a non-human CDR or only some of the CDRs may be replaced with non-human CDRs. It is only necessary to replace the number of CDRs required for binding of the humanized antibody to an isoform.
  • the donor will be a rodent antibody, e.g., a rat or mouse antibody
  • the recipient will be a human framework or a human consensus framework.
  • the immunoglobulin providing the CDRs is called the "donor” and the immunoglobulin providing the framework is called the “acceptor.”
  • the donor immunoglobulin is a non-human (e.g., rodent).
  • the acceptor framework is a naturally-occurring (e.g., a human) framework or a consensus framework, or a sequence about 85% or higher, preferably 90%, 95%, 99% or higher identical thereto.
  • Consensus sequence refers to the sequence formed from the most frequently occurring amino acids (or nucleotides) in a family of related sequences (See e.g., Winnaker, From Genes to Clones (Verlagsgesellschaft, Weinheim, Germany 1987). In a family of proteins, each position in the consensus sequence is occupied by the amino acid occurring most frequently at that position in the family. If two amino acids occur equally frequently, either can be included in the consensus sequence.
  • a “consensus framework” refers to the framework region in the consensus immunoglobulin sequence.
  • An antibody can be humanized by methods known in the art. Humanized antibodies can be generated by replacing sequences of the Fv variable region which are not directly involved in antigen binding with equivalent sequences from human Fv variable regions.
  • General methods for generating humanized antibodies are provided by Morrison, S. L., 1985, Science 229: 1202-1207, by Oi et al., 1986, BioTechniques 4:214, and by Queen et al. US 5,585,089, US 5,693,761 and US 5,693,762, the contents of all of which are hereby incorporated by reference. Those methods include isolating, manipulating, and expressing the nucleic acid sequences that encode all or part of immunoglobulin Fv variable regions from at least one of a heavy or light chain.
  • Sources of such nucleic acid are known to those skilled in the art and, for example, may be obtained from a hybridoma producing an antibody against the isoform.
  • the recombinant DNA encoding the humanized antibody, or fragment thereof, can be cloned into an appropriate expression vector.
  • Humanized or CDR-grafted antibodies can be produced by CDR-grafting or CDR substitution, wherein one, two, or all CDRs of an immunoglobulin chain can be replaced.
  • CDR-grafting or CDR substitution wherein one, two, or all CDRs of an immunoglobulin chain can be replaced.
  • U.S. Patent 5,225,539 Jones et al. 1986 Nature 321:552-525; Verhoeyan et al. 1988 Science 239: 1534; Beidler et al. 1988 /. Immunol. 141 :4053-4060; Winter US 5,225,539, the contents of all of which are hereby expressly incorporated by reference.
  • Winter describes a CDR-grafting method which may be used to prepare the humanized antibodies of the present invention (UK Patent Application GB 2188638A, filed on March 26, 1987; Winter US 5,225,539), the contents of which is expressly incorporated by reference.
  • humanized antibodies in which specific amino acids have been substituted, deleted or added.
  • Preferred humanized antibodies have amino acid substitutions in the framework region, such as to improve binding to the antigen.
  • a humanized antibody will have framework residues identical to the donor framework residue or to another amino acid other than the recipient framework residue.
  • a selected, small number of acceptor framework residues of the humanized immunoglobulin chain can be replaced by the corresponding donor amino acids.
  • Preferred locations of the substitutions include amino acid residues adjacent to the CDR, or which are capable of interacting with a CDR (see e.g., US 5,585,089).
  • an antibody can be made by immunizing with purified anti-isoform antigen, or a fragment or epitope thereof, e.g., a fragment described herein, membrane associated antigen, tissue, e.g., crude tissue preparations, whole cells, preferably living cells, lysed cells, or cell fractions, e.g., membrane fractions.
  • the anti-isoform antibody can be a single chain antibody.
  • a single-chain antibody (scFV) may be engineered (see, for example, Colcher, D. et al. (1999) Ann N Y Acad Sci 880:263-80; and Reiter, Y. (1996) Clin Cancer Res 2:245-52).
  • the single chain antibody can be dimerized or multimerized to generate multivalent antibodies having specificities for different epitopes of the same target isoform protein.
  • the antibody molecule has a heavy chain constant region chosen from, e.g., the heavy chain constant regions of IgGl, IgG2, IgG3, IgG4, IgM, IgAl, IgA2, IgD, and IgE;
  • the antibody molecule has a light chain constant region chosen from, e.g., the (e.g., human) light chain constant regions of kappa or lambda.
  • the constant region can be altered, e.g., mutated, to modify the properties of the antibody (e.g., to increase or decrease one or more of: Fc receptor binding, antibody glycosylation, the number of cysteine residues, effector cell function, and/or complement function).
  • the antibody has: effector function; and can fix complement.
  • the antibody does not; recruit effector cells; or fix complement.
  • the antibody has reduced or no ability to bind an Fc receptor.
  • it is a isotype or subtype, fragment or other mutant, which does not support binding to an Fc receptor, e.g., it has a mutagenized or deleted Fc receptor binding region.
  • Antibodies with altered function e.g. altered affinity for an effector ligand, such as FcR on a cell, or the CI
  • component of complement can be produced by replacing at least one amino acid residue in the constant portion of the antibody with a different residue (see e.g., EP 388,151 Al, U.S. Pat. No.
  • An isoform-specific inhibitor e.g., an isoform-binding molecule
  • can be derivatized or linked to another functional molecule e.g., another peptide or protein.
  • another functional molecule e.g., another peptide or protein.
  • “derivatized” antibody molecule is one that has been modified. Methods of derivatization include but are not limited to the addition of a fluorescent moiety, a radionucleotide, a toxin, an enzyme or an affinity ligand such as biotin. Accordingly, the antibody molecules of the invention are intended to include derivatized and otherwise modified forms of the antibodies described herein, including immunoadhesion molecules.
  • an antibody molecule can be functionally linked (by chemical coupling, genetic fusion, noncovalent association or otherwise) to one or more other molecular entities, such as another antibody (e.g., a bispecific antibody or a diabody), a detectable agent, a cytotoxic agent, a pharmaceutical agent, and/or a protein or peptide that can mediate association of the antibody or antibody portion with another molecule (such as a streptavidin core region or a polyhistidine tag).
  • another antibody e.g., a bispecific antibody or a diabody
  • detectable agent e.g., a detectable agent, a cytotoxic agent, a pharmaceutical agent, and/or a protein or peptide that can mediate association of the antibody or antibody portion with another molecule (such as a streptavidin core region or a polyhistidine tag).
  • One type of derivatized antibody molecule is produced by crosslinking two or more antibodies (of the same type or of different types, e.g., to create bispecific antibodies).
  • Suitable crosslinkers include those that are heterobifunctional, having two distinctly reactive groups separated by an appropriate spacer (e.g., m-maleimidobenzoyl-N-hydroxysuccinimide ester) or homobifunctional (e.g. , disuccinimidyl suberate).
  • an appropriate spacer e.g., m-maleimidobenzoyl-N-hydroxysuccinimide ester
  • homobifunctional e.g. , disuccinimidyl suberate
  • Exemplary fluorescent detectable agents include fluorescein, fluorescein isothiocyanate, rhodamine, 5dimethylamine- l-napthalenesulfonyl chloride, phycoerythrin and the like.
  • An antibody may also be derivatized with detectable enzymes, such as alkaline phosphatase, horseradish peroxidase, ⁇ -galactosidase, acetylcholinesterase, glucose oxidase and the like.
  • detectable enzymes such as alkaline phosphatase, horseradish peroxidase, ⁇ -galactosidase, acetylcholinesterase, glucose oxidase and the like.
  • detectable enzymes such as alkaline phosphatase, horseradish peroxidase, ⁇ -galactosidase, acetylcholinesterase, glucose oxidase and the like.
  • an antibody is derivatized with a detectable enzyme, it is detected by adding additional reagents that the enzyme uses to produce a detectable reaction product.
  • the detectable agent horseradish peroxidase is present, the addition of hydrogen peroxide and diaminobenzidine leads to a
  • an antibody may be derivatized with biotin, and detected through indirect measurement of avidin or streptavidin binding.
  • suitable fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin; an example of a luminescent material includes luminol; and examples of bioluminescent materials include luciferase, luciferin, and aequorin.
  • Labeled antibody molecule can be used, for example, diagnostically and/or
  • An anti-isoform antibody molecules may be conjugated to another molecular entity, typically a label or a therapeutic (e.g., a cytotoxic or cytostatic) agent or moiety.
  • Radioactive isotopes can be used in diagnostic or therapeutic applications. Radioactive isotopes that can be coupled to the anti-PSMA antibodies include, but are not limited to ⁇ -, ⁇ -, or ⁇ -emitters, or ⁇ -and ⁇ -emitters.
  • radioactive isotopes include, but are not limited to iodine ( 131 I or 125 I), yttrium ( 90 Y), lutetium ( 177 Lu), actinium ( 225 Ac), praseodymium, astatine ( 211 At), rhenium ( 186 Re), bismuth ( 212 Bi or 213 Bi), indium ( U 1 ln), technetium (" mTc), phosphorus ( 32 P), rhodium ( 188 Rh), sulfur ( 35 S) , carbon ( 14 C), tritium ( 3 H), chromium ( 51 Cr), chlorine ( 36 C1), cobalt
  • Radioisotopes useful as labels include iodine ( 131 I or 125 I), indium ( U 1 ln), technetium ("mTc), phosphorus ( 32 P), carbon ( 14 C), and tritium ( 3 H), or one or more of the therapeutic isotopes listed above.
  • the invention provides radiolabeled antibody molecules and methods of labeling the same.
  • a method of labeling an antibody molecule is disclosed. The method includes contacting an antibody molecule, with a chelating agent, to thereby produce a conjugated antibody.
  • the conjugated antibody is radiolabeled with a radioisotope, e.g., u l Indium, 90 Yttrium and 177 Lutetium, to thereby produce a labeled antibody molecule.
  • the antibody molecule can be conjugated to a therapeutic agent.
  • therapeutically active radioisotopes have already been mentioned.
  • examples of other therapeutic agents include taxol, cytochalasin B, gramicidin D, ethidium bromide, emetine, mitomycin, etoposide, tenoposide, vincristine, vinblastine, colchicine, doxorubicin,
  • daunorubicin dihydroxy anthracin dione, mitoxantrone, mithramycin, actinomycin D, 1- dehydrotestosterone, glucocorticoids, procaine, tetracaine, lidocaine, propranolol, puromycin, maytansinoids, e.g., maytansinol (see U.S. Pat. No. 5,208,020), CC-1065 (see U.S. Pat. Nos. 5,475,092, 5,585,499, 5,846, 545) and analogs or homologs thereof.
  • Therapeutic agents include, but are not limited to, antimetabolites (e.g., methotrexate, 6-mercaptopurine, 6-thioguanine, cytarabine, 5-fluorouracil decarbazine), alkylating agents (e.g., mechlorethamine, thioepa chlorambucil, CC- 1065, melphalan, carmustine (BSNU) and lomustine (CCNU),
  • antimetabolites e.g., methotrexate, 6-mercaptopurine, 6-thioguanine, cytarabine, 5-fluorouracil decarbazine
  • alkylating agents e.g., mechlorethamine, thioepa chlorambucil, CC- 1065, melphalan, carmustine (BSNU) and lomustine (CCNU)
  • cyclothosphamide busulfan, dibromomannitol, streptozotocin, mitomycin C, and cis- dichlorodiamine platinum (II) (DDP) cisplatin), anthracyclinies (e.g., daunorubicin (formerly daunomycin) and doxorubicin), antibiotics (e.g., dactinomycin (formerly actinomycin),
  • bleomycin bleomycin, mithramycin, and anthramycin (AMC)
  • anti-mitotic agents e.g., vincristine, vinblastine, taxol and maytansinoids.
  • the conjugates of the invention can be used for modifying a given biological response.
  • the therapeutic agent is not to be construed as limited to classical chemical therapeutic agents.
  • the therapeutic agent may be a protein or polypeptide possessing a desired
  • Such proteins may include, for example, a toxin such as abrin, ricin A,
  • pseudomonas exotoxin diphtheria toxin, or a component thereof (e.g., a component of
  • pseudomonas exotoxin is PE38; a protein such as tumor necrosis factor, interferon, nerve
  • lymphokines interleukin- 1
  • IL- 2 interleukin-2
  • IL-6 interleukin-6
  • GM-CSF granulocyte macrophase colony stimulating factor
  • G-CSF granulocyte colony stimulating factor
  • therapeutic agent can be a viral particle, e.g., a recombinant viral particle, that is conjugated
  • an anti-isoform antibody of the invention e.g., via a chemical linker or fused (e.g., via a viral coat protein) to an anti-isoform antibody of the invention.
  • the invention features a method of providing a target binding molecule that specifically binds to an isoform receptor.
  • the target binding molecule is an antibody molecule.
  • the method includes: providing a target protein that comprises at least a portion of non- human protein, the portion being homologous to (at least 70, 75, 80, 85, 87, 90, 92, 94, 95, 96, 97, 98% identical to) a corresponding portion of a human target protein, but differing by at least one amino acid (e.g., at least one, two, three, four, five, six, seven, eight, or nine amino acids); obtaining an antibody molecule that specifically binds to the antigen; and evaluating efficacy of the binding agent in modulating activity of the target protein.
  • at least one amino acid e.g., at least one, two, three, four, five, six, seven, eight, or nine amino acids
  • the method can further include administering the binding agent (e.g., antibody molecule) or a derivative (e.g., a humanized antibody molecule) to a human subject.
  • the binding agent e.g., antibody molecule
  • a derivative e.g., a humanized antibody molecule
  • This invention provides an isolated nucleic acid molecule encoding the above antibody molecule, vectors and host cells thereof.
  • the nucleic acid molecule includes but is not limited to RNA, genomic DNA and cDNA. Soluble Receptors and Fusions Thereof
  • the isoform- specific inhibitor is a full length or a fragment of an isoform receptor polypeptide, e.g., an inhibitory ligand-binding domain of an isoform receptor polypeptide.
  • the isoform- specific inhibitor can be a soluble form of an FGFR2 isoform IIIc receptor (e.g., a soluble form of mammalian (e.g., human) FGFR2 isoform IIIc comprising a ligand (e.g., FGF)-binding domain.
  • the isoform- specific inhibitor can include about amino acids 1 to 262 of human FGFR2 isoform IIIc receptor (FIG.
  • the isoform-specific inhibitor can include an amino acid sequence encoded by the nucleotide sequence from about nucleotides 1 to 786 of human FGFR2 isoform IIIc (FIG. 13B; nucleotides 1-786 of SEQ ID NO: 54); or an amino acid sequence substantially identical thereto.
  • a "soluble form of an FGFR2 isoform IIIc receptor " or a "soluble form of an isoform receptor polypeptide” is a receptor isoform, e.g., an FGFR2 isoform IIIc receptor polypeptide incapable of anchoring itself in a membrane.
  • Such soluble polypeptides include, for example, an isoform receptor polypeptide, e.g., an FGFR2 isoform IIIc receptor polypeptide, as described herein that lack a sufficient portion of their membrane spanning domain to anchor the polypeptide or are modified such that the membrane spanning domain is non-functional.
  • the soluble isoform receptor polypeptide retains the ability of binding to an isoform ligand, e.g., an FGF ligand.
  • an isoform ligand e.g., an FGF ligand.
  • a soluble fragment of an FGFR2 isoform IIIc receptor polypeptide e.g., a fragment of an FGFR2 isoform IIIc receptor comprising the extracellular domain of human FGFR2 isoform IIIc receptor, including about amino acids 1 to 262 of human FGFR2 isoform IIIc receptor (FIG. 13C; amino acids 1-262 of SEQ ID NO: 55, including the signal sequence); or an amino acid sequence substantially identical thereto.
  • a soluble FGFR2 isoform IIIc receptor polypeptide can additionally include, e.g., be fused to, a second moiety, e.g., a polypeptide (e.g., an immunoglobulin chain, a GST, Lex-A or MBP polypeptide sequence).
  • a polypeptide e.g., an immunoglobulin chain, a GST, Lex-A or MBP polypeptide sequence.
  • a fusion protein can includes at least a fragment of an FGFR2 isoform IIIc receptor polypeptide, which is capable of binding an FGF ligand, fused to a second moiety, e.g., a polypeptide (e.g., an immunoglobulin chain, an Fc fragment, a heavy chain constant regions of the various isotypes, including: IgGl, IgG2, IgG3, IgG4, IgM, IgAl, IgA2, IgD, and IgE).
  • a polypeptide e.g., an immunoglobulin chain, an Fc fragment, a heavy chain constant regions of the various isotypes, including: IgGl, IgG2, IgG3, IgG4, IgM, IgAl, IgA2, IgD, and IgE).
  • a soluble form of an isoform receptor polypeptide can be used alone or functionally linked (e.g., by chemical coupling, genetic or polypeptide fusion, non-covalent association or otherwise) to a second moiety, e.g., an immunoglobulin Fc domain, serum albumin, pegylation, a GST, Lex-A or an MBP polypeptide sequence.
  • a "fusion protein” refers to a protein containing two or more operably associated, e.g., linked, moieties, e.g., protein moieties. Typically, the moieties are covalently associated.
  • the moieties can be directly associated, or connected via a spacer or linker.
  • the fusion proteins may additionally include a linker sequence joining the first moiety, e.g., a soluble isoform receptor, to the second moiety.
  • the fusion protein can include a peptide linker, e.g., a peptide linker of about 4 to 20, more preferably, 5 to 10, amino acids in length; the peptide linker is 8 amino acids in length.
  • Each of the amino acids in the peptide linker is selected from the group consisting of Gly, Ser, Asn, Thr and Ala; the peptide linker includes a Gly-Ser element.
  • the fusion protein includes a peptide linker and the peptide linker includes a sequence having the formula (Ser-Gly-Gly-Gly-Gly)y wherein y is 1, 2, 3, 4, 5, 6, 7, or 8 (SEQ ID NOs: 73-80).
  • a soluble form of an isoform receptor polypeptide can be fused to a heavy chain constant region of the various isotypes, including: IgGl, IgG2, IgG3, IgG4, IgM, IgAl, IgA2, IgD, and IgE).
  • the fusion protein can include the extracellular domain of a human FGFR2 isoform IIIc receptor (or a sequence homologous thereto), and, e.g., fused to, a human immunoglobulin Fc chain, e.g., human IgG (e.g., human IgGl or human IgG2, or a mutated form thereof).
  • the Fc sequence can be mutated at one or more amino acids to enhance or reduce effector cell function, Fc receptor binding and/or complement activity.
  • the constant region is mutated at positions 296 (M to Y), 298 (S to T), 300 (T to E), 477 (H to K) and 478 (N to F) of SEQ ID NO: 55 to alter Fc receptor binding.
  • One exemplary fusion protein that includes the amino acid sequence from about amino acids 1 to 262 of human FGFR2 isoform IIIc receptor (FIG. 13C; amino acids 1-262 of SEQ ID NO: 55) fused via an Arg-Ser linker to a human IgGl Fc is shown in FIG. 13C (SEQ ID NO: 55).
  • additional amino acid sequences can be added to the N- or C- terminus of the fusion protein to facilitate expression, detection and/or isolation or purification.
  • the fusion protein may be linked to one or more additional moieties, e.g., GST, His6 tag (His- His-His-His-His-His; SEQ ID NO: 81), FLAG tag.
  • the fusion protein may additionally be linked to a GST fusion protein in which the fusion protein sequences are fused to the C-terminus of the GST (i.e., glutathione S-transferase) sequences.
  • Such fusion proteins can facilitate the purification of the receptor fusion protein.
  • the fusion protein is includes a heterologous signal sequence (i.e., a polypeptide sequence that is not present in a polypeptide encoded by a receptor nucleic acid) at its N- terminus.
  • a heterologous signal sequence i.e., a polypeptide sequence that is not present in a polypeptide encoded by a receptor nucleic acid
  • the native receptor signal sequence can be removed and replaced with a signal sequence from another protein.
  • expression and/or secretion of receptor can be increased through use of a heterologous signal sequence.
  • a chimeric or fusion protein of the invention can be produced by standard recombinant DNA techniques. For example, DNA fragments coding for the different polypeptide sequences are ligated together in-frame in accordance with conventional techniques, e.g., by employing blunt-ended or stagger-ended termini for ligation, restriction enzyme digestion to provide for appropriate termini, filling-in of cohesive ends as appropriate, alkaline phosphatase treatment to avoid undesirable joining, and enzymatic ligation.
  • the fusion gene can be synthesized by conventional techniques including automated DNA synthesizers.
  • PCR amplification of gene fragments can be carried out using anchor primers that give rise to complementary overhangs between two consecutive gene fragments that can subsequently be annealed and reamplified to generate a chimeric gene sequence (see, for example, Ausubel et al. (eds.) Current Protocols in Molecular Biology, John Wiley & Sons, 1992).
  • anchor primers that give rise to complementary overhangs between two consecutive gene fragments that can subsequently be annealed and reamplified to generate a chimeric gene sequence
  • many expression vectors are commercially available that encode a fusion moiety (e.g., an Fc region of an immunoglobulin heavy chain).
  • a receptor encoding nucleic acid can be cloned into such an expression vector such that the fusion moiety is linked in-frame to the immunoglobulin protein.
  • receptor fusion polypeptides exist as oligomers, such as dimers or trimers.
  • the receptor polypeptide moiety is provided as a variant receptor polypeptide having a mutation in the naturally- occurring receptor sequence (wild type) that results in higher affinity (relative to the non-mutated sequence) binding of the receptor polypeptide to a corresponding ligand.
  • additional amino acid sequences can be added to the N- or C-terminus of the fusion protein to facilitate expression, steric flexibility, detection and/or isolation or purification.
  • the second polypeptide is preferably soluble.
  • the second polypeptide enhances the half-life, (e.g., the serum half-life) of the linked polypeptide.
  • the second polypeptide includes a sequence that facilitates association of the fusion polypeptide with a second polypeptide.
  • the second polypeptide includes at least a region of an immunoglobulin polypeptide. Immunoglobulin fusion polypeptides are known in the art and are described in e.g., U.S. Pat. Nos.
  • a soluble form of a receptor can be fused to a heavy chain constant region of the various isotypes, including: IgGl, IgG2, IgG3, IgG4, IgM, IgAl, IgA2, IgD, and IgE).
  • the fusion protein can include the extracellular domain of a human receptor (or a sequence homologous thereto), and, e.g., fused to, a human immunoglobulin Fc chain, e.g., human IgG (e.g., human IgGl or human IgG2, or a mutated form thereof).
  • a human immunoglobulin Fc chain e.g., human IgG (e.g., human IgGl or human IgG2, or a mutated form thereof).
  • the Fc sequence can be mutated at one or more amino acids to reduce effector cell function, Fc receptor binding and/or complement activity.
  • Methods for altering an antibody constant region are known in the art.
  • Antibodies with altered function e.g. altered affinity for an effector ligand, such as FcR on a cell, or the CI component of complement can be produced by replacing at least one amino acid residue in the constant portion of the antibody with a different residue (see e.g., EP 388, 151 Al, U.S. Pat. No. 5,624,821 and U.S. Pat. No. 5,648,260). Similar type of alterations could be described which if applied to the murine, or other species immunoglobulin would increase or decrease these functions.
  • an Fc region of an antibody e.g., an IgG, such as a human IgG
  • FcR e.g. , Fc gamma Rl
  • Clq binding by replacing the specified residue(s) with a residue(s) having an appropriate functionality on its side chain, or by introducing a charged functional group, such as glutamate or aspartate, or perhaps an aromatic non-polar residue such as phenylalanine, tyrosine, tryptophan or alanine (see e.g., U.S. Pat. No. 5,624,821).
  • the second polypeptide has less effector function that the effector function of a Fc region of a wild-type immunoglobulin heavy chain.
  • Fc effector function includes for example, Fc receptor binding, complement fixation and T cell depleting activity (see for example, U.S. Pat. No. 6,136,310). Methods for assaying T cell depleting activity, Fc effector function, and antibody stability are known in the art.
  • the second polypeptide has low or no detectable affinity for the Fc receptor. In an alternative embodiment, the second polypeptide has low or no detectable affinity for complement protein Clq.
  • the second polypeptide has increased effector cell function, e.g., increased binding to an Fc receptor (e.g., FcyRI, FcyRIIA, FcyRIIB, FcyRIIIA and FcRn receptors) as described in, for example, Shields et al. (JBC, 276:6591-6604, 2001) and US 6,737,056.
  • Fc receptor e.g., FcyRI, FcyRIIA, FcyRIIB, FcyRIIIA and FcRn receptors
  • antibody molecules and soluble receptor or fusion proteins described herein can be functionally linked (e.g., by chemical coupling, genetic fusion, non-covalent association or otherwise) to one or more other molecular entities, such as an antibody (e.g., a bispecific or a multispecific antibody), toxins, radioisotopes, cytotoxic or cytostatic agents, among others.
  • an antibody e.g., a bispecific or a multispecific antibody
  • toxins e.g., a bispecific or a multispecific antibody
  • radioisotopes e.g., cytotoxic or cytostatic agents, among others.
  • the isoform- specific inhibitor includes a peptide or a
  • an "analog" of a peptide refers to a compound wherein the amino acid sequence of the compound is the same as that of the peptide except for up to 10, typically up to 8, up to 6, up to 5, up to 4, up to 3, up to 2, or up to 1 amino acid insertions, deletions, and/or substitutions of the amino acid sequence of the peptide.
  • an analog binds to the same biological receptor as the peptide and thus displays at least some of the biological activity of the peptide.
  • the peptide may be "derivatized” or linked to another functional molecule (e.g.,
  • a carrier protein e.g., a carrier protein
  • a fluorescent moiety e.g., a radionucleotide, a toxin, an enzyme, polyethylene glycol (PEG), or an affinity ligand such as biotin.
  • PEG polyethylene glycol
  • carrier protein is a protein or peptide that improves the
  • KLH keyhole limpet hemocyanin
  • BSA bovine serum albumin
  • examples include secretory alkaline phosphatase (SEAP), horseradish peroxidase, luciferase, beta-galactosidase, IgG Fc (gamma chain), Glutathione-S-Transferase (GST), polyhistidine containing tags and other enzymes like beta-lactamase, other secretary proteins or peptides.
  • SEAP secretory alkaline phosphatase
  • SEAP secretory alkaline phosphatase
  • luciferase luciferase
  • beta-galactosidase beta-galactosidase
  • IgG Fc gamma chain
  • GST Glutathione-S-Transferase
  • polyhistidine containing tags and other enzymes like beta-lactamase, other secretary proteins or peptides.
  • a modified peptide, conjugate or compound of the invention comprises a reactive group covalently attached to the peptide or protein.
  • the reactive group is chosen for its ability to form a stable covalent bond with a serum protein or peptide, for example, by reacting with one or more amino groups, hydroxyl groups, or thiol groups on the serum protein or peptide.
  • a reactive group reacts with only one amino group, hydroxyl group, or thiol group on the serum protein or peptide.
  • a reactive group reacts with a specific amino group, hydroxyl group, or thiol group on the serum protein or peptide.
  • a conjugate of the invention comprises a modified peptide, which is covalently attached to a serum protein or peptide via a reaction of the reactive group with an amino group, hydroxyl group, or thiol group on the serum protein or peptide.
  • a conjugate of the invention comprises a modified peptide, in which a residue of the reactive group has formed a covalent bond to a serum protein or peptide.
  • a residue of a reactive group or "a reactive group residue” refers to the chemical structure resulting from covalent bond formation between the reactive group and another moiety, e.g., a peptide or protein present in blood.
  • the reactive group is a maleimide containing group selected from gamma-maleimide-butrylamide (GMBA), maleimido propionic acid (MPA), N- hydroxysuccinimide (NHS), N-hydroxy-sulfosuccinimide (sulfo-NHS), maleimide-benzoyl- succinimide (MBS) and gamma-maleimido-butyryloxy succinimide ester (GMBS).
  • GMBA gamma-maleimide-butrylamide
  • MSA maleimido propionic acid
  • NHS N- hydroxysuccinimide
  • sulfo-NHS N-hydroxy-sulfosuccinimide
  • MBS maleimide-benzoyl- succinimide
  • GMBS gamma-maleimido-butyryloxy succinimide ester
  • the peptides of the invention may be synthesized by standard methods of solid or solution phase peptide chemistry.
  • a summary of the solid phase techniques may be found in Stewart and Young (1963) Solid Phase Peptide Synthesis, W. H. Freeman Co. (San Francisco), and Meienhofer (1973) Hormonal Proteins and Peptides, Academic Press (New York).
  • For classical solution synthesis see Schroder and Lupke, The Peptides, Vol. 1, Academic Press (New York).
  • these methods comprise the sequential addition of one or more amino acids or suitably protected amino acids to a growing peptide chain.
  • a suitable protecting group either the amino or carboxyl group of the first amino acid is protected by a suitable protecting group.
  • the protected amino acid is then either attached to an inert solid support or utilized in solution by adding the next amino acid in the sequence having the complimentary (amino or carboxyl) group suitably protected and under conditions suitable for forming the amide linkage.
  • the protecting group is then removed from this newly added amino acid residue and the next amino acid (suitably protected) is added, and so forth. After all the desired amino acids have been linked in the proper sequence, any remaining protecting groups (and any solid support) are removed sequentially or concurrently to afford the final peptide.
  • the peptides of the invention are synthesized with amino- and carboxy- protecting groups for use as pro-drugs.
  • Protecting groups are chemical moieties which block a reactive group on the peptide to prevent undesirable reactions.
  • a modified peptide of the invention is synthesized with one or more protecting groups that are designed to be cleaved in vivo, thereby exposing the reactive group or groups of the modified peptide to serum proteins after administration of the peptide to a subject.
  • amino-protecting group refers to those groups intended to protect the amino- terminal end of an amino acid or peptide or to protect the amino group of an amino acid or peptide against undesirable reactions. Commonly used amino-protecting groups are disclosed in Greene (1981) Protective Groups in Organic Synthesis (John Wiley & Sons, New York), which is hereby incorporated by reference. Additionally, protecting groups can be used which are readily cleaved in vivo, for example, by enzymatic hydrolysis, thereby exposing the amino group for reaction with serum proteins in vivo.
  • carboxy protecting group refers to a carboxylic acid protecting ester or amide group employed to block or protect the carboxylic acid functionality.
  • Carboxy protecting groups are disclosed in Greene, "Protective Groups in Organic Synthesis” pp. 152-186 (1981), which is hereby incorporated by reference. Additionally, a carboxy protecting group can be used as a prodrug whereby the carboxy protecting group can be readily cleaved in vivo, for example by enzymatic hydrolysis, thereby exposing the carboxy group for reaction with serum proteins in vivo.
  • Such carboxy protecting groups are well known to those skilled in the art, having been extensively used in the protection of carboxyl groups in the penicillin and cephalosporin fields as described in U.S. Pat. Nos. 3,840,556 and 3,719,667, the disclosures of which are hereby incorporated by reference.
  • Preferred carboxy-protected peptides of the invention are peptides wherein the protected carboxy group is a lower alkyl, cycloalkyl or arylalkyl ester, for example, methyl ester, ethyl ester, propyl ester, isopropyl ester, butyl ester, sec-butyl ester, isobutyl ester, amyl ester, isoamyl ester, octyl ester, cyclohexyl ester, and phenylethyl ester or an alkanoyloxyalkyl,
  • amide carboxy protecting groups are lower alkylaminocarbonyl groups.
  • aspartic acid may be protected at the a-C-terminal by an acid labile group (e.g., t-butyl) and protected at the ⁇ -C- terminal by a hydrogenation labile group (e.g., benzyl) then deprotected selectively during synthesis.
  • the peptide or functional variant thereof consists of, or includes, an amino acid sequence located at the junctional region between two exons that are predominantly joined together in protein isoforms expressed or associated with one or more cancerous or tumor cells or disorders, e.g., as a result of an in-frame exon deletion or the use of an alternatively spliced exon.
  • the peptide or functional variant thereof consists of, or includes, an amino acid sequence located at the junctional region between two exons that are predominantly joined together in protein isoforms expressed or associated with one or more cancerous or tumor cells or disorders, e.g., as a result of an in-frame exon deletion or the use of an alternatively spliced exon.
  • the peptide or functional variant thereof consists of, or includes, an amino acid sequence, up to 60 amino acids or less (e.g., up to 50, 40, 30, 20, 10 or less amino acids), and which is identical to the alternative spliced form of Exon III, e.g., from about amino acids 301 to 360 of FGFR2-IIIc (SEQ ID NO:2); about amino acids 314 to 324 of FGFR2-IIIc (AAGVNTTDKEI, SEQ ID NO:4); about amino acids 328 to 337 of FGFR2-IIIC (YIRNVTFEDA, SEQ ID NO:6); about amino acids 350 to 353 of FGFR2-IIIc (ISFH, SEQ ID NO:8); about amino acids 314-353 of FGFR2 IIIc
  • the peptide or functional variant thereof consists of, or includes, an amino acid sequence, up to 60 amino acids or less (e.g., up to 50, 40, 30, 20, 10 or less amino acids), and which is identical the junctional region between Ig-II and Ig-III of FGFRIL (SEQ ID NO: 10) or a fragment thereof, or an amino acid sequence encoded by a nucleotide sequence of SEQ ID NO: 9 or a fragment thereof; or an amino acid or nucleotide sequence substantially identical thereto.
  • an amino acid sequence up to 60 amino acids or less (e.g., up to 50, 40, 30, 20, 10 or less amino acids), and which is identical the junctional region between Ig-II and Ig-III of FGFRIL (SEQ ID NO: 10) or a fragment thereof, or an amino acid sequence encoded by a nucleotide sequence of SEQ ID NO: 9 or a fragment thereof; or an amino acid or nucleotide sequence substantially identical thereto.
  • the peptide or functional variant thereof consists of, or includes, an amino acid sequence, up to 60 amino acids or less (e.g., up to 50, 40, 30, 20, 10 or less amino acids), and which is identical to the junctional region between exon 4 and exon 7 of isoform RONA160 (SEQ ID NO: 12) or a fragment thereof, or an amino acid sequence encoded by a nucleotide sequence of SEQ ID NO: 11 or a fragment thereof; or an amino acid or nucleotide sequence substantially identical thereto.
  • an amino acid sequence up to 60 amino acids or less (e.g., up to 50, 40, 30, 20, 10 or less amino acids), and which is identical to the junctional region between exon 4 and exon 7 of isoform RONA160 (SEQ ID NO: 12) or a fragment thereof, or an amino acid sequence encoded by a nucleotide sequence of SEQ ID NO: 11 or a fragment thereof; or an amino acid or nucleotide sequence substantially identical thereto.
  • the peptide or functional variant thereof consists of, or includes, an amino acid sequence, up to 60 amino acids or less (e.g., up to 50, 40, 30, 20, 10 or less amino acids), and which is identical to the junctional region of KIT between exons 10 and 12 of SEQ ID NO: 14 or a fragment thereof, or an amino acid sequence encoded by a nucleotide sequence of SEQ ID NO: 13 or a fragment thereof; or an amino acid or nucleotide sequence substantially identical thereto.
  • an amino acid sequence up to 60 amino acids or less (e.g., up to 50, 40, 30, 20, 10 or less amino acids), and which is identical to the junctional region of KIT between exons 10 and 12 of SEQ ID NO: 14 or a fragment thereof, or an amino acid sequence encoded by a nucleotide sequence of SEQ ID NO: 13 or a fragment thereof; or an amino acid or nucleotide sequence substantially identical thereto.
  • the peptide or functional variant thereof consists of, or includes, an amino acid sequence, up to 60 amino acids or less (e.g., up to 50, 40, 30, 20, 10 or less amino acids), and which is identical to the junctional region of PDGF between exons 5 and 7 of SEQ ID NO: 16 or a fragment thereof, or an amino acid sequence encoded by a nucleotide sequence of SEQ ID NO: 15 or a fragment thereof; or an amino acid or nucleotide sequence substantially identical thereto.
  • an amino acid sequence up to 60 amino acids or less (e.g., up to 50, 40, 30, 20, 10 or less amino acids), and which is identical to the junctional region of PDGF between exons 5 and 7 of SEQ ID NO: 16 or a fragment thereof, or an amino acid sequence encoded by a nucleotide sequence of SEQ ID NO: 15 or a fragment thereof; or an amino acid or nucleotide sequence substantially identical thereto.
  • the peptide or functional variant thereof consists of, or includes, an amino acid sequence, up to 60 amino acids or less (e.g., up to 50, 40, 30, 20, 10 or less amino acids), and which is identical to the junctional region of PDGFR-alpha between exons 6 and 9 of SEQ ID NO: 18 or a fragment thereof, or an amino acid sequence encoded by a nucleotide sequence of SEQ ID NO: 17 or a fragment thereof; or an amino acid or nucleotide sequence substantially identical thereto.
  • an amino acid sequence up to 60 amino acids or less (e.g., up to 50, 40, 30, 20, 10 or less amino acids), and which is identical to the junctional region of PDGFR-alpha between exons 6 and 9 of SEQ ID NO: 18 or a fragment thereof, or an amino acid sequence encoded by a nucleotide sequence of SEQ ID NO: 17 or a fragment thereof; or an amino acid or nucleotide sequence substantially identical thereto.
  • the peptides or a functional variant thereof can be made recombinantly or synthetically, e.g., using solid phase synthesis.
  • the isoform- specific inhibitor may include at least one, or alternatively, two or more peptide or variants thereof as described herein.
  • any combination of two or more peptide or peptide variants can be arranged, optionally, via a linker sequence.
  • the peptides can be functionally linked (e.g., by chemical coupling, genetic fusion, non-covalent association or otherwise) to one or more other molecular entities, e.g., carriers (e.g., an immunoglobulin Fc domain, serum albumin, pegylation, a GST, Lex- A or an MBP polypeptide sequence) to enhance the peptide stability in vivo.
  • carriers e.g., an immunoglobulin Fc domain, serum albumin, pegylation, a GST, Lex- A or an MBP polypeptide sequence
  • the peptides can be modified by, e.g., addition of chemical protecting groups, to enhance the peptide stability in vivo.
  • immunogenicity of pharmaceutical proteins comprises attachment of a suitable
  • pharmacologically acceptable polymer such as poly(ethyleneglycol) (PEG) or derivatives
  • pegylation can be used, such as the pegylation used in the art for antibody molecules; reference is made to for example Chapman, Nat. Biotechnol., 54, 531-545 (2002); by Veronese and Harris, Adv. Drug Deliv. Rev. 54, 453-456 (2003), by Harris and Chess, Nat. Rev. Drug. Discov., 2, (2003) and in WO 04/060965.
  • Various reagents for pegylation of proteins are also commercially available, for example from Nektar Therapeutics, USA.
  • site-directed pegylation is used, in particular via a cysteine-residue (see for example Yang et al., Protein Engineering, 16, 10, 761-770 (2003).
  • PEG may be attached to a cysteine residue that naturally occurs in an isoform-specific inhibitor, an inhibitor may be modified so as to suitably introduce one or more cysteine residues for attachment of PEG, or an amino acid sequence comprising one or more cysteine residues for attachment of PEG may be fused to the N-and/or C-terminus of an inhibitor of the invention, all using techniques of protein engineering known per se to the skilled person.
  • a PEG is used with a molecular weight of more than 5000, such as more than 10,000 and less than 200,000, such as less than 100,000; for example in the range of 20,000-80,000.
  • any SDAB molecule that has been pegylated at one or more amino acid positions preferably in such a way that said pegylation either (1) increases the half-life in vivo; (2) reduces immunogenicity; (3) provides one or more further beneficial properties known per se for pegylation; (4) does not essentially affect the affinity of the SDAB molecule (e.g. does not reduce said affinity by more than 90%, preferably not by more than 50 %, and by no more than 10%, as determined by a suitable assay, such as those described in the Examples below); and/or (4) does not affect any of the other desired properties of the isoform-specific inhibitor. Suitable PEG-groups and methods for attaching them, either specifically or non- specifically, will be clear to the skilled person.
  • kits and reagents for such pegylation can for example be obtained from Nektar (CA, USA).
  • Another, usually less preferred modification comprises N-linked or O-linked
  • glycosylation usually as part of co-translational and/or post-translational modification, depending on the host cell used for expressing the isoform-specific inhibitor.
  • the isoform-specific inhibitor inhibits the expression of nucleic acid encoding the isoform, e.g., the oncogenic isoform (e.g., an oncogenic isoform as described herein).
  • the oncogenic isoform e.g., an oncogenic isoform as described herein.
  • isoform-binding molecules include nucleic acid molecules, for example, antisense molecules, ribozymes, RNAi, triple helix molecules that hybridize to a nucleic acid encoding the isoform, e.g., the oncogenic isoform, or a transcription regulatory region, and blocks or reduces mRNA expression of the isoform, e.g., the oncogenic isoform.
  • the nucleic acid binding molecule capable of inhibiting the expression of an oncogenic isoform is an antisense oligonucleotide capable of specifically hybridizing to the oncogenic isoform.
  • sequence of an antisense compound need not be 100% complementary to that of its target nucleic acid to specifically hybridize to that sequence.
  • An antisense compound specifically hybridizes to a target DNA or RNA sequence when binding of the compound to the target DNA or RNA sequence interferes with the normal function of the target DNA or RNA. This interference should cause a loss of utility, and there should be a sufficient degree of complementarity to avoid non-specific binding of the antisense compound to non-target sequences under conditions in which specific binding is desired, i.e., under physiological conditions in the case of in vivo assays or therapeutic treatment, and in case of in vitro assays, under conditions in which the assays are performed.
  • an antisense oligonucleotide capable of specifically hybridizing to an oncogenic isoform can be identified through routine experimentation.
  • the antisense oligonucleotide capable of specifically hybridizing to an oncogenic isoform
  • oligonucleotide is capable of specifically hybridizing to a nucleic acid sequence provided herein, such as, e.g., a sequence encoding a polypeptide selected from the group consisting SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16, and 18.
  • the antisense oligonucleotide is capable of specifically hybridizing to a nucleic acid comprising the sequence of SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, or 17.
  • the compound capable of inhibiting the expression of an oncogenic isoform is an RNAi construct.
  • the RNAi construct is capable of specifically hybridizing to a nucleic acid sequence provided herein, such as, e.g., a sequence encoding a polypeptide selected from the group consisting SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16, and 18 or a substantially identical sequence thereof.
  • antisense oligonucleotides and RNAi constructs can be used to specifically inhibit the expression of the oncogenic polypeptide isoforms without inhibiting the non-oncogenic polypeptide isoforms derived from the same proto-oncogene. Using this technology, the specific function of each oncogenic polypeptide isoform can be studied. Further, antisense oligonucleotides and RNAi constructs may be used for disease treatment. Antisense oligonucleotides are relatively short nucleic acids that are complementary (or antisense) to the coding strand (sense strand) of the mRNA encoding a particular protein.
  • antisense oligonucleotides are typically RNA based, they can also be DNA based. Additionally, antisense oligonucleotides are often modified to increase their stability. See, for example, Antisense Technology in Methods in Enzymology, Vols. 313-314, ed. by Phillips, Abelson and Simon, Academic Press, 1999.
  • the oligonucleotides can be DNA or RNA, or chimeric mixtures or derivatives or modified versions thereof, single-stranded or double-stranded.
  • the oligonucleotide can be modified at the base moiety, sugar moiety, or phosphate backbone, for example, to improve its stability, hybridization, etc.
  • the oligonucleotide may include other appended groups such as peptides (e.g., for targeting host cell receptors), or agents facilitating transport across the cell membrane (see, e.g., Letsinger et al., Proc. Natl. Acad. Sci. U.S.A. 86:6553-56 (1989); Lemaitre et al., Proc. Natl. Acad.
  • oligonucleotide may be conjugated to another molecule.
  • the antisense oligonucleotide can also contain a neutral peptide-like backbone.
  • PNA peptide nucleic acid
  • Oligonucleotides of the invention may be synthesized by standard methods known in the art, e.g., by use of an automated DNA synthesizer (such as are commercially available from Biosearch
  • phosphorothioate oligonucleotides may be synthesized by the method of Stein et al. (Nucl. Acids Res. 16:3209 (1988)), and methylphosphonate oligonucleotides can be prepared by use of controlled pore glass polymer supports (Sarin et al., Proc. Natl. Acad. Sci. U.S.A. 85:7448-51 (1988)).
  • an appropriate oligonucleotide can be readily performed by one of skill in the art, based upon the present description. Given the nucleic acid encoding a particular protein, one of skill in the art can design antisense oligonucleotides that bind to that protein, and test these oligonucleotides in an in vitro or in vivo system to confirm that they bind to and mediate the degradation of the mRNA encoding the particular protein. To design an antisense oligonucleotide that specifically binds to and mediates the degradation of a particular protein, it is important that the sequence recognized by the oligonucleotide is unique or substantially unique to that particular protein.
  • sequences that are frequently repeated across proteins may not be an ideal choice for the design of an oligonucleotide that specifically recognizes and degrades a particular message.
  • One of skill in the art can design an oligonucleotide, and compare the sequence of that oligonucleotide to nucleic acid sequences that are deposited in publicly available databases to confirm that the sequence is specific, or substantially specific, for a particular protein.
  • antisense molecules can be injected directly into the tissue site, or modified antisense molecules, designed to target the desired cells (e.g. , antisense linked to peptides or antibodies that specifically bind receptors or antigens expressed on the target cell surface) can be administered systemically to a subject. See, for example, Antisense Technology in Methods in Enzymology, Vols. 313-314, ed. by Phillips, Abelson and Simon, Academic Press, 1999.
  • RNAi constructs comprise double stranded RNA that can specifically block expression of a target gene.
  • RNA interference or "RNAi” is a term initially applied to a phenomenon observed in plants and worms where double- stranded RNA (dsRNA) blocks gene expression in a specific and post- transcriptional manner. Without being bound by any particular theory, RNAi appears to involve mRNA degradation; however, the biochemical mechanisms remain an active area of research.
  • dsRNA refers to siRNA molecules, or other RNA molecules including a double stranded feature and able to be processed to siRNA in cells, such as hairpin RNA moieties.
  • RNAi construct is a generic term used throughout the specification to include small interfering RNAs (siRNAs), hairpin RNAs, and other RNA species, which can be cleaved in vivo to form siRNAs.
  • RNAi constructs herein also include expression vectors (also referred to as RNAi expression vectors) capable of giving rise to transcripts which form dsRNAs or hairpin RNAs in cells, and/or transcripts, which can produce siRNAs in vivo.
  • RNAi expression vector refers to a replicable nucleic acid constructs used to express (transcribe) RNA, which produces siRNA moieties in the cell in which the construct is expressed.
  • Such vectors include a transcriptional unit comprising an assembly of (1) genetic element(s) having a regulatory role in gene expression, for example, promoters, operators, or enhancers, operatively linked to (2) a "coding" sequence which is transcribed to produce a double- stranded RNA (two RNA moieties that anneal in the cell to form an siRNA, or a single hairpin RNA which can be processed to an siRNA), and (3) appropriate transcription initiation and termination sequences.
  • plasmids refer to circular double stranded DNA loops, which, in their vector form are not bound to the chromosome.
  • vectors and vector are used interchangeably as the plasmid is the most commonly used form of vector.
  • Methods of chemically modifying RNA molecules can be adapted for modifying RNAi constructs (see, e.g., Heidenreich et al., Nucleic Acids Res.
  • RNAi construct can be modified with phosphorothioates, phosphoramidate, phosphodithioates, chimeric methylphosphonate- phosphodie- sters, peptide nucleic acids, 5-propynyl-pyrimidine containing oligomers or sugar modifications (e.g., 2'-substituted ribonucleosides, a-configuration).
  • the double- stranded structure may be formed by a single self-complementary RNA strand or two complementary RNA strands.
  • RNA duplex formation may be initiated either inside or outside the cell.
  • the RNA may be introduced in an amount, which allows delivery of at least one copy per cell. Higher doses (e.g., at least 5, 10, 100, 500 or 1000 copies per cell) of double- stranded material may yield more effective inhibition, while lower doses may also be useful for specific applications.
  • Inhibition is sequence- specific in that nucleotide sequences corresponding to the duplex region of the RNA are targeted for genetic inhibition.
  • the siRNA molecules can be obtained using a number of techniques known to those of skill in the art.
  • the siRNA can be chemically synthesized or recombinantly produced using methods known in the art.
  • short sense and antisense RNA oligomers can be synthesized and annealed to form double- stranded RNA structures with 2-nucleotide overhangs at each end (Caplen et al, Proc. Natl. Acad. Sci. U.S.A., 98:9742-47 (2001); Elbashir et al., EMBO J., 20:6877-88 (2001)).
  • the invention also provides methods of inhibiting the expression of an oncogenic isoform provided herein in a cell comprising contacting the cell with a compound capable of inhibiting the expression of the oncogenic isoform. Inhibition of expression of an oncogenic isoform may be useful for the prevention and/or treatment of cancer. Inhibiting expression of an FGFR2-IIIc oncogenic isoform may be used to prevent and/or treat hormone-refractory prostate cancer, breast cancer, bladder cancer, thyroid cancer, or other form of cancer.
  • Inhibiting expression of FGFR1L may be used to prevent and/or treat pancreatic adenocarcinoma, prostate cancer, or other form of cancer.
  • Inhibiting expression of a RON receptor tyrosine kinase ⁇ 160 isoform may be used to prevent and/or treat metastatic colorectal cancer, breast cancer, ovarian cancer, lung cancer, bladder cancer, or other form of cancer.
  • Inhibiting expression of a KIT receptor tyrosine kinase oncogenic isoform may be used to prevent and/or treat gastrointestinal stromal tumors (GISTs) or other form of cancer.
  • Inhibiting expression of a PDGFR-alpha isoform may be used to prevent and/or treat brain cancer, glioblastoma, prostate cancer, bone metastasis, GIST, or other form of cancer.
  • the method is carried out in vitro. In another embodiment the method will be carried out in vivo. These methods could be used in research, diagnosis and treatment of a cancer associated with expression of the oncogenic isoform. In research, these methods could be used, for example, to elucidate the mechanism of action of an oncogenic isoform of the invention.
  • compositions e.g., pharmaceutically acceptable compositions, which include an isoform- specific inhibitor described herein, formulated together with a pharmaceutically acceptable carrier.
  • pharmaceutically acceptable compositions which include an isoform- specific inhibitor described herein, formulated together with a pharmaceutically acceptable carrier.
  • “pharmaceutically acceptable carrier” includes any and all solvents, dispersion media, isotonic and absorption delaying agents, and the like that are physiologically compatible.
  • the carrier can be suitable for intravenous, intramuscular, subcutaneous, parenteral, rectal, spinal or epidermal administration (e.g. by injection or infusion).
  • compositions of this invention may be in a variety of forms. These include, for example, liquid, semi-solid and solid dosage forms, such as liquid solutions (e.g., injectable and infusible solutions), dispersions or suspensions, liposomes and suppositories.
  • liquid solutions e.g., injectable and infusible solutions
  • dispersions or suspensions e.g., dispersions or suspensions
  • liposomes e.g., liposomes and suppositories.
  • the preferred form depends on the intended mode of administration and therapeutic application. Typical preferred compositions are in the form of injectable or infusible solutions.
  • the preferred mode of administration is parenteral (e.g., intravenous, subcutaneous, intraperitoneal, intramuscular).
  • the antibody is administered by intravenous infusion or injection.
  • the antibody is administered by intramuscular or subcutaneous injection.
  • parenteral administration and “administered parenterally” as used herein means modes of administration other than enteral and topical administration, usually by injection, and includes, without limitation, intravenous, intramuscular, intraarterial, intrathecal, intracapsular, intraorbital, intracardiac, intradermal, intraperitoneal, transtracheal, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal, epidural and intrasternal injection and infusion.
  • compositions typically should be sterile and stable under the conditions of manufacture and storage.
  • the composition can be formulated as a solution, microemulsion, dispersion, liposome, or other ordered structure suitable to high antibody concentration.
  • Sterile injectable solutions can be prepared by incorporating the active compound (i.e., antibody or antibody portion) in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by filtered sterilization.
  • dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above.
  • the preferred methods of preparation are vacuum drying and freeze-drying that yields a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
  • the proper fluidity of a solution can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants.
  • Prolonged absorption of injectable compositions can be brought about by including in the composition an agent that delays absorption, for example, monostearate salts and gelatin.
  • the isoform- specific inhibitor of the present invention can be administered by a variety of methods known in the art, although for many therapeutic applications, the preferred route/mode of administration is intravenous injection or infusion.
  • the antibody molecules can be administered by intravenous infusion at a rate of less than lOmg/min;
  • the active compound may be prepared with a carrier that will protect the compound against rapid release, such as a controlled release formulation, including implants, transdermal patches, and microencapsulated delivery systems.
  • a carrier that will protect the compound against rapid release, such as a controlled release formulation, including implants, transdermal patches, and microencapsulated delivery systems.
  • Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate,
  • polyanhydrides polyglycolic acid, collagen, polyorthoesters, and polylactic acid.
  • Many methods for the preparation of such formulations are patented or generally known to those skilled in the art. See, e.g., Sustained and Controlled Release Drug Delivery Systems, J. R. Robinson, ed., Marcel Dekker, Inc., New York, 1978.
  • an isoform-specific inhibitor of the invention may be orally administered, for example, with an inert diluent or an assimilable edible carrier.
  • the compound (and other ingredients, if desired) may also be enclosed in a hard or soft shell gelatin capsule, compressed into tablets, or incorporated directly into the subject's diet.
  • the compounds may be incorporated with excipients and used in the form of ingestible tablets, buccal tablets, troches, capsules, elixirs, suspensions, syrups, wafers, and the like.
  • To administer a compound of the invention by other than parenteral administration it may be necessary to coat the compound with, or co-administer the compound with, a material to prevent its inactivation.
  • Therapeutic compositions can also be administered with medical devices known in the art.
  • Dosage regimens are adjusted to provide the optimum desired response (e.g., a therapeutic response). For example, a single bolus may be administered, several divided doses may be administered over time or the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation. It is especially advantageous to formulate parenteral compositions in dosage unit form for ease of administration and uniformity of dosage.
  • Dosage unit form as used herein refers to physically discrete units suited as unitary dosages for the subjects to be treated; each unit contains a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required
  • An exemplary, non-limiting range for a therapeutically or prophylactically effective amount of an antibody or antibody portion of the invention is 0.1-20 mg/kg, more preferably 1- 10 mg/kg.
  • the isoform-specific inhibitor can be administered by intravenous infusion at a rate of less than 10 mg/min, preferably less than or equal to 5 mg/min to reach a dose of about 1 to
  • dosage values may vary with the type and severity of the condition to be alleviated. It is to be further understood that for any particular subject, specific dosage regimens should be adjusted over time according to the individual need and the professional judgment of the person administering or supervising the administration of the compositions, and that dosage ranges set forth herein are exemplary only and are not intended to limit the scope or practice of the claimed composition.
  • compositions of the invention may include a "therapeutically effective amount” or a “prophylactically effective amount” of an antibody or antibody portion of the invention.
  • a “therapeutically effective amount” refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired therapeutic result.
  • a therapeutically effective amount of the modified antibody or antibody fragment may vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability of the antibody or antibody portion to elicit a desired response in the individual.
  • a therapeutically effective amount is also one in which any toxic or detrimental effects of the modified antibody or antibody fragment is outweighed by the therapeutically beneficial effects.
  • a “therapeutically effective dosage” preferably inhibits a measurable parameter, e.g., tumor growth rate by at least about 20%, more preferably by at least about 40%, even more preferably by at least about 60%, and still more preferably by at least about 80% relative to untreated subjects.
  • a compound to inhibit a measurable parameter e.g., cancer
  • this property of a composition can be evaluated by examining the ability of the compound to inhibit, such inhibition in vitro by assays known to the skilled practitioner
  • a “prophylactically effective amount” refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired prophylactic result. Typically, since a prophylactic dose is used in subjects prior to or at an earlier stage of disease, the prophylactically effective amount will be less than the therapeutically effective amount.
  • kits comprising an isoform-specific inhibitor.
  • the kit can include one or more other elements including: instructions for use; other reagents, e.g., a label, a therapeutic agent, or an agent useful for chelating, or otherwise coupling, an antibody to a label or therapeutic agent, or a radioprotective composition; devices or other materials for preparing the antibody for administration; pharmaceutically acceptable carriers; and devices or other materials for administration to a subject.
  • Instructions for use can include instructions for diagnostic applications of the isoform-binding molecule, in vitro, e.g., in a sample, e.g., a biopsy or cells from a patient having a cancer or prostatic disorder, or in vivo.
  • the instructions can include instructions for therapeutic application including suggested dosages and/or modes of administration, e.g., in a patient with a cancer or prostatic disorder.
  • Other instructions can include instructions on coupling of the antibody to a chelator, a label or a therapeutic agent, or for purification of a conjugated antibody, e.g., from unreacted conjugation components.
  • the kit can include a label, e.g., any of the labels described herein.
  • the kit can include a therapeutic agent, e.g., a therapeutic agent described herein.
  • the kit can include a reagent useful for chelating or otherwise coupling a label or therapeutic agent to the antibody, e.g., a reagent discussed herein.
  • a macrocyclic chelating agent preferably 1,4,7, 10-tetraazacyclododecane-N, N',N",N"',4-tetraacetic acid (DOTA)
  • DOTA can be supplied as a separate component or the DOTA (or other chelator or conjugating agent) can be supplied already coupled to the antibody.
  • Additional coupling agents e.g., an agent such as N-hydroxysuccinimide (NHS)
  • NHS N-hydroxysuccinimide
  • the antibody will be reacted with other components; e.g., a chelator or a label or therapeutic agent, e.g., a
  • the kit can include one or more of a reaction vessel to carry out the reaction or a separation device, e.g., a chromatographic column, for use in separating the finished product from starting materials or reaction intermediates.
  • a reaction vessel to carry out the reaction
  • a separation device e.g., a chromatographic column
  • the kit can further contain at least one additional reagent, such as a diagnostic or therapeutic agent, e.g., a diagnostic or therapeutic agent as described herein, and/or one or more additional isoform-specific inhibitor, formulated as appropriate, in one or more separate pharmaceutical preparations.
  • additional reagent such as a diagnostic or therapeutic agent, e.g., a diagnostic or therapeutic agent as described herein, and/or one or more additional isoform-specific inhibitor, formulated as appropriate, in one or more separate pharmaceutical preparations.
  • the kit can further contain a radioprotectant.
  • a radioprotectant The radiolytic nature of isotopes, e.g., 90 Yttrium ( 90 Y) is known.
  • radioprotectants may be included, e.g., in the reaction buffer, as long as such radioprotectants are benign, meaning that they do not inhibit or otherwise adversely affect the labeling reaction, e.g., of an isotope, such as of 90 Y, to the antibody.
  • the formulation buffer of the present invention may include a radioprotectant such as human serum albumin (HSA) or ascorbate, which minimize radiolysis due to yttrium or other strong radionuclides.
  • a radioprotectant such as human serum albumin (HSA) or ascorbate
  • HSA human serum albumin
  • Other radioprotectants are known in the art and can also be used in the formulation buffer of the present invention, i.e., free radical scavengers (phenol, sulfites, glutathione, cysteine, gentisic acid, nicotinic acid, ascorbyl palmitate, HOP(:0)H 2 I glycerol, sodium formaldehyde sulfoxylate, Na 2 S 2 0, Na 2 S 2 0 3 , and S0 2 , etc.).
  • free radical scavengers phenol, sulfites, glutathione, cysteine, gentisic acid, nicotinic acid, ascorby
  • a preferred kit is one useful for radiolabeling a chelator-conjugated protein or peptide with a therapeutic radioisotope for administration to a patient.
  • the kit includes (i) a vial containing chelator-conjugated antibody, (ii) a vial containing formulation buffer for stabilizing and administering the radiolabeled antibody to a patient, and (iii) instructions for performing the radiolabeling procedure.
  • the kit provides for exposing a chelator-conjugated antibody to the radioisotope or a salt thereof for a sufficient amount of time under amiable conditions, e.g., as recommended in the instructions.
  • a radiolabeled antibody having sufficient purity, specific activity and binding specificity is produced.
  • the radiolabeled antibody may be diluted to an appropriate concentration, e.g., in formulation buffer, and administered directly to the patient with or without further purification.
  • the chelator-conjugated antibody may be supplied in lyophilized form.
  • the isoform-specific inhibitors of the invention have in vitro and in vivo diagnostic, as well as therapeutic and prophylactic utilities.
  • these binding molecules can be administered to cells in culture, e.g. in vitro or ex vivo, or in a subject, e.g., in vivo, to treat, prevent, and/or diagnose a variety of disorders, such as cancers (prostatic and non-prostatic cancers).
  • the term "subject" is intended to include human and non-human animals.
  • Preferred human animals include a human patient having a disorder characterized by abnormal functioning of an isoform-expressing cell, e.g., a cancer cell or a prostatic cell.
  • non-human animals" of the invention includes all vertebrates, e.g., mammals and non- mammals, such as non-human primates, sheep, dog, cow, chickens, amphibians, reptiles, etc.
  • the subject is a human subject.
  • the subject can be a mammal expressing an isoform-like antigen with which an isoform-specific inhibitor of the invention cross-reacts.
  • An isoform-specific inhibitor of the invention can be administered to a human subject for therapeutic purposes (discussed further below).
  • an isoform-specific inhibitor can be administered to a non-human mammal expressing the isoform-like antigen with which the modified antibody cross-reacts (e.g., a primate, pig or mouse) for veterinary purposes or as an animal model of human disease.
  • such animal models may be useful for evaluating the therapeutic efficacy of antibodies of the invention (e.g., testing of dosages and time courses of administration).
  • the invention provides a method of treating, e.g., ablating or killing, a hyperproliferative cell, e.g., a prostatic cell (e.g., a cancerous prostatic), or a malignant, non- prostatic cell, e.g., cell found in a non-prostatic solid tumor, a soft tissue tumor, or a metastatic lesion (e.g., a cell found in renal, urothelial (e.g., bladder), testicular, colon, rectal, lung (e.g., non-small cell lung carcinoma), breast, liver, neural (e.g., neuroendocrine), glial (e.g., glioblastoma), pancreatic (e.g., pancreatic duct) cancer and/or metastasis, melanoma (e.
  • a hyperproliferative cell e.g., a prostatic cell (e.g., a cancerous prostatic), or a malignant, non- pro
  • Methods of the invention include the steps of contacting the hyperproliferative cell, with an isoform-specific inhibitor described herein, in an amount sufficient to treat, e.g., reduce the activity, ablate or kill, the hyperproliferative cell.
  • the subject method can be used on cells in culture, e.g. in vitro or ex vivo.
  • cancerous or metastatic cells e.g., prostatic, renal, an urothelial, colon, rectal, lung, breast or liver, cancerous or metastatic cells
  • the contacting step can be effected by adding the isoform-specific inhibitor, to the culture medium.
  • the method can be performed on cells (e.g., cancerous or metastatic cells) present in a subject, as part of an in vivo (e.g., therapeutic or prophylactic) protocol.
  • the contacting step is effected in a subject and includes administering the isoform-specific inhibitor to the subject under conditions effective to permit inhibiting and/or reducing one or more activities of the isoform, or binding of the isoform-binding molecule to the cell, and thereby treating, e.g. , the killing or ablating of the cell.
  • cancer is meant to include all types of cancerous growths or oncogenic processes, metastatic tissues or malignantly transformed cells, tissues, or organs, irrespective of histopathologic type or stage of invasiveness.
  • cancerous disorders include, but are not limited to, solid tumors, soft tissue tumors, and metastatic lesions.
  • solid tumors include malignancies, e.g. , sarcomas, adenocarcinomas, and carcinomas, of the various organ systems, such as those affecting prostate, lung, breast, lymphoid, gastrointestinal (e.g. , colon), and genitourinary tract (e.g. , renal, urothelial cells), pharynx.
  • Adenocarcinomas include malignancies such as most colon cancers, rectal cancer, renal-cell carcinoma, liver cancer, non-small cell carcinoma of the lung, cancer of the small intestine and cancer of the esophagus. Metastatic lesions of the aforementioned cancers can also be treated or prevented using the methods and compositions of the invention.
  • the subject method can be useful in treating malignancies of the various organ systems, such as those affecting lung, breast, lymphoid, gastrointestinal (e.g. , colon), bladder,
  • genitourinary tract e.g. , prostate
  • pharynx e.g., prostate
  • adenocarcinomas which include malignancies such as most colon cancers, renal-cell carcinoma, prostate cancer and/or testicular tumors, non-small cell carcinoma of the lung, cancer of the small intestine and cancer of the esophagus.
  • the modified antibody molecules can be used as competitive agents for ligand binding to inhibit, reduce an undesirable interaction.
  • the isoform-specific inhibitors of the invention can be used by themselves or conjugated to a second agent, e.g., a cytotoxic drug, radioisotope, or a protein, e.g., a protein toxin or a viral protein.
  • a second agent e.g., a cytotoxic drug, radioisotope, or a protein, e.g., a protein toxin or a viral protein.
  • This method includes: administering the isoform-specific inhibitors, alone or conjugated to a cytotoxic drug, to a subject requiring such treatment.
  • the isoform-specific inhibitors of the invention may be used to deliver a variety of therapeutic agents, e.g., a cytotoxic moiety, e.g., a therapeutic drug, a radioisotope, molecules of plant, fungal, or bacterial origin, or biological proteins (e.g., protein toxins) or particles (e.g., a recombinant viral particles, e.g.; via a viral coat protein), or mixtures thereof.
  • the therapeutic agent can be an intracellularly active drug or other agent, such as short-range radiation emitters, including, for example, short-range, high-energy a-emitters, as described herein.
  • the isoform- specific inhibitors of the invention can be coupled to a molecule of plant or bacterial origin (or derivative thereof), e.g., a maytansinoid.
  • Maytansine is a cytotoxic agent that effects cell killing by preventing the formation of microtubules and depolymerization of extant microtubules. It is 100-to 1000-fold more cytotoxic than anticancer agents such as doxorubicin, methotrexate, and vinca alkyloid, which are currently in clinical use.
  • the isoform-binding molecule can be coupled to a taxane, a calicheamicin, a proteosome inhibitor, or a topoisomerase inhibitor.
  • Enzymatically active toxins and fragments thereof are exemplified by diphtheria toxin A fragment, nonbinding active fragments of diphtheria toxin, exotoxin A (from Pseudomonas aeruginosa), ricin A chain, abrin A chain, modeccin A chain, a-sacrin, certain Aleurites fordii proteins, certain Dianthin proteins, Phytolacca americana proteins (PAP, PAPII and PAP-S), Morodica charantia inhibitor, curcin, crotin, Saponaria officinalis inhibitor, gelonin, mitogillin, restrictocin, phenomycin, and enomycin.
  • the isoform-binding molecule is conjugated to maytansinoids, e.g., maytansinol (see U.S. Pat. No. 5,208, 020), CC-1065 (see U.S. Pat. Nos. 5,475,092, 5,585,499, 5,846,545).
  • maytansinoids e.g., maytansinol
  • CC-1065 see U.S. Pat. Nos. 5,475,092, 5,585,499, 5,846,545.
  • Procedures for preparing enzymatically active polypeptides of the immunotoxins are described in WO84/03508 and WO85/03508, which are hereby incorporated by reference.
  • cytotoxic moieties that can be conjugated to the antibodies include adriamycin, chlorambucil, daunomycin, methotrexate, neocarzinostatin, and platinum.
  • a first isoform-binding molecule can be conjugated with a prodrug which is activated only when in close proximity with a prodrug activator.
  • the prodrug activator is conjugated with a second isoform-binding molecule according to the present invention, preferably one that binds to a non-competing site on the prostate specific membrane antigen molecule. Whether two modified antibodies bind to competing or non-competing binding sites can be determined by conventional competitive binding assays.
  • Drug-prodrug pairs suitable for use in the practice of the present invention are described in Blakely et al., "ZD2767, an Improved System for Antibody-directed Enzyme Prodrug Therapy That Results in Tumor Regressions in Colorectal Tumor Xenografts," (1996) Cancer Research, 56:3287-3292, which is hereby incorporated by reference.
  • the isoform-binding molecules of the invention can be coupled to high energy radiation emitters, for example, a radioisotope, such as 131 I, a ⁇ -emitter, which, when localized at the tumor site, results in a killing of several cell diameters.
  • a radioisotope such as 131 I
  • a ⁇ -emitter which, when localized at the tumor site, results in a killing of several cell diameters.
  • radioisotopes include a-emitters, such as Bi, 213 Bi, and 211 At, and ⁇ -emitters, such as 186 Re and 90 Y. Radiotherapy is expected to be particularly effective, because prostate epithelial cells and vascular endothelial cells within cancers are relatively radiosensitive. Moreover, Lu 117 may also be used as both an imaging and cytotoxic agent.
  • Radioimmunotherapy (RIT) using antibodies labeled with 131 I, 90 Y, and 117 Lu is under intense clinical investigation. There are significant differences in the physical characteristics of these three nuclides and as a result, the choice of radionuclide can be important in order to deliver maximum radiation dose to the tumor.
  • the higher beta energy particles of 90 Y may be good for bulky tumors, but it may not be necessary for small tumors and especially bone metastases, (e.g. those common to prostate cancer).
  • 177 Lu has low energy beta particle with only 0.2-0.3 mm range and delivers much lower radiation dose to bone marrow compared to 90 Y. In addition, due to longer physical half-life (compared to 90 Y), the tumor residence times are higher. As a result, higher activities (more mCi amounts) of 177 Lu labeled agents can be administered with comparatively less radiation dose to marrow.
  • 177 Lu labeled antibodies There have been several clinical studies investigating the use of 177 Lu labeled antibodies in the treatment of various cancers. (Mulligan T et al, (1995) Clin Cancer Res. 1: 1447-1454; Meredith R F, et al. (1996) J Nucl Med 37: 1491- 1496; Alvarez R D, et al, (1997) Gynecologic Oncology 65: 94-101).
  • the isoform- specific inhibitors of the invention can also be conjugated or fused to viral surface proteins present on viral particles.
  • an isoform-binding molecule of the invention could be fused (e.g., to form a fusion protein) to a viral surface protein.
  • a whole isoform-specific inhibitor could be chemically conjugated (e.g., via a chemical linker) to a viral surface protein.
  • the virus is one that fuses with endocytic membranes, e.g., an influenza virus, such that the virus is internalized along with the isoform-specific inhibitor and thereby infects isoform-expressing cells.
  • the virus can be genetically engineered as a cellular toxin.
  • the virus could express or induce the expression of genes that are toxic to cells, e.g., cell death promoting genes.
  • such viruses would be incapable of viral replication.
  • the isoform-specific inhibitors of the invention can be used directly in vivo to eliminate antigen-expressing cells via natural complement or antibody-dependent cellular cytotoxicity (ADCC).
  • Isoform-specific inhibitors of the invention which have complement binding sites, such as portions from IgGl,-2, or-3 or IgM which bind complement can also be used in the presence of complement.
  • ex vivo treatment of a population of cells comprising target cells with a binding agent of the invention and appropriate effector cells can be supplemented by the addition of complement or serum containing complement.
  • Phagocytosis of target cells coated with modified antibodies or fragments thereof of the invention can be improved by binding of complement proteins.
  • target cells coated with the isoform-specific inhibitors of the invention can also be lysed by complement.
  • Also encompassed by the present invention is a method of killing or ablating cells which involves using the isoform-specific inhibitors of the invention for preventing an isoform-related disorder.
  • these materials can be used to prevent or delay development or progression of prostate or other cancers.
  • isoform-specific inhibitors according to the present invention only target cancerous cells, other tissue is spared. As a result, treatment with such isoform- specific inhibitors is safer, particularly for elderly patients.
  • Treatment according to the present invention is expected to be particularly effective, because it directs high levels of isoform- specific inhibitors to the bone marrow and lymph nodes where prostate cancer metastases and metastases of many other cancers predominate.
  • the methods of the present invention are particularly well-suited for treating prostate cancer, because tumor sites for prostate cancer tend to be small in size and, therefore, easily destroyed by cytotoxic agents.
  • Treatment in accordance with the present invention can be effectively monitored with clinical parameters, such as, in the case of prostate cancer, one or more markers chosen from: serum PSA, PSMA, PSCA, AR, chromogranin, synaptophysin, MIB-1 , and/or AMACR), and/or pathological features of a patient's cancer, including stage, Gleason score, extracapsular, seminal, vesicle or perineural invasion, positive margins, involved lymph nodes, disease related pain, etc.
  • these parameters can be used to indicate when such treatment should be employed.
  • DNA vaccines comprising a nucleotide sequence encoding an epitope of an oncogenic polypeptide isoform, which may be used for the prevention or treatment of cancer.
  • the epitope may be a short peptide of 10-15 amino acid residues from a linear or non- linear sequence of an oncogenic polypeptide isoform.
  • the epitope preferably spans a junction site between two exons, which junction is unique to the particular polypeptide isoform that is associated with cancer and not present in the protein isoform that is found in normal subjects or in normal tissues of diseases subjects.
  • DNA vaccines will encode two or more epitopes from a single protein isoform or from multiple protein isoforms and may be used in such combination, e.g. , for certain disease indications.
  • DNA vaccines may also encode an epitope specific sequence, e.g. , encoding 10- 15 amino acids, fused in frame to a carrier protein such as serum albumin, SEAP or other secreted peptide or protein.
  • DNA vaccines may be used for preventing or treated diseases as further described herein.
  • Exemplary DNA vaccines comprise nucleotide sequences encoding peptides of sequences described herein, or identified as described herein.
  • the vaccine may be given to an experimental animal model.
  • Animal models are well known in the art for numerous diseases, for example, for human tumors.
  • a vaccinated animal will be challenged with inoculated human tumors either before or after vaccination with a DNA vaccine.
  • a protective or positive effect of the vaccine should be reflected by reduced tumor burden in the experimental animals.
  • a tumor-specific vaccine may stimulate either one or both body's immune arms, i.e. cellular immunity and humoral immunity.
  • the isoform- specific inhibitors of the invention may be used in combination with other therapies.
  • the combination therapy can include a composition of the present invention co-formulated with, and/or co-administered with, one or more additional therapeutic agents, e.g., one or more anti-cancer agents, cytotoxic or cytostatic agents, hormone treatment, vaccines, and/or other immunotherapies.
  • the isoform- specific inhibitors are administered in combination with other therapeutic treatment modalities, including surgery, radiation, cryosurgery, and/or thermotherapy.
  • Such combination therapies may advantageously utilize lower dosages of the administered therapeutic agents, thus avoiding possible toxicities or complications associated with the various monotherapies.
  • Administered "in combination”, as used herein, means that two (or more) different treatments are delivered to the subject during the course of the subject's affliction with the disorder, e.g. , the two or more treatments are delivered after the subject has been diagnosed with the disorder and before the disorder has been cured or eliminated.
  • the delivery of one treatment is still occurring when the delivery of the second begins, so that there is overlap. This is sometimes referred to herein as “simultaneous" or “concurrent delivery.”
  • the delivery of one treatment ends before the delivery of the other treatment begins. In some embodiments of either case, the treatment is more effective because of combined administration.
  • the second treatment is more effective, e.g., an equivalent effect is seen with less of the second treatment, or the second treatment reduces symptoms to a greater extent, than would be seen if the second treatment were administered in the absence of the first treatment, or the analogous situation is seen with the first treatment.
  • delivery is such that the reduction in a symptom, or other parameter related to the disorder is greater than what would be observed with one treatment delivered in the absence of the other.
  • the effect of the two treatments can be partially additive, wholly additive, or greater than additive.
  • the delivery can be such that an effect of the first treatment delivered is still detectable when the second is delivered.
  • Isoform-specific inhibitors of the invention can be administered in combination with one or more of the existing modalities for treating prostate cancers, including, but not limited to: surgery (e.g. , radical prostatectomy); radiation therapy (e.g. , external-beam therapy which involves three dimensional, conformal radiation therapy where the field of radiation is designed to conform to the volume of tissue treated; interstitial-radiation therapy where seeds of radioactive compounds are implanted using ultrasound guidance; and a combination of external- beam therapy and interstitial-radiation therapy); hormonal therapy, which can be administered before or following radical prostatectomy or radiation (e.g. , treatments which reduce serum testosterone concentrations, or inhibit testosterone activity, e.g.
  • surgery e.g. , radical prostatectomy
  • radiation therapy e.g. , external-beam therapy which involves three dimensional, conformal radiation therapy where the field of radiation is designed to conform to the volume of tissue treated
  • interstitial-radiation therapy where seeds of radioactive compounds are implanted using ultrasound guidance
  • hormonal therapy which
  • LHRH leuteinizing hormone-releasing hormone
  • agonist e.g. , Lupron, Zoladex, leuprolide, buserelin, or goserelin
  • antagonists e.g. , Abarelix
  • Non-steroidal anti-androgens e.g. , flutamide, bicalutimade, or nilutamide
  • steroidal anti-androgens e.g. , cyproterone acetate or megastrol acetate
  • estrogens e.g. ,
  • hormonal therapy can be performed intermittently or using combinations of any of the above treatments, e.g. , combined use of leuprolide and flutamide.
  • the isoform- specific inhibitors of the invention are administered in combination with an immunomodulatory agent, e.g. , IL- 1, 2, 4, 6, or 12, or interferon alpha or gamma.
  • an immunomodulatory agent e.g. , IL- 1, 2, 4, 6, or 12, or interferon alpha or gamma.
  • IL-2 will function to augment the reticuloendothelial system to recognize antigen-antibody complexes by its effects on NK cells and macrophages.
  • NK cells by stimulating NK cells to release IFN, GM-CSF, and TNF, these cytokines will increase the cell surface density of Fc receptors, as well as the phagocytic capacities of these cells.
  • IL-2 can be administered by either bolus or continuous infusion. Accordingly, the antibodies of the invention can be administered in combination with IL-2 to maximize their therapeutic potential.
  • the present invention provides a diagnostic method for detecting the presence of an isoform, e.g., an isoform protein in vitro (e.g., in a biological sample, such as a tissue biopsy, e.g., from a cancerous tissue) or in vivo (e.g., in vivo imaging in a subject).
  • an isoform e.g., an isoform protein in vitro (e.g., in a biological sample, such as a tissue biopsy, e.g., from a cancerous tissue) or in vivo (e.g., in vivo imaging in a subject).
  • the method includes: (i) contacting the sample with an isoform-binding molecule described herein (e.g., an anti-FGFR2-IIIc antibody molecule described herein), or administering to the subject, the isoform-binding molecule; (optionally) (ii) contacting a reference sample, e.g., a control sample (e.g., a control biological sample, such as plasma, tissue, biopsy) or a control subject)); and (iii) detecting formation of a complex between the isoform-binding molecule, and the sample or subject, or the control sample or subject, wherein a change, e.g., a statistically significant change, in the formation of the complex in the sample or subject relative to the control sample or subject is indicative of the presence of isoform in the sample.
  • an isoform-binding molecule described herein e.g., an anti-FGFR2-IIIc antibody molecule described herein
  • a reference sample e.g., a control sample (e.
  • the isoform-binding molecule can be directly or indirectly labeled with a detectable substance to facilitate detection of the bound or unbound antibody.
  • detectable substances include various enzymes, prosthetic groups, fluorescent materials, luminescent materials and radioactive materials, as described above and described in more detail below.
  • sample as it refers to samples used for detecting polypeptides includes, but is not limited to, cells, cell lysates, proteins or membrane extracts of cells, body fluids, or tissue samples.
  • Complex formation between the isoform-binding molecule and the isoform can be detected by measuring or visualizing either the binding molecule bound to the isoform antigen or unbound binding molecule.
  • Conventional detection assays can be used, e.g., an enzyme-linked immunosorbent assays (ELISA), a radioimmunoassay (RIA) or tissue immunohistochemistry.
  • the presence of the isoform can be assayed in a sample by a competition immunoassay utilizing standards labeled with a detectable substance and an unlabeled isoform-binding molecule.
  • a competition immunoassay utilizing standards labeled with a detectable substance and an unlabeled isoform-binding molecule.
  • the biological sample, the labeled standards and the binding molecule are combined and the amount of labeled standard bound to the unlabeled binding molecule is determined.
  • the amount of isoform in the sample is inversely proportional to the amount of labeled standard bound to the binding molecule.
  • the invention provides a method for detecting the presence of isoform-expressing cancerous tissues in vivo.
  • the method includes (i) administering to a subject (e.g., a patient having a cancer) an isoform-binding molecule conjugated to a detectable marker; (ii) exposing the subject to a means for detecting said detectable marker to the isoform- expressing tissues or cells.
  • the binding molecule capable of specifically binding the polypeptide oncogenic isoform is an antibody molecule described above.
  • the binding molecule is an anti-FGFR2-IIIc antibody molecule described herein.
  • the antibody specifically binds a polypeptide comprising an amino acid sequence set forth in SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, or 18 or a substantially identical sequence thereof.
  • Determining whether a subject is expressing an oncogenic isoform may be useful to diagnose cancer. Determining whether a subject is expressing an FGFR2-IIIc oncogenic isoform may be used to diagnose hormone-refractory prostate cancer, breast cancer, bladder cancer, thyroid cancer, or other form of cancer. Determining whether a subject is expressing FGFR1L may be used to diagnose pancreatic adenocarcinoma, prostate cancer, or other form of cancer. Determining whether a subject is expressing a RON receptor tyrosine kinase ⁇ 160 isoform may be used to diagnose metastatic colorectal cancer, breast cancer, ovarian cancer, lung cancer, bladder cancer, or other form of cancer.
  • radiolabels such as 131 I, 111 In, 123 I, 99m Tc, 32 P, 125 1, 3 H, 14 C, and m Rh
  • fluorescent labels such as fluorescein and rhodamine, nuclear magnetic resonance active labels, positron emitting isotopes detectable by a positron emission tomography (“PET”) scanner,
  • chemiluminescers such as luciferin, and enzymatic markers such as peroxidase or phosphatase.
  • Short-range radiation emitters such as isotopes detectable by short-range detector probes, such as a transrectal probe, can also be employed. These isotopes and transrectal detector probes, when used in combination, are especially useful in detecting prostatic fossa recurrences and pelvic nodal disease.
  • the modified antibody can be labeled with such reagents using techniques known in the art. For example, see Wensel and Meares (1983) Radioimmunoimaging and
  • Radioimmunotherapy Elsevier, N.Y., which is hereby incorporated by reference, for techniques relating to the radiolabeling of antibodies. See also, D. Colcher et al., (1986) Meth. Enzymol. 121: 802-816, which is hereby incorporated by reference.
  • the modified antibody is administered to the patient, is localized to the tumor bearing the antigen with which the modified antibody reacts, and is detected or "imaged" in vivo using known techniques such as radionuclear scanning using e.g., a gamma camera or emission tomography. See e.g., A. R. Bradwell et al., "Developments in Antibody Imaging", Monoclonal Antibodies for Cancer Detection and Therapy, R. W. Baldwin et al., (eds.), pp 65785 (Academic Press 1985), which is hereby incorporated by reference.
  • positron emission transaxial tomography scanner such as designated Pet VI located at Brookhaven National Laboratory, can be used where the radiolabel emits positrons (e. g., U C, 18 F, 15 0, and 13 N).
  • Fluorophore and chromophore labeled modified antibodies can be prepared from standard moieties known in the art. Since antibodies and other proteins absorb light having wavelengths up to about 310 nm, the fluorescent moieties should be selected to have substantial absorption at wavelengths above 310 nm and preferably above 400 nm. A variety of suitable fluorescent compounds and chromophores are described by Stryer (1968) Science, 162:526 and Brand, L. et al., (1972) Annual Review of Biochemistry, 41:843-868, which are hereby incorporated by reference. The isoform-binding molecule can be labeled with fluorescent chromophore groups by conventional procedures such as those disclosed in U.S. Pat. Nos. 3,940,475, 4,289,747, and 4,376, 110, which are hereby incorporated by reference.
  • fluorescers having a number of the desirable properties described above is the xanthene dyes, which include the fluoresceins derived from 3,6-dihydroxy-9- henylxanthhydrol and resamines and rhodamines derived from 3,6-diamino-9-phenylxanthydrol and lissanime rhodamine B.
  • the rhodamine and fluorescein derivatives of 9-o- carboxyphenylxanthhydrol have a 9-o-carboxyphenyl group.
  • Fluorescein compounds having reactive coupling groups such as amino and isothiocyanate groups such as fluorescein
  • isothiocyanate and fluorescamine are readily available.
  • Another group of fluorescent compounds are the naphthylamines, having an amino group in the a or ⁇ position.
  • the invention provide methods for determining the dose, e.g., radiation dose, that different tissues are exposed to when a subject, e.g., a human subject, is administered an isoform-binding molecule that is conjugated to a radioactive isotope.
  • the method includes: (i) administering an isoform-binding molecule as described herein, e.g., an isoform-binding molecule, that is labeled with a radioactive isotope to a subject; (ii) measuring the amount of radioactive isotope located in different tissues, e.g., prostate, liver, kidney, or blood, at various time points until some or all of the radioactive isotope has been eliminated from the body of the subject; and (iii) calculating the total dose of radiation received by each tissue analyzed.
  • the measurements can be taken at scheduled time points, e.g., day 1, 2, 3, 5, 7, and 12, following administration (at day 0) of the radioactively labeled isoform-binding molecule to the subject.
  • the concentration of radioisotope present in a given tissue, integrated over time, and multiplied by the specific activity of the radioisotope can be used to calculate the dose that a given tissue receives.
  • Pharmacological information generated using isoform-binding molecules labeled with one radioactive isotope e.g., a gamma-emitter, e.g., m In, can be used to calculate the expected dose that the same tissue would receive from a different radioactive isotope which cannot be easily measured, e.g., a beta-emitter, e.g., 90 Y.
  • “Pharmacogenomics” refers to the application of genomics technologies such as gene sequencing, statistical genetics, gene expression, and protein biomarker expression analysis to drugs in clinical development and on the market. See, for example, Eichelbaum, M. et al., (1996) Clin. Exp. Pharmaco. Physiol. 23:983-985 and Linder, M. W. et al. (1997) Clin. Chem. 43:254-266. Differences in metabolism of therapeutics can lead to severe toxicity or therapeutic failure by altering the relation between dose and blood concentration of the pharmacologically active drug. In general, two types of pharmacogenetic conditions can be differentiated. Genetic conditions transmitted as a single factor altering the way drugs act on the body (altered drug action) or genetic conditions transmitted as single factors altering the way the body acts on drugs (altered drug metabolism).
  • pharmacogenetic conditions can occur either as rare genetic defects or as naturally-occurring polymorphisms. More specifically, the term refers the study of how a patient's genes determine his or her response to a drug (e.g., a patient's "drug response phenotype,” or "drug response genotype.")
  • a drug response genotype e.g., a patient's "drug response phenotype," or "drug response genotype.
  • Information generated from pharmacogenomic research can be used to determine appropriate dosage and treatment regimens for prophylactic or therapeutic treatment of an individual.
  • This knowledge when applied to dosing or drug selection, can avoid adverse reactions or therapeutic failure and thus enhance therapeutic or prophylactic efficiency when administering a therapeutic composition, e.g., a composition consisting of one or more isoform- specific inhibitors, or derivatized form(s) thereof, to a patient, as a means of treating a disorder, e.g., a cancer as described herein.
  • a physician or clinician may consider applying knowledge obtained in relevant pharmacogenomics studies when determining whether to administer a pharmaceutical composition, e.g., a composition consisting of one or more isoform- specific inhibitors, derivatized form(s) thereof, and optionally a second agent, to a subject.
  • a physician or clinician may consider applying such knowledge when determining the dosage, e.g., amount per treatment or frequency-of treatments, of a pharmaceutical composition, e.g., a pharmaceutical composition as described herein, administered to a patient.
  • a physician or clinician may determine the genotypes, at one or more genetic loci, of a group of subjects participating in a clinical trial, wherein the subjects display a disorder, e.g., a cancer or prostatic disorder as described herein, and the clinical trial is designed to test the efficacy of a pharmaceutical composition, e.g., a composition consisting of one or more isoform- specific inhibitors, and optionally a second agent, and wherein the physician or clinician attempts to correlate the genotypes of the subjects with their response to the pharmaceutical composition.
  • a pharmaceutical composition e.g., a composition consisting of one or more isoform- specific inhibitors, and optionally a second agent
  • the invention also provides methods of detecting a nucleic acid which encodes an oncogenic isoform provided herein, comprising: (a) obtaining cDNA from mRNA obtained from a suitable sample; (b) amplifying the cDNA corresponding to the proto-oncogene, oncogenic isoform, or an epitope fragment thereof; (c) comparing the amplified cDNA to the DNA of a nucleic acid known to encode proto-oncogene, oncogenic isoform, or epitope fragment thereof, wherein the presence of the oncogenic isoform in the amplified cDNA indicates the detection of a nucleic acid encoding the oncogenic isoform.
  • the invention also provides methods for detecting a nucleic acid which encodes an oncogenic isoform provided herein, comprising: (a) contacting a suitable sample with a compound capable of specifically binding a nucleic acid encoding oncogenic isoform provided herein; and (b) determining whether any compound is bound to the nucleic acid, where the presence of compound bound to the nucleic acid in the sample indicates the detection of a nucleic acid encoding the oncogenic isoform.
  • sample as it refers to samples used for detecting nucleic acids includes, but is not limited to, cells, cell lysates, nucleic acids extracts of cells, tissue samples, or body fluids.
  • Body fluids include, but are not limited to, blood, serum and saliva.
  • the suitable sample is obtained from a subject.
  • Methods of obtaining mRNA from a suitable sample are well known in the art. Further, methods of making cDNA from mRNA, such as reverse transcription, are also well known in the art.
  • amplifying means increasing the numbers of copies of a specific DNA fragment.
  • amplifying of the cDNA is carried out using PCR (polymerase chain reaction).
  • the amplifying of the cDNA is accomplished using primers flanking the entire reading frame of a proto-oncogene encoding an oncoogenic isoform polypeptide.
  • the amplifying of the cDNA is accomplished out using primers flanking a portion, e.g. an exon, of a nucleic acid encoding the polypeptide oncogenic isoform.
  • one or more of the primers hybridize to sequences of the oncogenic isoform which are present in the nucleic acid encoding the oncogenic isoform, but absent in the nucleic acid encoding a non-oncogenic isoform, or vice versa.
  • a primer may hybridize to a sequence selected from the group consisting of SEQ ID NOs: 1, 3, 5, 7, 9, 11, 13, 15, or 17. In certain embodiments, a primer may be 18-22 nucleotides in length.
  • comparing the amplified cDNA to the cDNA of a nucleic acid known to encode the proto-oncogene, oncogenic isoform, or epitope fragment thereof is accomplished by comparing the sequence of the amplified cDNA to the known sequence corresponding to the proto-oncogene, oncogenic isoform, or epitope fragment thereof. The presence or absence of sequence in the amplified sequence will indicate that the oncogenic isoform is present or absent.
  • comparing the amplified cDNA to the cDNA of a nucleic acid known to encode the proto-oncogene, oncogenic isoform, or epitope fragment thereof is accomplished by comparing the size of the amplified cDNA to the size of the DNA of a gene known to correspond to the proto-oncogene, oncogenic isoform, or epitope fragment thereof. A difference in size will indicate that the amplified DNA encodes an oncogenic isoform.
  • the invention also provides methods of determining whether a subject is expressing an oncogenic isoform comprising: (a) obtaining cDNA from mRNA obtained from a suitable sample from the subject; (b) amplifying the cDNA corresponding to the proto-oncogene, oncogenic isoform, or an epitope fragment thereof; and (c) comparing the amplified cDNA to the cDNA of a nucleic acid known to encode the proto-oncogene, oncogenic isoform, or an epitope fragment thereof, wherein the presence of the oncogenic isoform in the amplified cDNA indicates that the subject is expressing the oncogenic isoform.
  • a "suitable sample” in connection with the above method of determining whether a subject is expressing an oncogenic isoform refers to any sample from the subject that could contain the oncogenic isoform. Examples include, but are not limited to, body fluids and tissue samples. Examples of body fluids include, but are not limited to, blood, serum, urine and saliva.
  • Amplifying, comparing, and determining the presence of the cDNA may be
  • the invention also features nucleic acids comprising nucleotide sequences that encode heavy and light chain variable regions and CDRs of the anti- FGFR2-IIIc antibody molecules, as described herein.
  • the invention features a first and second nucleic acid encoding heavy and light chain variable regions, respectively, of an anti- FGFR2-IIIc antibody molecule chosen from one or more of, e.g., Atto-MuMab-01 , Atto-MuMab-02, Atto-MuMab-03, Atto- HuMab-01, Atto-MuMab-06, or Atto-MuMab-08, as described herein.
  • the nucleic acid can comprise a nucleotide sequence as set forth in FIGS.
  • 29A, 29C, 29E, 30A, 30C, 30E, 34A (SEQ ID NO: 87 for VH), 34B (SEQ ID NO: 89 for VL), or 37B, or a sequence substantially identical thereto (e.g. , a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, or which differs by no more than 3, 6, 15, 30, or 45 nucleotides from the sequences shown in FIGS. 29A, 29C, 29E, 30A, 30C, 30E, 34A (SEQ ID NO: 87 for VH), 34B (SEQ ID NO: 89 for VL), or 37B.
  • a sequence substantially identical thereto e.g. , a sequence at least about 85%, 90%, 95%, 99% or more identical thereto, or which differs by no more than 3, 6, 15, 30, or 45 nucleotides from the sequences shown in FIGS. 29A, 29C, 29E, 30A, 30C, 30E, 34A (SEQ
  • the nucleic acid can comprise a nucleotide sequence encoding at least one, two, or three CDRs from a heavy chain variable region having an amino acid sequence as set forth in FIG. 35 (SEQ ID NOs: 92, 94 and 96 for VH CDRs 1-3, respectively), 28, 29F (SEQ ID NOs: 147- 149 for VH CDRs 1-3, respectively), 30F (SEQ ID NOs: 147, 158 and 159 for VH CDRs 1-3, respectively), 38, 39 (SEQ ID NOs: 147- 149 for VH CDRs 1-3, respectively), or 40, or a sequence substantially homologous thereto (e.g.
  • the nucleic acid can comprise a nucleotide sequence encoding at least one, two, or three CDRs from a light chain variable region having an amino acid sequence as set forth in FIG.
  • the nucleic acid can comprise a nucleotide sequence encoding at least one, two, three, four, five, or six CDRs from heavy and light chain variable regions having an amino acid sequence as set forth in FIG. 35 (SEQ ID NOs: 92, 94 and 96 for VH CDRs 1-3, and SEQ ID NOs: 98, 100 and 102 for VL CDRs 1-3, respectively), 28, 29D (SEQ ID NOs: 155, 156 and 146 for VL CDRs 1-3, respectively), 29F (SEQ ID NOs: 147-149 for VH CDRs 1-3, respectively), 30D (SEQ ID NOs: 155-157 for VL CDRs 1-3, respectively), 30F (SEQ ID NOs: 147, 158 and 159 for VH CDRs 1- 3, respectively), 38, 39 (SEQ ID NOs: 144- 146 for VH CDRs 1-3, and SEQ ID NOs: 147- 149 for VL CDRs 1- 3, respectively), 38
  • the nucleic acid can comprise a nucleotide sequence encoding at least one, two, or three CDRs from a heavy chain variable region having the nucleotide sequence as set forth in FIG. 34A (SEQ ID NOs: 91, 93 and 95 for VH CDRs 1-3, respectively), 29E (SEQ ID NOs: 187-189 for VH CDRs 1-3, respectively), 30E (SEQ ID NOs: 181- 183 for VH CDRs 1- 3, respectively), or 37B (SEQ ID NOs: 175-177 for VH CDRs 1-3, respectively), a sequence substantially homologous thereto (e.g.
  • the nucleic acid can comprise a nucleotide sequence encoding at least one, two, or three CDRs from a light chain variable region having the nucleotide sequence as set forth in FIG.
  • the nucleic acid can comprise a nucleotide sequence encoding at least one, two, three, four, five, or six CDRs from heavy and light chain variable regions having the nucleotide sequence as set forth in FIG. 34A (SEQ ID NOs: 91, 93 and 95 for VH CDRs 1-3, respectively), 34B (SEQ ID NOs: 97, 99 and 101 for VL CDRs 1-3, respectively), 29C (SEQ ID NOs: 184- 186 for VL CDRs 1-3, respectively), 29E (SEQ ID NOs: 187-189 for VH CDRs 1-3, respectively), 30C (SEQ ID NOs: 178- 180 for VL CDRs 1-3, respectively), 30E (SEQ ID NOs: 181-183 for VH CDRs 1-3, respectively), or 37B (SEQ ID NOs: 175-177 for VH CDRs 1-3, and SEQ ID NOs: 172-174 for VL CDRs 1-3, respectively),
  • the application features host cells and vectors containing the nucleic acids described herein.
  • the nucleic acids may be present in a single vector or separate vectors present in the same host cell or separate host cell, as described in more detail hereinbelow.
  • the invention provides isolated nucleic acids encoding the oncogenic polypeptide isoforms provided herein, or a substantially identical sequence thereof.
  • the invention also provides isolated nucleic acids encoding the polypeptides of oncogenic isoforms or epitope fragments thereof. In one embodiment, the invention provides isolated nucleic acids encoding polypeptides of human oncogenic isoforms or epitope fragments thereof. In one embodiment, the isolated nucleic acid encodes an isoform or epitope fragment thereof of an oncogenic form of a proto-oncogene is selected from the group consisting of FGFR2, FGFR1, RON Receptor tyrosine kinase, KIT receptor tyrosine kinase, PDGF, and PDGFR-alpha.
  • the invention provides isolated nucleic acids encoding rat polypeptides of oncogenic isoforms or epitope fragments thereof. In one embodiment, the invention provides isolated nucleic acids encoding mouse polypeptides of human oncogenic isoforms or epitope fragments thereof. In other embodiments the isolated nucleic acids encoding polypeptides of human oncogenic isoforms or epitope fragments thereof will be derived from other species, including but not limited to, dogs, pigs, guinea pigs and rabbits.
  • the invention provides an isolated nucleic acid encoding an oncogenic polypeptide isoform or epitope fragment thereof comprising a segment of nucleotides which arise from an alternative use of Exon III of a nucleic acid encoding a FGFR2.
  • the alternative use of Exon III results in sequence variation in the region of amino acids from 301-360, when aligned with FGFR2 Illb.
  • the nucleic acid encodes a polypeptide comprising a sequence selected from the group of SEQ NOs: 2, 4, 6, and 8.
  • the nucleic acid comprises a sequence selected from the group consisting of SEQ NOs: 1, 3, 5, and 7.
  • the invention provides an isolated nucleic acid encoding an oncogenic polypeptide isoform or epitope fragment thereof comprising a segment of nucleotides which arise from an alternative deletion of Exons 7 and 8 of FGFR1.
  • the alternative deletion of Exons 7 and 8 results in a deletion of 105 amino acids, when aligned with an FGFR1 proto-oncogene.
  • the isolated nucleic acid encodes a polypeptide comprising a sequence of SEQ NO: 10.
  • the nucleic acid comprises the sequence of SEQ NO: 9.
  • the invention provides an isolated nucleic acid encoding polypeptides of oncogenic isoforms or epitope fragments thereof comprising a segment of nucleotides which arise from an alternative deletion of Exons 5 and 6 of RON receptor tyrosine kinase.
  • the alternative deletion of Exons 5 and 6 results in an in-frame deletion of 109 amino acids in the extracellular domain, when aligned with a RON receptor tyrosine kinase proto-oncogene.
  • the isolated nucleic acid comprises a juxtaposition of Exons 4 and 7.
  • the isolated nucleic acid encodes a polypeptide comprising the sequence of SEQ NO: 12.
  • the isolated nucleic acid comprises the sequence of SEQ NO: 11.
  • the invention provides an isolated nucleic acid encoding a polypeptide of an oncogenic isoform or epitope fragment thereof comprising a segment of nucleotides which arise from an alternative deletion of Exon 11 of a nucleic acid encoding KIT receptor tyrosine kinase.
  • the isolated nucleic acid encodes a polypeptide comprising the sequence of SEQ NO: 14.
  • the nucleic acid comprises the sequence of SEQ NO: 13.
  • the invention provides an isolated nucleic acid encoding a polypeptide of an oncogenic isoform or epitope fragment thereof comprising a segment of nucleotides which arise from an alternative in-frame deletion of Exon 6 of PDGF.
  • the isolated nucleic acid encodes a polypeptide comprising the sequence of SEQ NO: 16.
  • the isolated nucleic acid comprises the sequence of SEQ NO: 15.
  • the invention provides an isolated nucleic acid encoding a polypeptide of an oncogenic isoform or epitope fragment thereof comprising a segment of nucleotides which arise from an alternative deletion of Exons 7 and 8 (e.g., amino acids 374-456) of PDGFR-alpha.
  • the isolated nucleic acid encodes a polypeptide
  • nucleic acid comprises the sequence of SEQ NO: 17.
  • an isolated nucleic acid encoding a polypeptide of an oncogenic isoform or epitope fragment thereof may be encoded by a nucleic acid which is substantially identical to a nucleic acid of an oncogenic isoform or epitope fragment thereof provided herein.
  • an isolated nucleic acid may encode a polypeptide of an oncogenic isoform or epitope fragment thereof which is substantially identical to an oncogenic isoform or epitope fragment thereof, as provided herein.
  • a sequence (polypeptide or nucleic acid) that "substantially corresponds" to another sequence may be a sequence that allows single amino acid or nucleotide substitutions, deletions and/or insertions. In one embodiment, sequences that substantially correspond have 80% sequence identity.
  • sequences that substantially correspond have 85% sequence identity. In another embodiment, sequences that substantially correspond have 90% sequence identity. In another embodiment, sequences that substantially correspond have 95% sequence identity. In another embodiment, sequences that substantially correspond have 97% sequence identity. In another embodiment, sequences that substantially correspond have 99% sequence identity.
  • the nucleic acid encodes an oncogenic isoform or epitope fragment thereof comprising the amino acid sequence set forth in SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16, 18, 19, or 20, but with a conservative amino acid substitution.
  • the nucleic acid encodes an oncogenic isoform or epitope fragment thereof comprising 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 conservative amino acid substitutions with respect to SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16, 18, 19, or 20.
  • the nucleic acid encodes an oncogenic polypeptide insert variant comprising 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 conservative amino acid substitutions with respect to SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16, 18, 19, or 20.
  • the invention also provides an isolated nucleic acid that specifically binds to a nucleic acid provided herein or a nucleic acid capable of hybridizing under high stringency conditions to a nucleic acid described herein, or a substantially identical sequence thereof.
  • the invention provides an isolated nucleic acid capable of hybridizing under high stringency conditions to a nucleic acid encoding an oncogenic isoform or epitope fragment thereof comprising SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 19, or 20 or a substantially identical sequence thereof.
  • the invention provides an isolated nucleic acid capable of hybridizing under high stringency conditions to a nucleic acid comprising the sequence of SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, or 17, or a fragment thereof.
  • This invention also provides isolated nucleic acids encoding an oncogenic isoform or epitope fragment thereof, wherein the nucleic acid is at least 80% identical to a nucleic acid encoding an oncogenic isoform or epitope fragment thereof, wherein the nucleic acid encoding the oncogenic isoform or epitope fragment thereof comprises a segment of nucleotides at a position which corresponds to the alternative slice junction which when used renders the polypeptide oncogenic.
  • the percent identity is 85%, 90%, 95%, 97%, or 99%.
  • Detectable markers include, but are not limited to: a radioactive marker, a colorimetric marker, a
  • Radioactive markers include, but are not limited to: 3 H, 14 C, 32 P, 33 P, 35 S, 36 C1, 51 Cr, 57 Co, 59 Co, 59 Fe, 90 Y, 125 I, 131 I, and 186 Re.
  • Fluorescent markers include, but are not limited to, fluorescein, rhodamine and auramine.
  • Colorimetric markers include, but are not limited to, biotin and digoxigenin. Any suitable method for attaching markers to nucleic acids may be used with the nucleotides of the invention, and many such methods are well known in the art.
  • nucleic acids complementary to the nucleic acids disclosed herein By a nucleic acid sequence “homologous to” or “complementary to”, it is meant a nucleic acid that selectively hybridizes, duplexes or binds to a target nucleic acid sequence.
  • adenine is complementary to thymine as they can form two hydrogen bonds.
  • guanine and cytosine are complementary since they can form three hydrogen bonds.
  • a nucleic acid sequence, which is homologous to a target sequence can include sequences, which are shorter or longer than the target sequence as long as they meet the functional test set forth.
  • the invention also provides vectors comprising nucleotides encoding a polypeptide of an oncogenic isoform or epitope thereof provided herein.
  • the vectors comprise nucleotides encoding a polypeptide of an oncogenic isoform or epitope fragment thereof provided herein.
  • the vectors comprise the nucleotide sequences described herein.
  • the vectors include, but are not limited to, a virus, plasmid, cosmid, lambda phage or a yeast artificial chromosome (YAC). In accordance with the invention, numerous vector systems may be employed.
  • one class of vectors utilizes DNA elements which are derived from animal viruses such as, for example, bovine papilloma virus, polyoma virus, adenovirus, vaccinia virus, baculovirus, retroviruses (Rous Sarcoma Virus, MMTV or MOMLV) or SV40 virus.
  • Another class of vectors utilizes RNA elements derived from RNA viruses such as Semliki Forest virus, Eastern Equine Encephalitis virus and Flavi viruses.
  • cells which have stably integrated the DNA into their chromosomes may be selected by introducing one or more markers which allow for the selection of transfected host cells.
  • the marker may provide, for example, prototropy to an auxotrophic host, biocide resistance, (e.g., antibiotics), or resistance to heavy metals such as copper, or the like.
  • the selectable marker gene can be either directly linked to the DNA sequences to be expressed, or introduced into the same cell by cotransformation. Additional elements may also be needed for optimal synthesis of mRNA. These elements may include splice signals, as well as
  • transcriptional promoters e.g., promoters, and termination signals.
  • the expression vectors may be transfected or introduced into an appropriate host cell.
  • Various techniques may be employed to achieve this, such as, for example, protoplast fusion, calcium phosphate precipitation, electroporation, retroviral transduction, viral transfection, gene gun, lipid based transfection or other conventional techniques.
  • protoplast fusion the cells are grown in media and screened for the appropriate activity.
  • Methods and conditions for culturing the resulting transfected cells and for recovering the polypeptide of an oncogenic isoform or epitope fragment thereof so produced are well known to those skilled in the art, and may be varied or optimized depending upon the specific expression vector and mammalian host cell employed, based upon the present description.
  • the invention also provides host cells comprising a nucleic acid encoding a polypeptide of an oncogenic isoform or epitope fragment thereof as described herein.
  • the host cells are genetically engineered to comprise nucleic acids encoding a polypeptide of an oncogenic isoform or epitope fragment thereof.
  • the host cells are genetically engineered by using an expression cassette.
  • expression cassette refers to nucleotide sequences, which are capable of affecting expression of a gene in hosts compatible with such sequences.
  • cassettes may include a promoter, an open reading frame with or without introns, and a termination signal.
  • an inducible promoter may also be used, such as, for example, an inducible promoter.
  • the invention also provides host cells comprising the vectors described herein.
  • the cell can be, but is not limited to, a eukaryotic cell, a bacterial cell, an insect cell, or a human cell.
  • Suitable eukaryotic cells include, but are not limited to, Vero cells, HeLa cells, COS cells, CHO cells, HEK293 cells, BHK cells and MDCKII cells.
  • Suitable insect cells include, but are not limited to, Sf9 cells.
  • FGFR2 Fibroblast Growth Factor Receptor 2
  • exon III results in different sequence in the Ig-like loop III of the extracellular domain, which is critical for ligand binding.
  • Isoform Illb is expressed in normal prostate epithelial cells. Malignant prostate cancer cells switch to IIIc isoform, which has high binding affinity to growth factors with high transforming activities, e.g., FGF8b isoform.
  • FGFR2-IIIc uses the alternative exon III, which encodes difference sequence than that in isoform FGFR2-IIIb.
  • FGFR2-IIIc isoform contains non-homologous sequence with Illb isform in the region of the carboxyl terminal half of the Ig-loop III region, from amino acid position 314 to 353.
  • the isoform structure of FGFR2 is shown in FIG. 1.
  • IIIc and Illb isoforms shows the differences in carboxyl terminal half of the Ig loop III region (FIG. 2).
  • Amino acid (SEQ ID NO: 19) and nucleotide (SEQ ID NO: 20) sequences of FGFR2-IIIc are shown in FIGs 3A and 3B respectively.
  • Nucleotide (SEQ ID NO: 1) and amino acid (SEQ ID NO: 2) sequences of FGFR2 Exon- IIIc are shown in FIGs. 4A and 2, respectively.
  • Nucleotide (SEQ ID NO: 64) and amino acid (SEQ ID NO: 65) sequences of FGFR2 Exon-IIIb are shown in FIGs. 4B and 2, respectively.
  • Short peptide sequences were also used as epitopes for generation of monoclonal antibodies.
  • Amino acid (SEQ ID NO: 4) and nucleotide (SEQ ID NO: 3) sequences of IIIc-314, are shown in FIG. 5A.
  • Amino acid (SEQ ID NO: 6) and nucleotide (SEQ ID NO: 5) sequences of IIIc-328 are shown in FIG. 5B.
  • Amino acid (SEQ ID NO: 8) and nucleotide (SEQ ID NO: 7) sequences of IIIc-350 are shown in FIG. 5C.
  • Amino acid (SEQ ID NO: 57) and nucleotide (SEQ ID NO: 61) sequences of Illb epitope: amino acids 314-328 are shown in FIG. 6B.
  • Amino acid (SEQ ID NO: 58) and nucleotide (SEQ ID NO: 62) sequences of Illb epitope: amino acids 340-351 are shown in FIG. 6C.
  • Example 1.2 FGFR1: isoform FGFR1L (Deletion ofexon 7 & 8; 105 amino acids; part oflg-II and part oflg-III)
  • FIG. 7 The isoform structure of Fibroblast Growth Factor Receptor 1 (FGFR1) is shown in FIG. 7.
  • the amino acid (SEQ ID NO: 10) and nucleotide (SEQ ID NO: 9) sequences for the epitope at the junction are shown in FIG 8.
  • Example 1.3 RON receptor tyrosine kinase: isoform RONA160
  • This isoform of Macrophage stimulating 1 receptor (RON) is constitutively active.
  • the epitope is at the junction between exon 4 and exon 7.
  • the nucleotide (SEQ ID NO: 11) and amino acid (SEQ ID NO: 12) sequences of this epitope are shown in FIG. 9.
  • Example 1.4 KIT receptor tyrosine kinase (deletion in exon 11 ) Most gastrointestinal stromal tumors, GISTs, harbor oncogenic mutations in the v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog (KIT) gene, and the majority of these mutations affect the juxtamembrane domain of the kinase encoded by exon 11.
  • KIT Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog
  • the nucleotide (SEQ ID NO: 13) and amino acid (SEQ ID NO: 14) sequences for this epitope are shown in FIG. 10.
  • Example 1.5 PDGF: isoform 2 (in-frame deletion of exon 6)
  • PDGF Platelet-Derived Growth Factor
  • SEQ ID NO: 15 amino acid sequences for this epitope are shown in FIG. 11.
  • Example 1.6 PDGFR-alpha: Delta -exon 7 and 8 (amino acids 374 to 456)
  • PDGFR-alpha Platelet-Derived Growth Factor Receptor alpha
  • PDGFR-alpha has deletion in exons 7 and 8.
  • the nucleotide (SEQ ID NO: 17) and amino acid (SEQ ID NO: 18) sequences for this epitope are shown in FIG. 12.
  • Antibodies to FGFR2 are commercially available.
  • antibodies recognizing isoform-specific sequences for FGFR2-IIIc and Illb were designed. Monoclonal antibodies were generated by common hybridoma technology. Briefly, coding sequences were either PCR amplified or chemically synthesized based on gene sequences of SEQ ID NOs: 19 and 63, respectively. The DNA fragments were subsequently cloned into a commercially available mammalian expression vector. The expression vectors were used for genetic immunization of 5 mice for each antigen. Immunized mice that had serum titer greater than 40,000-fold by ELISA test were used for fusion with myeloma SP 2/0 cells for generation of hybridoma clones.
  • Monoclonal antibodies were screened by ELISA and Western blots for affinity and specificity. Multiple monoclonal antibody clones for each isoform were further characterized by binding specificity, affinity and IC 50 (concentration at 50% inhibition) against target receptors. Receptors were prepared either as full-length membrane bound receptor (for cell-based assays) or as soluble form of the extracellular domain fused to human IgG Fc (for ELISA based tests).
  • Positive monoclonal antibody clones to FGFR2IIIc were chosen for further development based on the following criteria (i) no detectable cross-reactivity with FGFR2 Illb isoform, (ii) nanomolar affinity to its receptor based on EC 50 value, (iii) staining profile in prostate tumor, other tumors and normal tissue controls.
  • Anti-FGFR2 Illb monoclonal antibody clones were chosen by similar criteria and used as a control for in vitro studies and for IHC staining of normal and tumor tissues.
  • humanized anti-FGFR2 isoform specific antibodies can be generated by replacing sequences of the Fv variable region which are not directly involved in antigen binding with equivalent sequences from human Fv variable regions, as described by, e.g., Morrison, S. L., 1985, Science 229: 1202-1207, by Oi et al., 1986, BioTechniques 4:214, and by Queen et al., US 5,585,089, US 5,693,761 and US 5,693,762, the contents of all of which are hereby incorporated by reference. Humanized anti-FGFR2 isoform specific antibodies can also be produced by
  • the anti-FGFPv2 isoform specific antibodies can also be produced by phage display technology.
  • Phage display techniques for generating anti-FGFR2 isoform specific antibodies are known in the art (as described in, e.g., Ladner et al. U.S. Patent No. 5,223,409; Kang et al., International Publication No. WO 92/18619; Dower et al. International Publication No. WO 91/17271; Winter et al, International Publication WO 92/20791; Markland et al, International Publication No. WO 92/15679; Breitling et al, International Publication WO 93/01288;
  • McCafferty et al International Publication No. WO 92/01047; Garrard et al, International Publication No. WO 92/09690; Ladner et al, International Publication No. WO 90/02809; Fuchs et al, (1991) Bio/Technology 9: 1370-1372; Hay et al, (1992) Hum Antibod Hybridomas 3:81- 85; Huse et al, (1989) Science 246: 1275-1281; Griffths et al, (1993) EMBO J 12:725-734; Hawkins et al. (1992) J Mol Biol 226:889-896; Clackson et al.
  • a DNA sequence encoding the extracellular domain of the human FGFR2 beta (IIIc) protein was fused to the carboxy-terminal Fc region of human IgGl.
  • the two gene fragments were jointed by a 6 nucleotide linker from a restriction enzyme (Bgl-II), which created two amino acid residues, Arginine and Serine.
  • the total sequence encodes a polypeptide of 491 amino acids.
  • the signal sequence is 21 amino acids; therefore the mature protein of this chimera is 470 amino acids in length.
  • the calculated molecular weight is 52.81 kilodaltons (kDa).
  • FIG. 13 A The structure of this fusion protein is illustrated in FIG. 13 A.
  • the nucleotide (SEQ ID NO: 54) and amino acid (SEQ ID NO: 55) sequences of the soluble FGFR2 IIIc-Fc fusion protein are shown in FIG. 13B and 13C, respectively.
  • the fusion protein was expressed by generation of stable cell lines in CHO host cells.
  • the recombinant protein is soluble and secreted in the culture media.
  • the recombinant protein migrates as an approximately 95 kDa protein, presumably as a result of glycosylation (FIG. 13D).
  • FIG. 13D lane 7 shows the molecular weight standards. Thirteen clonal cell lines were analyzed on the blot (lanes 1-6, 8- 14).
  • the conditioned media (20 microliter per lane) from each clone was run on the SDS-PAGE gel, subsequently transferred onto Western blot.
  • the blot was stained with a secondary antibody, goat-anti-human IgG conjugated with alkaline phosphatase.
  • Lane 3, 10, 11 and 14 show positive expression of the Fc fusion protein of FGFR2 beta-ECD from stable clone number 1D2, 1F5, 1F7 and 1F10.
  • Clone 1D2 was used as a cell line for production of cell conditioned media for protein purification.
  • the supernatant of cell conditioned medium was collected after 72 hours of cell culture.
  • Fusion protein of FGFR2 beta-ECD was purified by affinity chromatography using Protein-G Sepharose fast Flow (GE Healthcare, Life Sciences - Products) according to manufacturer's protocol.
  • the functional activity of the purified soluble receptor was
  • ligand binding assay as shown in FIG 13E.
  • the ligand protein FGF8b was coated on ELIS A plates at 2 microgram per milliliter, at 4 C over night. Coated plates were washed in PSB containing 0.05% Tween-20 (PBST), subsequently blocked in 2% BSA in PBST buffer at room temperature for 2 hours. Subsequently, preparations of purified fusion protein FGFR2 beta-ECD, at concentration of 4 microgram per milliliter, was allowed to bind to the
  • FGF8b coated on the plates The binding was detected by adding a secondary antibody, goat anti- human IgG Fc conjugated with horseradish peroxidase (HRP) and by using a chromogenic substrate 3,3', 5, 5'- tetramethylbenzidine (TMB). The signal was measured in an ELISA plate reader at absorbance wavelength 450 nm.
  • HRP horseradish peroxidase
  • TMB chromogenic substrate 3,3', 5, 5'- tetramethylbenzidine
  • FGFR2c beta-EDC prep- A, and prep-B were added to the plate, 100 microliter per well at 4 microgram/ml. After incubation at room temperature for 60 minutes, the binding was measured with a goat anti-human IgG Fc-HRP and TMB substrate. The signal was measured at 450 nm on a plate reader. Results showed that both preparations of purified soluble receptor exhibited similar binding activity to its ligand FGF8b in the ELISA binding assay.
  • FGF8b is a specific growth factor ligand for isoform IIIc of receptor FGFR2, it does not detectably bind to Illb isoform of the same receptor (data not shown; Zhang et al., (2006) J Biol Chem. 281, 15694-15700).
  • Atto-MuMab-03 can block ligand binding of the receptor FGFR2IIIc
  • a ligand binding assay as described above in FIG 13E was performed in the presence or absence of the monoclonal antibody Atto-MuMab-03.
  • Atto-MuMab-03 was pre-incubated with FGFR2IIIc-ECD-Fc before adding to the ligand (FGF8b) coated plates.
  • the binding of FGFR2IIIc to the ligand in the presence or absence of different concentrations of Atto-MuMab-03 was measured via a secondary antibody conjugated with HRP (goat anti-human IgG Fc-HRP).
  • Isoform-specific peptides of FGFR2 IIIc can be generated by standard recombinant or solid phase synthesis.
  • 6C can be generated by cloning the corresponding nucleotide sequences into an expression vector as described in Example 2.
  • peptides can be synthesized by standard methods of solid or solution phase peptide chemistry.
  • a summary of the solid phase techniques can be found in Stewart and Young (1963) Solid Phase Peptide Synthesis, W. H. Freeman Co. (San Francisco), and Meienhofer (1973) Hormonal Proteins and Peptides, Academic Press (New York).
  • For classical solution synthesis see Schroder and Lupke, The Peptides, Vol. 1, Academic Press (New York).
  • one or more amino acids or suitably protected amino acids can be sequentially added to a growing peptide chain.
  • the protected amino acid is then either attached to an inert solid support or utilized in solution by adding the next amino acid in the sequence having the complimentary (amino or carboxyl) group suitably protected and under conditions suitable for forming the amide linkage.
  • the protecting group is then removed from this newly added amino acid residue and the next amino acid (suitably protected) is added, and so forth. After all the desired amino acids have been linked in the proper sequence, any remaining protecting groups (and any solid support) are removed sequentially or concurrently to afford the final peptide.
  • More than one amino acid can be added at a time to a growing chain, for example, by coupling (under conditions which do not racemize chiral centers) a protected tripeptide with a properly protected dipeptide to form, after deprotection, a pentapeptide.
  • This example evaluates the therapeutic feasibility of an antibody drug against FGFR2 IIIc (anti-FGFR2-IIIc antibody) in prostate cancer models.
  • the molecular target of the antibody, FGFR2 isoform IIIc has been associated with androgen-independent tumor growth and metastasis.
  • This approach is based on the high expression level of this receptor on hormone - refractory prostate cancer (HRPC) and its key role in enhancing the invasive behavior of tumor cells (epithelial-to-mesenchymal transition, EMT).
  • This isoform-specific antibody drug is designed with the intention of targeting the "bad isoform" of FGFR2 receptor on tumor, but spare the "good isoform" FGFR2-IIIb on normal prostate epithelium that functions to suppress tumor growth.
  • the androgen-independent human prostate cancer cells DU145 (ATCC) and DU9479 (Duke University) used in this study are both well-characterized cell lines displaying metastatic properties and androgen-independent growth.
  • DU145 was derived from carcinoma of prostate cancer metastasized to the brain (Stone et al. (1978) Int. J. Cancer 21: 274-281). This cell line expresses predominantly FGFR2-IIIc (Carstens et al., (1997) Oncogene 15, 3059-3065). It has been frequently used in animal model studies for tumor growth and angiogenesis (Garrison et al. , (2007) Cancer Res. 67: 11344-11352; Russel and Voeks (2003) Methods in Molecular
  • DU9479 is another androgen insensitive line, and consists of entirely FGFR2IIIc isoform (Carstens et al, (1997) Oncogene 15, 3059-3065).
  • DU145 is suitable for most of the experiments, including proliferation and receptor activation assays.
  • ligand binding assay Transfected cells that express the recombinant FGFR2IIIc target can be used.
  • Monoclonal antibodies anti-FGFR2-IIIc and Illb were generated and characterized (referenced herein as "Ab-1” or “Atto-MuMab-01” and “Ab-2” or “Atto-MuMab-02,” respectively).
  • Other biochemical reagents (FGFs) and immunochemical reagents ⁇ e.g., antibodies to phosphotyrosine, signaling molecules of Grb2, ERKl/2, STATl and SHP2) can be purchased from various commercial vendors.
  • the antibody molecules can be tested in vitro and in vivo using hormone-independent tumor lines, DU145 and DU9479. The following experiments can be conducted:
  • Atto-MuMab-01 Monoclonal antibody Atto-MuMab-01 was developed with a dual functionality in the design.
  • the mode-of-action for this antibody can include both inhibitor function, i.e. blocking receptor's activation, and immunological function, i.e. inducing cytotoxic T-cell activity.
  • Atto- MuMab-01 binds to the isoform- specific domain of Ig-like loop-3 on the FGFR2IIIc receptor. This domain is involved in ligand binding specificity as previously demonstrated by crystal structure analysis (Shaun et al., (2006) Genes & Dev. 20: 185-198). It is expected that antibody Atto-MuMab-01 can block ligand binding, therefore, inhibiting receptor activation.
  • the antibody can activate the body's cellular immunity.
  • This antibody is a human IgGl isotype and can elicit strong immune responses of antibody-dependent cellular cytotoxicity (ADCC) and/or complement-mediated cell lysis.
  • ADCC antibody-dependent cellular cytotoxicity
  • Atto-MuMab-01 is engineered at amino acid position 333 from glutamine to alanine in the Fc region to further enhance the ADCC activity of the antibody. Therefore, when the antibody binds to FGFR2IIIc positive tumor cells, it can recruit cytotoxic T-cells via ADCC to mount potent tumor killing activities.
  • Atto-MuMab-01 can have robust anti-tumor activity, and at the same time, can have an attractive safety feature. Because it binds strictly to the IIIc -positive tumor, it can selectively kill tumor cells without causing serious side-effects to normal epithelial tissues (which express Illb isoform).
  • FGF8b was PCR cloned from cDNA template (SEQ ID NO: 66) and inserted behind the secreted alkaline phosphatase gene in a commercially available expression vector.
  • a flexible linker of 10-amino acid GGGGSGGGGS SEQ ID NO: 59 was added between the two fragments, and a His-tag was added to the C-terminal of the fusion protein to facilitate protein purification.
  • the resulting fusion protein, FGF8-SEAP can be easily prepared as secreted form in cell supernatant and used directly for most of the assays.
  • purified SEAP commercially available
  • chemiluminescent substrate was used for measuring the light signal. SEAP activity directly correlates with the quantity of the ligand FGF8b.
  • Established anti-cancer antibody drugs such as Herceptin (anti-Her2 receptor for breast cancer) and Erbitux (anti-EGFR receptor for head and neck cancer) exhibit their anti-tumor activities via diverse mechanisms. These mechanisms include blocking receptor signaling, interfering with ligand-receptor binding, triggering apoptosis, and inducing cytotoxic effects via ADCC or complement-mediated lysis (Baselga et al., (2001) Semin Oncol. 5 Suppl 16:4-11; Trauth et al. (1989) Science 245:301; Yang et al. (1999) Cancer Res. 59: 1236). In this case, several in vitro experiments can be used to investigate the anti-tumor activity of Ab-1 to prostate cancer cells, with the intention to provide information for understanding drug's cellular mechanism in prostate cancer cells.
  • FGFR2 receptor activation Assay Dose Dependent Inhibition: The neutralizing activity of antibody on FGFR2 receptor activation in DU145 cells can be examined.
  • DU145 is known to express FGFR1, FGFR2IIIc (predominantly) and FGFR4 (Coombes et al., (2000) Book
  • DU145 cells are incubated with or without increasing concentrations of antibody before challenging with FGF8.
  • the range of antibody concentration can be empirically determined, which is dictated by antibody affinity and receptor expression level on the particular cells.
  • Antibody's inhibition curve can be established via quantification of phosphorylated receptors (e.g., densitometry scan), thus an IC 50 value for antibody inhibition of receptor activation can be deduced through these analyses.
  • downstream signaling events can be examined by analyzing the signaling molecules or effectors of FGFR2, e.g. Grb2, ERK1/2, p38 or STAT1.
  • FGFR2 e.g. Grb2, ERK1/2, p38 or STAT1.
  • These additional readouts can be used to confirm the data. Together with receptor activation, phosphorylation analyses, these results provide information for the potential potency of the drug.
  • These data can demonstrate whether antibody Ab- 1 has neutralizing activity. Mechanistically, the antibody could compete with ligand binding to the receptor, or it could block receptor dimerization. Both can give the same readout as inhibition of receptor activation and signaling. The following experiments are designed to answer those questions.
  • b Effect of blocking ligand binding or receptor dimerization
  • transfected HEK293 cells expressing the receptor FGFR2-IIIc can be used in a 96-well plate assay.
  • Non-radioactive and sensitive luminescence assays to measure ligand binding to its receptor were developed.
  • This assay format involves using a recombinant FGF8 infused with secreted alkaline phosphatase, FGF8- SEAP (as described above).
  • FGF8-SEAP can be used in the 20 pM to 5 nM concentration range according to previously reported ligand binding conditions (Zhang et ah, (2006) J Biol Chem.
  • Heparin is added at a concentration of 10 ⁇ g/ml to facilitate FGF8 binding to the receptor.
  • the receptor bound ligand can be directly quantified by adding chemiluminescence substrate of SEAP (CDP-Star ® from Applied Biosystems, or PhosphaGLO from KPL), and measured in a microplate reader (Luminoskan, Thermo
  • the IC 50 value can be obtained from a competition experiment, in which antibody Ab-1 is pre-incubated with cells at a concentration range from 1 pM to 100 nM. Subsequently, ligand SEAP-FGF8 is added to the cell culture. Dose dependent reduction of SEAP signal means that antibody competes with ligand binding site on the receptor.
  • FGFs bind to their receptors to induce receptor dimerization. This can be demonstrated using chemical cross-linking reagent, such as cross-linker SDP
  • transfected cells expressing FGFR2IIIc in 6-well culture plate are pre-incubated with antibody at 0, EC 50, and saturation concentrations. An irrelevant antibody can be used as a negative control.
  • FGF8 is added to the cells to induce receptor dimerization.
  • Chemical cross-linker DSP is then added to the cells for an additional incubation of 10 to 15 minutes at room temperature.
  • cell lysate is prepared and analyzed on Western blot with an anti- receptor antibody. The blot reveals primarily receptor monomers in un-stimulated cells, and increased dimers in FGF8 stimulated cells (in the absence of Ab-1 treatment).
  • MTT mitochondrial dehydrogenase activity
  • Cells at exponential growth can be seeded at 2000 - 3000 cell density in the wells of 96- well plates.
  • AB-1 at nM range is added to the wells with culture medium and incubated for 48 hours.
  • MTT (1 mg/ml) is added to the cells for incubation of 2 hours at 37 C.
  • Cells are lysed, and absorbance of the dye measured in micro-plate reader at 600 nm.
  • MC540 detects early stage of apoptosis (i.e. conformational changes in the plasma membrane). Tumor cells are treated with antibody similarly as described above for proliferation assay. The membrane change is measured by incorporation of the dye MC540.
  • Applicants examine the expression of the active form of caspase-7 by Western blotting. Anti-caspase-7 can be purchased from Cell Signaling
  • Example 5.4 In vivo study for Ab- 1 effect on human tumor xenografts
  • Endpoints include tumor volume, weight, tumor vasculature and metastasis index. Additional readouts, e.g. survival time, immunological responses, and toxicology can also be analyzed.
  • mice participating in experiments are checked every 2 days for signs of toxicity and discomfort including weight, level of activity, skin abnormalities, diarrhea, and general appearance.
  • a well-established subcutaneous (s.c.) tumor xenograft model using DU145 prostate cancer cells (Coombes et ah, Book “Endocrine Oncology", Edited by Stephen P. Ethier. Chapter 12, 237-253) can be adapted. Briefly, 5 xlO 6 tumor cells are inoculated into 6-week-old nude mice and allowed tumor to grow to 1 cm 3 (3- 4 weeks for DU145). Tumor fragments of 100 mm 3 volume are implanted into mice. Tumor growth is monitored every 3-days by external measurements with a caliper. Tumor-bearing mice are divided into 3 groups of 10 mice. Group-1 can be treated with taxol as positive control group.
  • Group-2 can be treated with antibody Ab-1 at 10 mg/kg, 2 times a week, i.p. injection for 5 weeks.
  • Group-3 can be treated with vehicle as a negative control group. Tumor growth is monitored by external measurement. Heparinized blood samples are drawn from the retro-orbital plexus for determination of plasma Ab-1 concentrations.
  • Example 5.5 Alternative strategies
  • Dunning rat prostate cancer model and the AT-3 hormone-independent cell line can be used.
  • This model system has been used extensively for studying the FGFR2 isoform function/regulation and is considered relevant to human HRPC (Sebastian et ah, (2006) PNAS 103: 14116-14121; Muh et al, (2002) JBC 277:50143-50154; Carstens et al, (2000) MCB, 20:7388-7400).
  • This approach can be evaluated to confirm that monoclonal antibodies, Ab-1 and Ab-2 (anti-FGFR2IIIc and anti-FGFR2IIIb, respectively) cross-react with rat receptors.
  • transfected cells with low endogenous FGFR2IIIc expression can be used in the in vitro study.
  • This example examines the presence of FGFR2 IIIc receptors on cell lines resembling hormone refractory prostate cancer in peripheral blood cells from patients via testing positive for CTC by the conventional, approved histopathology methods. Additional verification of the tumor nature of cells positive for FGFR2 IIIc expression can be done by PCR methods using isoform specific primer sets. The outcome of this study is to recognize a subgroup of patients, whose tumor and metastasis is dependent on the expression of FGFR2 isoform IIIc, and an additional enhancement of the specificity of the existing and approved CTC test using Ep-CAM.
  • this example evaluates the feasibility to detect and enrich CTCs (or epithelial-to-mesenchymal (ETM) transformed prostate tumor cells) expressing the oncogenic receptor FGFR2 isoform IIIc (FGFR2 IIIc) with an isoform specific antibody.
  • the initial focus is the identification and detection of circulating cells bearing FGFR2 IIIc from peripheral blood from patients with known metastatic diseases.
  • the technical optimization can be pursued on sensitivity of the detection in a healthy control group, patients with benign prostate hyperplasia, and prostate cancer patients.
  • This example is a feasibility study for the utility of FGFR2 IIIc as a valid biomarker for identification of prostate cancer CTCs for diagnosing metastatic disease and malignancy in asymptomatic prostate cancer patients. Further study focuses on:
  • FGFR2-IIIc positive spiked-in prostate tumor cells
  • TURP transurethral prostate resection
  • Example 6.1 Significance of the test for detection of circulating tumor cells
  • CTCs circulating tumor cells
  • DTCs dissected tumor cells
  • CTCs and DTCs represent unique diagnostic and therapeutic targets. Circulating tumor cells are extremely rare in patients with nonmalignant diseases but are present in various metastatic carcinomas with a wide range of frequencies (Allard et al. (2004) Clin Cancer Res. 10:6897-6904). Some clinical studies indicate the assessment of CTCs can assist physicians in monitoring and predicting cancer progression and in evaluating response to therapy in patients with metastatic cancer (Berrepoot et al., (2004) Ann Oncol. 15: 139-145; Aquino et al, (2002) J. Chemother.
  • Ep-CAM may miss
  • FGFR2-IIIc positive circulating tumor cells because FGFR2 IIIc expression on prostate cancer cells is associated with loss of epithelial markers and gain of mesenchymal markers (Moffa and Ethier (2007) J Cell Physiol. 210(3):720-31).
  • RT-PCR reverse-transcription PCR
  • Immunochemical e.g. antibody-coupled magnetic beads; immunofluorescent
  • RT-PCR offers a highly sensitive method to detect genes.
  • PCR detects living cells, dead cells, and free DNA, resulting in potential false-positives.
  • the specificity of the amplified target genes is a limiting factor for its diagnostic or prognostic value.
  • Tumor cells bearing an oncogenic receptor FGFR2 IIIc isoform found on androgen- independent tumors are believed to be responsible for invasive tumor growth and metastasis by intra-organ spread and by dissemination via blood stream, respectively.
  • the identification of prostate-derived circulating tumor cells (CTCs) by a FGFR2 IIIc specific antibody is an alternative step in the diagnosis and staging of prostate cancer. The continued presence of these cells in the circulation after prostatectomy may indicate the development of metastatic disease. Therefore, CTC detection shown in this example can provide additional sensitivity and specificity for diagnosing metastasis in HPCR patients.
  • Example 6.2 CTC enumeration for overall survival prediction in prostate cancer
  • Example 6.3 Immunomagnetic purification ofDU145 tumor cells spiked in normal blood
  • a Prepare immunomagnetic beads: monoclonal antibody against FGFR2 IIIc (in 0. lmg/ml in PBS containing 1% BSA) is immobilized onto magnetic beads pre-coupled with goat anti-mouse Fc (from Becton Dickinson) by an overnight incubation at 4 °C.
  • tumor cells are preload with fluorescent dye calcein AM for viable cells (from
  • Labeled cells are spiked in 7.5 ml normal blood cells at the following ratios: 1000 cells, 500 cells, 100 cells, 50 cells, 10 cells. These labeled cells are exposed to immunomagnetic beads, recovered fluorescent cells can be counted under a fluorescent microscope using a 20x magnification or by flow cytometry FACS analysis. A constant recovery rate is the demonstration of good efficiency of immunomagnetic selection of FGFR2-IIIc positive cells.
  • Example 6.4 Detection and enrichment of CTCs from patients with prostate cancer
  • FGFR2- IIIc positive CTCs can be performed with the use of the CellSpotter Analyzer, a semiautomated fluorescence-based microscopy system that permits computer-generated reconstruction of cellular images. Circulating tumor cells are counted as nucleated cells expressing FGFR2-IIIc. To confirm the epithelial cell nature of the isolated CTCs, cells can be double stained with an epithelial cell marker cytokeratinl9, labeled with another fluorescent dye phycoerytherin (PE).
  • PE phycoerytherin
  • RNA can be isolated using RNeasy Mini Kit, including RNase-Free DNase Set (Qiagen, Hilden, Germany). For reverse transcription, RNA is diluted in 15 ⁇ 1 of RNase-free water, incubated for 5 min at 65°C, and placed on ice.
  • a 7.5 ⁇ mixture containing 2 ⁇ of oligo- p(dT)15 primer (0.8 ⁇ g/ ⁇ ), 2 ⁇ of deoxynucleoside triphosphate (5 mM), 0.5 ⁇ of RNAsin (40 units/ ⁇ ), 1 ⁇ of Omniscript Reverse Transcriptase (4.5 units/ ⁇ ), and 2 ⁇ of reverse transcriptase buffer (xlO) are prepared and added to the diluted RNA. After incubation at 37°C for 1 h, Omniscript Reverse Transcriptase is inactivated for 5 min at 95°C, and cDNA can be stored at -20°C. PCR amplification is performed using IIIc exon specific primers (IIIc-F:
  • IIIb-R caaccatgcagagtgaaagga (SEQ ID NO: 72).
  • Illb exon specific primers IIIb-F: ggttctcaagcactcgggga (SEQ ID NO: 69) and IIIb-R:
  • gccaggcagactggttggcc (SEQ ID NO: 70) are used as reference.
  • the design of isoform-specific primers for PCR analysis is shown in FIG. 16.
  • Tumor cells, PC-3 (Illb positive) and DU145 (IIIc positive) can be used as positive controls for the PCR experiments.
  • the PCR product should be appear as a 140 base-pair band on agarose gel.
  • Example 7 FGFR2 III-c as a Biomarker for Detection of Hormone-Refractory Prostate Cancer
  • This example describes the establishment of an immunohistochemical staining (IHC) test for the detection of invasive, hormone-resistant prostate cancer.
  • IHC immunohistochemical staining
  • FGFR2 isoform IIIc is associated with androgen-independent tumor growth and metastasis, and it is expressed on the surface of cancerous prostate tissue.
  • biomarkers have been developed as immunohistochemical (IHC) staining tests for prostate cancer. These include pro state- specific antigen (PSA), pro state- specific membrane antigen (PSMA), prostate stem cell antigen (PSCA), androgen receptor (AR), chromogranin, synaptophysin, MIB-1, and a-methylacyl-CoA racemase (AMACR). These markers are not specific for metastatic status or metastatic potential.
  • PSA pro state- specific antigen
  • PSMA pro state- specific membrane antigen
  • PSCA prostate stem cell antigen
  • AR chromogranin
  • synaptophysin MIB-1
  • MIB-1 a-methylacyl-CoA racemase
  • AMACR a-methylacyl-CoA racemase
  • An examination of FGFR2 isoform IIIc and Illb expression in the biopsies and surgical specimens should provide additional information for patient with hormone refractory disease and a potential for metastasis.
  • Prostate cancer cell lines DU145 and LNCaP were originally obtained from the
  • ATC American Type Culture Collection
  • Prostate cancer with matched normal prostate tissue Arrays, and human tissue arrays can be obtained from US Biomax (Rockville, MD 20849); Multi-Tumor Microarrays will be obtained from Invitrogen (CA). These tissues should be in compliant with FDA and regulatory requirements.
  • Patients' clinical data, e.g. Gleason score and pathological stage of disease are available. Patient' s private information is protected.
  • IHC tests can be used for surgical samples from radical prostatectomy, or needle biopsies (NBX) and transurethral resections of the prostate (TURP).
  • NBX needle biopsies
  • TURP transurethral resections of the prostate
  • Objectives of this example include (i) establishing the IHC test protocol by using tumor cell lines fixed in paraffin as cell pellets; (ii) evaluating the utility of this IHC diagnostic test using tissue specimens from patients with prostate cancer and patients with benign prostate hypertrophy.
  • This biomarker can also be used in combination with other IHC tissue markers in a multi-biomarker analysis.
  • Monoclonal anti-FGFR2 IIIc and anti-FGFR2 Illb antibodies are generated as described above.
  • a monoclonal anti-Cytokeratin (Pan) Clone AE1/AE3 antibody is from Zymed (San Francisco, CA) and a polyclonal anti-PSA antibody is from Dako Cytomation.
  • Secondary antibody coupled with peroxidase, ChemMateTM, DAKO EnvisionTM Detection Kit are from Dako Cytomation (Denmark).
  • Diaminohenzidine can be used as cbromogen followed by Meyer's hematoxylin counterstaining.
  • Cell pellets are created from DU145 and LNCaP cells, fixed in 10% formalin overnight, and then processed in the regular manner for pathology specimens to produce paraffin embedded cell blocks. Tissue slides are already prepared from paraffin-blocks by commercial vendors.
  • Stained slides can be evaluated by experienced urological pathologists (consultants). A scoring method will be developed based on a varying degree of staining intensity and percentage of cells staining. The evaluation will be done in a blinded fashion.
  • mice were immunized either with the DNA construct encoding a 40-amino acid FGFR2 IIIc fragment (SEQ ID NO: 84; amino acid residues 314-353 of FGFR2 IIIc) or with a synthetic FGFR2 Illc-specific peptide (TCLAGNSIGISFH (SEQ ID NO: 86)), purified and conjugated to KLH.
  • SEQ ID NO: 84 amino acid residues 314-353 of FGFR2 IIIc
  • TCLAGNSIGISFH synthetic FGFR2 Illc-specific peptide
  • a 40-amino acid fragment (amino acid residues 313-352 of FGFR2 IIIc; AAGVNTTDKEIEVLYIRNVTFEDAGEYTCLAGNSIGISFH (SEP ID NO: 84)) fused at its carboxyl-terminus to mouse IgGl Fc was used as the immunogen.
  • Capital and underlined letters indicate unique residues in isoform FGFR2 IIIc that are non-homologous with isoform FGFR2 Illb.
  • Nucleotide sequence encoding the 40-amino acid FGFR2 IIIc fragment (SEQ ID NO: 84; amino acid residues 313-352) was inserted into a modified vector pVAC from

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Genetics & Genomics (AREA)
  • Medicinal Chemistry (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Investigating Or Analysing Biological Materials (AREA)

Abstract

L'invention concerne des molécules d'anticorps se liant spécifiquement à une ou plusieurs isoformes exprimées par et/ou associées à des phénotypes oncogènes d'une cellule hyperproliférative (par exemple, une cellule cancéreuse). Les molécules d'anticorps se liant aux isoformes peuvent être utilisées pour traiter, prévenir et/ou diagnostiquer une maladie cancéreuse. L'invention concerne également des méthodes d'utilisation des molécules se liant aux isoformes pour détecter sélectivement les isoformes oncogènes, pour réduire l'activité et/ou pour induire la destruction d'une cellule hyperproliférative exprimant une isoforme oncogène in vitro, ex vivo ou in vivo. En outre, l'invention concerne des méthodes de diagnostic et/ou de dépistage et des kits pour évaluer la fonction ou l'expression d'une isoforme oncogène.
EP11817134.7A 2010-08-12 2011-08-12 Molécules d'anticorps dirigées contre des isoformes oncogènes du récepteur 2 du facteur de croissance des fibroblastes et leurs utilisations Withdrawn EP2603521A4 (fr)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US37307210P 2010-08-12 2010-08-12
PCT/US2011/047650 WO2012021841A2 (fr) 2010-08-12 2011-08-12 Molécules d'anticorps dirigées contre des isoformes oncogènes du récepteur 2 du facteur de croissance des fibroblastes et leurs utilisations

Publications (2)

Publication Number Publication Date
EP2603521A2 true EP2603521A2 (fr) 2013-06-19
EP2603521A4 EP2603521A4 (fr) 2014-10-01

Family

ID=45568223

Family Applications (1)

Application Number Title Priority Date Filing Date
EP11817134.7A Withdrawn EP2603521A4 (fr) 2010-08-12 2011-08-12 Molécules d'anticorps dirigées contre des isoformes oncogènes du récepteur 2 du facteur de croissance des fibroblastes et leurs utilisations

Country Status (3)

Country Link
EP (1) EP2603521A4 (fr)
CN (1) CN103201287B (fr)
WO (1) WO2012021841A2 (fr)

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10172937B2 (en) 2013-08-01 2019-01-08 Five Prime Therapeutics, Inc. Method of treatment of malignant solid tumors with afucosylated anti-FGFR2IIIb antibodies
US11091555B2 (en) 2017-05-16 2021-08-17 Five Prime Therapeutics, Inc. Method of treating gastric cancer with anti-FGFR2-IIIb antibodies and modified FOLFOX6 chemotherapy
US11447553B2 (en) 2015-11-23 2022-09-20 Five Prime Therapeutics, Inc. FGFR2 inhibitors alone or in combination with immune stimulating agents in cancer treatment

Families Citing this family (13)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8663635B2 (en) 2006-03-21 2014-03-04 The Regents Of The University Of California N-cadherin: target for cancer diagnosis and therapy
US9260525B2 (en) 2008-02-04 2016-02-16 Xiao-Jia Chang Antibody molecules to oncogenic isoforms of fibroblast growth factor receptor-2 and uses thereof
MX2010010835A (es) * 2008-04-04 2011-02-22 Univ California Novedosos anticuerpos contra cancer dirigidos a bloqueo de crecimiento de tumor, angiogenesis y metastasis.
BR112012028764A2 (pt) 2010-05-11 2017-03-14 Aveo Pharmaceuticals Inc anticor-pos antifgfr2
AU2013247645B2 (en) 2012-04-09 2019-02-14 Daiichi Sankyo Company, Limited Anti-FGFR2 antibody
WO2014089193A1 (fr) * 2012-12-04 2014-06-12 Aveo Pharmaceuticals, Inc. Anticorps anti-fgfr2
US9415118B2 (en) * 2013-03-13 2016-08-16 Novartis Ag Antibody drug conjugates
US9498532B2 (en) 2013-03-13 2016-11-22 Novartis Ag Antibody drug conjugates
EP3287522A4 (fr) * 2015-04-20 2019-03-27 Daiichi Sankyo Company, Limited Détection de fgfr2
CN107513106A (zh) * 2016-06-17 2017-12-26 艾托金生物医药（苏州）有限公司 抗FGFR2-IIIc单克隆抗体、杂交瘤细胞株和应用
CA3037461A1 (fr) * 2016-09-27 2018-04-05 The University Of The Highlands And Islands Biomarqueurs antigeniques
KR102539445B1 (ko) * 2020-11-25 2023-06-05 (주)케어젠 미세먼지에 의한 세포 손상 방지 활성을 갖는 펩타이드 및 이의 용도
CN113150135B (zh) * 2021-04-14 2022-09-20 中山大学 抗新型冠状病毒受体结合区域中和抗体及其应用

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2009100105A2 (fr) * 2008-02-04 2009-08-13 Attogen Inc. Inhibiteurs d'isoformes oncogènes et leurs utilisations

Family Cites Families (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
TWI353992B (en) * 2003-07-22 2011-12-11 Schering Ag Rg1 antibodies and uses thereof
WO2006121207A1 (fr) * 2005-05-12 2006-11-16 Oncotherapy Science, Inc. Procedes pour endommager des cellules en utilisant une fonction effectrice d’un anticorps anti-dsc2
US20080300204A1 (en) * 2005-07-19 2008-12-04 University Of Rochester Alpha-Synuclein Antibodies and Methods Related Thereto
EP2020419A1 (fr) * 2007-07-31 2009-02-04 Bayer Schering Pharma Aktiengesellschaft Fragments d'anticorps anti-ephB4
PL2365828T3 (pl) * 2008-11-07 2015-04-30 Galaxy Biotech Llc Przeciwciała monoklonalne swoiste dla receptora 2 czynnika wzrostu fibroblastów

Patent Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2009100105A2 (fr) * 2008-02-04 2009-08-13 Attogen Inc. Inhibiteurs d'isoformes oncogènes et leurs utilisations

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
See also references of WO2012021841A2 *

Cited By (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10172937B2 (en) 2013-08-01 2019-01-08 Five Prime Therapeutics, Inc. Method of treatment of malignant solid tumors with afucosylated anti-FGFR2IIIb antibodies
US11235059B2 (en) 2013-08-01 2022-02-01 Five Prime Therapeutics, Inc. Afucosylated anti-FGFR2IIIB antibodies
US11447553B2 (en) 2015-11-23 2022-09-20 Five Prime Therapeutics, Inc. FGFR2 inhibitors alone or in combination with immune stimulating agents in cancer treatment
US11091555B2 (en) 2017-05-16 2021-08-17 Five Prime Therapeutics, Inc. Method of treating gastric cancer with anti-FGFR2-IIIb antibodies and modified FOLFOX6 chemotherapy

Also Published As

Publication number Publication date
WO2012021841A3 (fr) 2012-06-14
CN103201287B (zh) 2016-04-13
WO2012021841A2 (fr) 2012-02-16
CN103201287A (zh) 2013-07-10
EP2603521A4 (fr) 2014-10-01

Similar Documents

Publication Publication Date Title
US9260525B2 (en) Antibody molecules to oncogenic isoforms of fibroblast growth factor receptor-2 and uses thereof
WO2012021841A2 (fr) Molécules d'anticorps dirigées contre des isoformes oncogènes du récepteur 2 du facteur de croissance des fibroblastes et leurs utilisations
US20110059091A1 (en) Inhibitors of oncogenic isoforms and uses thereof
US10836831B2 (en) Anti-PTK7 antibodies and methods of use
CN112566662A (zh) 针对cd47的阻断抗体及其使用方法
US20130084243A1 (en) Igf-1r specific antibodies useful in the detection and diagnosis of cellular proliferative disorders
US20110286916A1 (en) Generation and characterization of anti-notch antibodies for therapeutic and diagnostic use
JP2017538442A (ja) 抗ｆｇｆｒ２／３抗体及びその使用方法
CA2694990A1 (fr) Anticorps specifiques de igf-1r utiles dans la detection et le diagnostic de troubles de proliferation cellulaire
KR20140031175A (ko) 신규 조절제 및 용법
US20180142032A1 (en) Anti-lamp1 antibodies and antibody drug conjugates, and uses thereof
CN113993899B (zh) 抗cd47抗体及其应用
US20090196880A1 (en) Cancer treatment using humanized antibodies that bind to EphB4
US8748587B2 (en) Molecules and methods for modulating TMEM16A activities
US8173434B2 (en) PCan065 antibody compositions and methods of use
KR101789338B1 (ko) 이소형 특이적 항-ｈｅｒ４ 항체
US20210403602A1 (en) Anti-ido antibody and uses thereof

Legal Events

Date Code Title Description
PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

17P Request for examination filed

Effective date: 20130307

AK Designated contracting states

Kind code of ref document: A2

Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO RS SE SI SK SM TR

DAX Request for extension of the european patent (deleted)
A4 Supplementary search report drawn up and despatched

Effective date: 20140828

RIC1 Information provided on ipc code assigned before grant

Ipc: A61K 39/395 20060101ALI20140822BHEP

Ipc: C07K 16/00 20060101AFI20140822BHEP

Ipc: C07K 16/28 20060101ALI20140822BHEP

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN

18D Application deemed to be withdrawn

Effective date: 20150303