EP2490691A1 - Utilisation de 1h-quinazoline-2,4-diones - Google Patents

Utilisation de 1h-quinazoline-2,4-diones

Info

Publication number
EP2490691A1
EP2490691A1 EP10766293A EP10766293A EP2490691A1 EP 2490691 A1 EP2490691 A1 EP 2490691A1 EP 10766293 A EP10766293 A EP 10766293A EP 10766293 A EP10766293 A EP 10766293A EP 2490691 A1 EP2490691 A1 EP 2490691A1
Authority
EP
European Patent Office
Prior art keywords
methanesulfonamide
dioxo
dihydro
quinazolin
trifluoromethyl
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Withdrawn
Application number
EP10766293A
Other languages
German (de)
English (en)
Inventor
Hans Allgeier
Yves Auberson
Alexandre Avrameas
Thomas Blaettler
David Carcache
Philipp Floersheim
Wolfgang Froestl
Christel Guibourdenche
Hans O. Kalkman
Joerg Kallen
Manuel Koller
Kurt LINGENHÖHL
Shenglin Ma
Henri Mattes
Joachim Nozulak
David Orain
Johanne Renaud
Christine Strohmaier
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Novartis AG
Original Assignee
Novartis AG
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Novartis AG filed Critical Novartis AG
Priority to EP10766293A priority Critical patent/EP2490691A1/fr
Publication of EP2490691A1 publication Critical patent/EP2490691A1/fr
Withdrawn legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/495Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
    • A61K31/505Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
    • A61K31/517Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim ortho- or peri-condensed with carbocyclic ring systems, e.g. quinazoline, perimidine
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/335Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin
    • A61K31/34Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin having five-membered rings with one oxygen as the only ring hetero atom, e.g. isosorbide
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/08Antiepileptics; Anticonvulsants

Definitions

  • the present invention relates to pharmaceutical uses of 1 H-quinazoline-2,4-diones, their pharmaceutically acceptable salts, and prodrugs thereof specifically for the treatment of Rasmussen's encephalitis or epilepsy, e.g. Rasmussen's encephalitis
  • Rasmussen's encephalitis is a rare, progressive neurological disorder.
  • the typical features of Rasmussen's encephalitis are onset in childhood (usually between the ages of 14 months and 14 years) and the development of slowly progressive, neurological deterioration (including hemiparesis; cognitive impairment; dysphasia; radiological evidence of a progressive, usually unilateral, cerebral atrophy; and a pathological picture suggesting an encephalitis).
  • seizures are the most common initial symptom, with approximately 20% of patients presenting with generalised or focal status epilepticus, 33% with a generalised tonic clonic seizure and the others with partial seizures.
  • Rasmussen's encephalitis was described about 50 years ago, yet the cause and optimum treatment still remains unclear.
  • treatment of the seizure themselves with common antiepileptic drugs has proved disappointing with most patients receiving polytherapy causing significant toxicity, but with little effect on seizures (Hart, Epileptic Disorder, 2004, 6, 133-144).
  • a first aspect of the invention relates to a compound, 1 H-quinazoline-2,4-diones of formula (I)
  • Ri is C Cealkyl substituted by one, two or three substituents selected from hydroxy, C C 6 alkoxy or C 5 -C 6 cycloalkoxy; or
  • R 3 is C C 6 alkyl, hydroxy or C Cealkoxy-d-Cealkyl
  • R 4 is hydrogen or Ci-C 6 alkyl
  • n 1 or 2;
  • R 2 is d-Caalkyl or Ci-C 3 fluoroalkyl
  • a second aspect of the invention concerns a method for the treatment, prevention or delay of progression of Rasmussen's encephalitis in a subject in need of such treatment, which comprises administering to said subject a therapeutically effective amount of a 1 H- quinazoline-2,4-dione of formula (I).
  • a third aspect of the invention concerns a method for the treatment, prevention or delay of progression of epilepsy in a subject in need of such treatment, which comprises administering to said subject a therapeutically effective amount of a 1 H-quinazoline-2,4- dione of formula (I).
  • a fourth aspect of the invention relates to the use of a 1 H-quinazoline-2,4-dione of formula (I) for the treatment (whether therapeutic or prophylactic), prevention or delay of progression of Rasmussen's encephalitis or epilepsy, e.g. Rasmussen's encephalitis.
  • a fifth aspect of the invention relates to a 1 H-quinazoline-2,4-dione of formula (I) for the treatment, prevention or delay of progression of Rasmussen's encephalitis or epilepsy, e.g. Rasmussen's encephalitis.
  • a sixth aspect of the invention relates to a pharmaceutical composition
  • a pharmaceutical composition comprising a 1 H- quinazoline-2,4-dione of formula (I) for the treatment, prevention or delay of progression of Rasmussen's encephalitis or epilepsy, e.g. Rasmussen's encephalitis.
  • a seventh aspect of the invention relates to the use of a 1 H-quinazoline-2,4-dione of formula (I) for the manufacture of a medicament for the treatment, prevention or delay of progression of Rasmussen's encephalitis or epilepsy, e.g. Rasmussen's encephalitis.
  • the invention relates to a method for the treatment, prevention or delay of progression of Rasmussen's encephalitis in a subject in need of such treatment, which comprises administering to said subject a therapeutically effective amount of a compound of formula (I), wherein said subject is selected among those having an abnormal serum level of anti-GluR3 autoantibodies.
  • the invention relates to a method for the treatment, prevention or delay of progression of Rasmussen's encephalitis in a subject in need of such treatment, which comprises administering to said subject a therapeutically effective amount of a compound of formula (I), wherein said subject is selected among those having an abnormal serum level of anti-GluR3 autoantibodies with agonistic activity.
  • a further aspect of the invention is a method for the treatment, prevention or delay of progression of epilepsy in a subject in need of such treatment, which comprises administering to said subject a therapeutically effective amount of a compound of formula (I), wherein said subject is selected among those having an abnormal serum level of anti- GluR3 autoantibodies.
  • a further aspect of the invention is a method for the treatment, prevention or delay of progression of epilepsy in a subject in need of such treatment, which comprises administering to said subject a therapeutically effective amount of a compound of formula (I), wherein said subject is selected among those having an abnormal serum level of anti- GluR3 autoantibodies with agonistic activity.
  • a further aspect of the invention is a method of screening a subject to determine whether they are likely to respond to treatment with a 1 H-quinazoline-2,4-dione of formula (I) comprising the steps of:
  • a further aspect of the invention is a method for monitoring the treatment of epilepsy or Rasmussen's encephalitis, e.g. Rasmussen's encephalitis, in a subject comprising the steps of:
  • the biological sample may have already been obtained from a subject, thus the invention further provides:
  • the invention also provides:
  • a method for monitoring the treatment of epilepsy or Rasmussen's encephalitis, e.g. Rasmussen's encephalitis, in a subject comprising the steps of:
  • the invention relates to a compound, 1 H-quinazoline-2,4-diones of formula (I)
  • Ri is (-VCealkyl substituted by one, two or three substituents selected from hydroxy, C C 6 alkoxy or C 5 -C 6 cycloalkoxy; C 5 -C 6 cycloalkyl substituted by one, two or three substituents selected from hydroxy, d-C 6 alkoxy or C 5 -C 6 cycloalkoxy; or
  • R 3 is C C 6 alkyl, hydroxy or CrC 6 alkoxy-Ci-C 6 alkyl
  • R 4 is hydrogen or CrC 6 alkyl
  • n 1 or 2;
  • R 2 is C Caalkyl or Ci-C 3 fluoroalkyl
  • Rasmussen's encephalitis for use in a method for the treatment, prevention or delay of progression of Rasmussen's encephalitis or epilepsy, e.g. Rasmussen's encephalitis.
  • the compound of formula (I) is a competitive AMPA antagonist. It is well understood that allosteric (non-competitive) antagonists provide an insurmountable blockade of AMPA receptors, potentially preventing any AMPA receptor-mediated neurotransmission at the synapse. In contrast, a high concentration of glutamate at the synapse can still activate the post-synaptic membrane in the presence of a competitive AMPA antagonist (albeit with a lower efficacy). Competitive AMPA antagonists may therefore exhibit an improved safety profile, as they will not fully block neurotransmission, but instead reduce the exaggerated glutamate signaling observed in some neurological disease, e.g. epilepsy.
  • Compounds of the formula (I) not only block AMPA-induced glutamate release from activated astrocytes but after oral dosing also suppress epilepsy seizures in epilepsy or in Rasmussen encephalitis.
  • the compound of the invention of formula (I) in addition to the advantage of being a competitive AMPA antagonist receptor inhibitor, presents also the advantage of being a selective competitive AMPA antagonist. Furthermore the compound of the invention of formula (I) is capable of penetrating the blood brain barrier and may be formulated in an oral dosage form.
  • the following definitions shall apply if no specific other definition is given:
  • Cy 6 alkyl represents a straight-chain or branched-chain alkyl group; for example, methyl, ethyl, n- or iso-propyl, n-, iso-, sec- or tert-butyl, n-pentyl, n-hexyl, with particular preference given to methyl, ethyl, n-propyl and iso-propyl.
  • C 5 -C 6 cycloalkyl represents cyclopentyl or cyclohexyl; preferably cyclopentyl.
  • alkyl/cycloalkyl-part of "alkoxy”, “cycloalkoxy”, “alkoxyalkyl” and “fluoroalkyl” shall have the same meaning as described in the above-mentioned definitions of "alkyl”/" cycloalkyl.
  • Ci-C 3 fluoroalkyl preferably represents trifluoromethyl, difluoromethyl or fluoromethyl.
  • any discussion of methods or references to the active ingredients includes said active ingredient in free form and in form of a pharmaceutically acceptable salt. If the active ingredients have, for example, at least one acidic center (for example COOH) they can form salts with bases.
  • the active ingredient or a pharmaceutically acceptable salt thereof may also be used in the form of a hydrate or may include other solvents used for crystallization.
  • a “pharmaceutically acceptable salt” is intended to mean a salt of a free base/free acid of a compound represented by formula (I) that is not toxic, biologically intolerable, or otherwise biologically undesirable.
  • Preferred pharmaceutically acceptable salts are those that are pharmacologically effective and suitable for contact with the tissues of patients without undue toxicity, irritation, or allergic response.
  • Such salts are known in the field (e.g. S.M. Berge, et al, “Pharmaceutical Salts", J. Pharm. Sd., 1977, 66:1-19; and “Handbook of Pharmaceutical Salts, Properties, Selection, and Use", Stahl, RH., Wermuth, C.G., Eds.; Wiley-VCH and VHCA: Zurich, 2002).
  • the H-quinazoline-2,4-diones of formula (I) is used in free form.
  • the 1 H-quinazoline-2,4-diones of formula (I), their manufacture and their use as competitive AMPA receptor antagonists are known from WO 2006/108591 or can be prepared analogously to said reference.
  • WO 2006/108591 is incorporated herein by reference.
  • the compounds may exist in optically active form or in form of mixtures of optical isomers, e.g. in form of racemic mixtures or diastereomeric mixtures. All optical isomers and their mixtures, including racemic mixtures, are part of the present invention.
  • the H-quinazoline-2,4-dione of formula (I) is a compound, wherein is Ci-C 6 alkyl substituted by one, two or three substituents selected from hydroxy, d-C 6 alkoxy or C 5 -C 6 cycloalkoxy; and R 2 is CrC 3 alkyl or CrC 3 fluoroalkyl.
  • the 1 H-quinazoline-2,4-dione of formula (I) is a compound, wherein is
  • R 3 is Ci-C 6 alkyl, hydroxy or CrCealkoxy-Ci-Cealkyl; and R 2 is C r C 3 alkyl or C r C 3 fluoroalkyl.
  • the 1 H-quinazoline-2,4-dione of formula (I) is a compound, wherein is
  • R 4 is hydrogen or CrC e alkyl; n is 1 or 2; and R 2 is C C 3 alkyl or CrCsfluoroalkyl.
  • the 1 H-quinazoline-2,4-dione of formula (I) is a compound selected from the group consisting of
  • A-1 N-[6-(1-Hydroxy-ethyl)-2,4-dioxo-7-trifluoromethyl-1 ,4-dihydro-2H-quinazolin-3-yl]- methanesulfonamide;
  • A-2 N-[6-(1 -Methoxy-ethyl)-2,4-dioxo-7-trifluoromethyl-1 ,4-dihydro-2H-quinazolin-3-yl]- methanesulfonamide;
  • A-3 N-[6-(1 -Hydroxy-propyl)-2,4-dioxo-7-trifluoromethyl-1 ,4-dihydro-2H-quinazolin-3-yl]- methanesulfonamide;
  • A-4 N-[6-(1 -lsopropoxy-ethyl)-2,4-dioxo-7-trifluoromethyl-1 ,4-dihydro-2H-quinazolin-3-yl]- methanesulfonamide;
  • A-5 N-[6-(1 -Ethoxy-ethyl)-2,4-dioxo-7-trifluoromethyl-1 ,4-dihydro-2H-quinazolin-3-yl]- methanesulfonamide;
  • A-6 N-[2,4-Dioxo-6-(1-propoxy-propyl)-7-trifluoromethyl-1 ,4-dihydro-2H-quinazolin-3-yl]- methanesulfonamide;
  • A-7 N-[6-(1 -isopropoxy-propyl)-2,4-dioxo-7-trifluoromethyl-1 ,4-dihydro-2H-quinazolin-3-yl]- methanesulfonamide;
  • A-8 N-[7-Difluoromethyl-6-(1-ethoxy-ethyl)-2,4-dioxo-1 ,4-dihydro-2H-quinazolin-3-yl]- methanesulfonamide;
  • A-9 N- ⁇ -Dioxo-e-il-propoxy-ethy -y-trifluoromethyl-l ⁇ -dihydro ⁇ H-quinazolin-S-yl]- methanesulfonamide;
  • A-10 N-[6-(1 -Butoxy-ethyI)-2,4-dioxo-7-trifluoromethyl-1 ,4-dihydro-2H-quinazolin-3-yl]- methanesulfonamide;
  • A-1 1 N-[6-(1 -lsobutoxy-ethyl)-2,4-dioxo-7-trifluoromethyl-1 ,4-dihydro-2H-quinazolin-3-yl]- methanesulfonamide;
  • A-12 N-[6-(1 -methoxy-butyl)-2,4-dioxo-7-trifluoromethyI-1 ,4-dihydro-2H-quinazolin-3-yl]- methanesulfonamide;
  • A-13 N-[6-(1 -Ethoxy-propyl)-2,4-dioxo-7-trifluoromethyl-1 ,4-dihydro-2H-quinazolin-3-yl]- methanesulfonamide;
  • A-1 N-[6-(1-Cyclopentyloxy-ethyl)-2,4-dioxo-7-trifluoromethyl-1 ,4-dihydro-2H-quinazolin-3- yl]-methanesulfonamide;
  • A-15 N-[6-(1 -Hydroxy-butyl)-2,4-dioxo-7-trifluoromethyl-1 ,4-dihydro-2H-quinazolin-3-yl]- methanesulfonamide;
  • A-16 N-[6-(1 -Methoxy-2-methyl-propyl)-2,4-dioxo-7-trifluoromethyl-1 ,4-dihydro-2H- quinazolin-3-yl]-methanesulfonamide;
  • A-17 N-[6-(3-Hydroxy-propyl)-2,4-dioxo-7-trifluoromethyl-1 ,4-dihydro-2H-quinazoIin-3-yl]- methanesulfonamide;
  • A-18 N-[6-(1 -Hydroxy-3-methoxy-propyl)-2,4-dioxo-7-trifluoromethyl-1 ,4-dihydro-2H- quinazolin-3-yl]-methanesulfonamide;
  • B-1 N-[2,4-Dioxo-6-(tetrahydro-pyran-2-yl)-7-trifluoromethyl-1 ,4-dihydro-2H-quinazolin-3-yl]- methanesulfonamide;
  • B-2 N-[2,4-Dioxo-6-(tetrahydro-furan-2-yl)-7-trifluoromethyl-1 ,4-dihydro-2H-quinazolin-3-yl]- methanesulfonamide;
  • C-3 N-[7-Fluoromethyl-6-(2-isopropyl-2H-pyrazol-3-yl)-2,4-dioxo-1 ,4-dihydro-2H-quinazolin- 3-yl]-methanesulfonamide;
  • C-4 N- ⁇ 6-[2-(2-Methoxy-ethyl)-2H-pyrazol-3-yl]-2,4-dioxo-7-trifluoromethyl-1 ,4-clihydro-2H- quinazolin-3-yl ⁇ -methanesulfonamide;
  • C-7 N-[7-lsopropyl-6-(2-methyl-2H-pyrazol-3-yl)-2,4-dioxo-1 ,4-dihydro-2H-quinazolin-3-yl]- methanesulfonamide;
  • C-1 1 N-[7-Ethyl-6-(2-methyl-2H-pyrazol-3-yl)-2,4-dioxo-1 ,4-dihydro-2H-quinazolin-3-yl]- methanesulfonamide;
  • the compounds of the invention may be prepared by any suitable method, e.g. as described in WO 2006/108591.
  • the 1 H-quinazoline-2,4-dione of formula (I) is a compound selected from the group consisting of compound A-1 , A-2, A-3, A-4, A-5, A-6, A- 7, A-8, A-9, A-10, A-1 1 , A-12, A-13, A-14, A-15, A16, A17, A-18 and A-19.
  • the 1 H-quinazoline-2,4-dione of formula (I) is a compound selected from the group consisting of compound B-1 , B-2 and B-3.
  • the 1 H-quinazoline-2,4-dione of formula (I) is a compound selected from the group consisting of compound C-1 , C-2, C-3, C-4, C-5, C-6, C- 7, C-8, C-9, C-10, C-1 1 , C-12, C-13, C-14, C-15, C-16, C-17 and C-18.
  • Advantageous compounds of the invention i.e., the 1 H-quinazoline-2,4-diones of formula (I), should be well absorbed from the gastrointestinal tract, penetrate the blood brain barrier, be sufficiently metabolically stable and possess favorable pharmacokinetic properties.
  • Preferred compounds, having superior bioavailibility are 1 H-quinazoline-2,4-dione of formula (I) selected from the group consisting of compounds: A-1 , A-2, A-3, A-4, A-5, A-6, A-7, A-13, A-14, A-15, A-18, B-2, B-3, C-1 , C-2, C-3, C-4, C-5, C-6, C-7, C-8, C-9, C-10, C- 11 , C-12, C-15, C-16, C-17 and C-18.
  • More preferred compounds, having superior bioavailibility are 1 H-quinazoline-2,4-dione of formula (I) selected from the group consisting of compounds: A-1 , A-2, A-3, A-4, A-5, A-7, A-15, B-2, B-3, C-1 , C-2, C-3, C-6, C-7, C-8, C-9, C-10, C-1 1 , C-12, C-15, C-17 and C-18.
  • prodrug as used herein relates to a compound, which converts in vivo into a compound used in the present invention.
  • a pro-drug is an active or inactive compound that is modified chemically through in vivo physiological action, such as hydrolysis, metabolism and the like, into a compound of this invention following administration of the prodrug to a subject.
  • the suitability and techniques involved in making and using pro-drugs are well known by those skilled in the art.
  • prodrug represents in particular compounds which are transformed in vivo to the parent compound, for example, by hydrolysis in blood, for example as described in T. Higuchi and V. Stella, Pro-drugs as Novel Delivery Systems, Vol. 14 of the A.C.S. Symposium Series, Edward B.
  • Prodrugs therefore include drugs having a functional group which has been transformed into a reversible derivative thereof. Typically, such prodrugs are transformed to the active drug by hydrolysis. As examples may be mentioned the following:
  • Carboxylic acid Esters including e.g. alkyl esters
  • Alcohol Esters including e.g. sulfates and phosphates as well
  • Amine Amides carbamates, imines, enamines,
  • Prodrugs also include compounds convertible to the active drug by an oxidative or reductive reaction. As examples may be mentioned Oxidative activation
  • each of the above described reactions and/or reaction steps can be used individually or in combination in a method to prepare a AMPA-inhibitor or a prodrug thereof.
  • the compounds of the present invention including their salts, can also be obtained in the form of their hydrates, or include other solvents used for their crystallization.
  • the compounds of the present invention may inherently or by design form solvates with pharmaceutically acceptable solvents (including water); therefore, it is intended that the invention embrace both solvated and unsolvated forms.
  • solvate refers to a molecular complex of a compound of the present invention (including pharmaceutically acceptable salts thereof) with one or more solvent molecules.
  • solvent molecules are those commonly used in the pharmaceutical art, which are known to be innocuous to the recipient, e.g., water, ethanol, and the like.
  • hydrate refers to the complex where the solvent molecule is water.
  • the compounds of the present invention, including salts, hydrates and solvates thereof, may inherently or by design form polymorphs.
  • Preferred prodrugs of the invention should be well absorbed from the gastrointestinal tract, be transformed into the parent compound (or active principle, being the compound that in- vivo acts as AMPA receptor antagonist), the parent compound should be sufficiently metabolically stable and possess favorable pharmacokinetic properties.
  • prodrugs of the invention lead to an oral bioavailability of the parent compound which is comparable to the bioavailability when administered as a drug.
  • Further preferred prodrugs of the invention exhibit increased oral bioavailability compared to the parent compound when administered as a drug.
  • Oral bioavailability may manifest itself in different ways: (i) a biological effect may be achieved after oral administration when the parent compound is less effective upon oral administration, (ii) an earlier onset of action upon oral administration, (iii) a lower dose needed to achieve the same effect, (iv) a higher effect achieved by the same dose or (v) a prolonged action at the same dose.
  • prodrugs of the invention are transformed into parent compounds which in-vivo bind potently to AMPA receptors whilst showing little affinity for other receptors.
  • Some prodrugs of the invention are transformed into parent compounds which also show antagonistic activity at kainate receptors. Besides such dual activity, showing little affinity for other receptors is a preferred feature.
  • prodrugs of the invention when the active principle is targeted against receptors in the central nervous system - are transformed into parent compounds that cross the blood brain barrier freely.
  • prodrugs of the invention when the active principle is targeted selectively against receptors in the peripheral nervous system - are transformed into parent compounds that do not cross the blood brain barrier.
  • Prodrugs, parent compounds and released pro-moieties should be non-toxic and demonstrate few side-effects.
  • the ideal prodrug of the invention will be able to exist in a physical form that is stable, non-hygroscopic and easily formulated.
  • the higher oral bioavailability of the compounds for use in the invention may give rise to the following beneficial effects relating to less bioavailable compounds: (i) an enhanced biological effect may be achieved after oral administration; (ii) an earlier onset of action may be observed following oral administration; (iii) a lower dose may be needed to achieve the same effect; (iv) a higher effect may be achieved by the same dose or (v) a prolonged action may be observed at the same dose.
  • the compound for use in the invention when tested in-vivo potently binds to AMPA receptors whilst showing little affinity for other receptors.
  • subject refers to a human being, especially to a patient being diagnosed with Rasmussen's encephalitis or epilepsy, or who is suspected of having Rasmussen's encephalitis or epilepsy.
  • treatment refers to any type of treatment that imparts a benefit to a subject affected with a disease, e.g. a patient diagnosed with a disease, including improvement in the condition of the subject (e.g. in one or more symptoms) or prevention/delay of the onset/progression of the disease (e.g. prophylactic treatment).
  • treatment typically comprise a reduction in the symptoms associated with Rasmussen's encephalitis, including for example, although not limited to, a reduction in number and severity of seizures, a reduction of cognitive impairment, a reduction of dysphasia, a reduction of brain areas showing atrophy or a pathological picture suggesting an encephalitis.
  • treatment typically comprise a reduction in the symptoms associated with epilepsy, including a reduction in number and severity of seizures.
  • therapeutically effective amount typically refers to a drug amount which, when administered to a subject, is sufficient to provide a therapeutic benefit, e.g. is sufficient for treating, preventing or delaying the progression of epilepsy or Rasmussen's encephalitis (e.g. the amount provides an amelioration of symptoms, e.g. it leads to a reduction in number and severity of seizures) or is sufficient for treating, preventing or delaying the progression of epilepsy.
  • the appropriate dosage will vary depending upon, for example, the compound employed, the host, the mode of administration and the nature and severity of the condition being treated. However, in general, satisfactory results in animals are indicated to be obtained at a daily dosage of from about 0.01 to about 100 mg/kg body weight, preferably from about 1 to about 30 mg/kg body weight, e.g. 10 mg/kg. In larger mammals, for example humans, an indicated daily dosage is in the range from about 0.1 to about 1000 mg, preferably from about 1 to about 400 mg, most preferably from about 10 to about 100 mg of a 1 H-quinazoline-2,4- dione of formula (I) conveniently administered, for example, in divided doses up to four times a day.
  • about 100mg of a 1 H-quinazoline-2,4-dione of formula (I) is administered daily. In a further embodiment, about 200mg of a 1 H-quinazoline-2,4-dione of formula (I) is administered daily.
  • the 1 H-quinazoline-2,4-diones of formula (I) may be administered as single active agent or in combination with one or more other active agents, in any usual manner, e.g. orally, for example in the form of tablets, capsules or drinking solutions; rectally, for example in the form of suppositories; intravenously, for example in the form of injection solutions or suspensions; or transdermal ⁇ , for example in the form of a patch.
  • the manner of administration is oral administration, for example in the form of a tablet, capsule or drinking solution.
  • the manner of administration is rectal administration, for example in the form of a suppository.
  • the manner of administration is transdermal administration, for example in the form of a patch. In one preferred embodiment, the manner of administration is oral administration.
  • Preferred pharmaceutical compositions comprise a H-quinazoline-2,4-diones of formula (I) in association with at least one pharmaceutical carrier or diluent.
  • Such compositions may be manufactured in conventional manner.
  • Unit dosage forms may contain, for example, from about 2.5 to about 250 mg, preferably from about 2.5 to about 200 mg, more preferably from about 2.5 to about 100 mg, still more preferably from about 2.5 to about 50 mg and still more preferably from about 2.5 to about 25 mg, of one or more of the 1 H-quinazoline-2,4- diones of formula (I).
  • compositions according to the invention are compositions for enteral administration, such as oral or rectal administration; or parenteral administration, such as intramuscular, intravenous, and nasal or transdermal administration, to warm-blooded animals (human beings and animals) that comprise an effective dose of the pharmacological active ingredient alone or together with a significant amount of a pharmaceutically acceptable carrier.
  • the dose of the active ingredient depends on the species of warm-blooded animal, body weight, age and individual condition, individual pharmacokinetic data, the disease to be treated and the mode of administration.
  • the pharmaceutical compositions comprise from approximately 1 % to approximately 95%, preferably from approximately 20% to approximately 90%, active ingredient.
  • compositions according to the invention may be, for example, in unit dose form, such as in the form of ampoules, vials, suppositories, dragees, tablets or capsules.
  • the pharmaceutical compositions of the present invention are prepared in a manner known per se, for example by means of conventional dissolving, lyophilizing, mixing, granulating or confectioning processes. Such processes are exemplified in WO 2005/079802, WO 2003/047581 , WO 2004/000316, WO 2005/044265, WO 2005/044266, WO 2005/044267, WO 2006/114262 and WO 2007/071358.
  • compositions for transdermal administration are described in Remington's Pharmaceutical Sciences 16 th Edition Mack; Sucker, Fuchs and Spieser, Pharmazeutician Technologie, 1 st Edition, Springer.
  • the invention relates to a method for the treatment, prevention or delay of progression of epilepsy or Rasmussen's encephalitis in a subject in need of such treatment, which comprises administering to said subject a therapeutically effective amount of a compound of formula (I), wherein said subject is selected among those having an abnormal serum level of anti-GluR3 autoantibodies.
  • the invention relates to a method for the treatment, prevention or delay of progression of epilepsy or Rasmussen's encephalitis in a subject in need of such treatment, which comprises administering to said subject a therapeutically effective amount of a compound of formula (I), wherein said subject is selected among those having an abnormal serum level of anti-GluR3 autoantibodies with agonistic activity.
  • a further aspect of the invention is a method for the treatment, prevention or delay of progression of epilepsy in a subject in need of such treatment, which comprises administering to said subject a therapeutically effective amount of a compound of formula (I), wherein said subject is selected among those having an abnormal serum level of anti- GluR3 autoantibodies.
  • a further aspect of the invention is a method for the treatment, prevention or delay of progression of epilepsy in a subject in need of such treatment, which comprises administering to said subject a therapeutically effective amount of a compound of formula (I), wherein said subject is selected among those having an abnormal serum level of anti- GluR3 autoantibodies with agonistic activity.
  • a further aspect of the invention is a method of screening a subject to determine whether they are likely to respond to treatment with a 1 H-quinazoline-2,4-dione of formula (I) comprising the steps of:
  • a further aspect of the invention is a method for monitoring the treatment of epilepsy or Rasmussen's encephalitis in a subject comprising the steps of:
  • the invention also provides:
  • a method for monitoring the treatment of epilepsy or Rasmussen's encephalitis in a subject comprising the steps of:
  • the monitoring of the subject using such a method will also allow the physician to tailor the treatment of the subject.
  • the dosage of a 1 H- quinazoline-2,4-dione of formula (I) may be increased, or vice versa.
  • the dosage of a 1 H-quinazoline-2,4-dione of formula (I) may be decreased, or vice versa.
  • the anti-GluR3 autoantibodies are anti-GluR3B autoantibodies.
  • autoantibodies refers to antibodies formed in response to an immune reaction and reacting against an antigenic constituent of the subject's own proteins, cells or tissues.
  • the autoantibody may be of the isotype IgA, IgD, IgE, IgG, or IgM.
  • the autoantibody isotype is IgG or IgM. Different assays may be required to optimally detect the different isotypes.
  • anti-GluR3 autoantibodies refers to autoantibodies that bind to GluR3 antigen. Such binding must be measurably and significantly different from a nonspecific interaction.
  • the GluR3 gene belongs to the gene family comprising GluR1 , GluR2, GluR3 and GluR4, which are all coding for subunits of homomeric or heteromeric AMPA receptors. Said AMPA receptors are ionotrophic glutamate receptors found in the central nervous system.
  • GluR3B is a peptide of 24 amino acids. Both human (NEYERFVPFSDQQISNDSASSENR - SEQ ID NO: 6) and rodent (NEYERFVPFSDQQISNDSSSSENR - SEQ ID NO: 7) forms of GluR3B are known to exist.
  • the serum level of antibodies can be determined from a biological sample, for example a blood sample or a serum sample, of a subject in need of treatment.
  • a serum sample is obtained from a subject in need of treatment.
  • Said biological sample may be pre-treated prior to determining the level of anti-GluR3 auto- antibodies. Pre-treatment may consist of purification steps for enriching the sample with anti-GluR3 antibodies or depletion steps, for example, for removing non-immunoglobulin materials.
  • the sample may be purified to remove any non-lgG materials.
  • the sample may be purified to remove any non-lgM materials.
  • the presence or the level of anti-GluR3 autoantibodies in a biological sample can be determined using standard methods, such as Western Blot, immunoprecipitation, surface plasmon resonance analysis (e.g. using BiaCore) or ELISA. Examples of specific methods using ELISA for detecting human anti-GluR3 autoantibodies in serum samples are described in the Examples.
  • the assay is an ELISA assay.
  • the ELISA assay uses a chaotropic buffer.
  • a peptide to which the antibodies bind may be used.
  • the peptide (or substrate) may be immobilised to the surface of a multi-well plate. Streptavidin coated plates combined with biotin tagged peptide may be used for this purpose. The serum sample may then be added to the multi-well plate, allowing autoantibodies to selectively bind to the peptide.
  • the peptides of SEQ ID NOs: 1-4, 6 and 7, are suitable peptides for such uses. In one embodiment, the peptide of SEQ ID NO: 6 is used in the assay.
  • the serum level of anti-GluR3 autoantibodies is considered abnormal when the amount of anti-GluR3 antibodies detected in a test sample from a subject is significantly higher than the amount (control value) detected in the control samples from a control population, for example, serum samples from healthy donors.
  • the serum level of anti-GluR3 autoantibodies is considered abnormal when the level of anti-GluR3 autoantibodies detected in the serum sample of a subject is at least equal to the corresponding mean level + 2 fold or greater (e.g. 3, 4, 5 fold or greater) the standard deviations measured in the control samples, for example, from serum samples of healthy donors or patients not suffering from Rasmussen's encephalitis or epilepsy or related disorders.
  • the serum level of anti-GluR3 autoantibodies is considered abnormal when the level of anti-GluR3 autoantibodies detected in the serum sample of a subject is 50% or more (i.e. 60, 70, 80, 90, 100, 200, 500% or more) than that of the average measured in control samples from healthy donors or subjects not suffering from Rasmussen's encephalitis or epilepsy or related disorders.
  • the level of anti-GluR3 antibodies is considered abnormal when the amount of anti-GluR3 antibodies is a detectable amount in the test sample whereas no significant amount of anti-GluR3 antibodies is detected in the control samples (e.g. from healthy donors or patients not suffering from Rasmussen's encephalitis or epilepsy or related disorders).
  • a subject with abnormal level of anti-GIuR3 autoantibodies is a subject suffering from Rasmussen's encephalitis and having a serum level of anti-GluR3 autoantibodies superior to ⁇ ⁇ g ⁇ m ⁇ , 10 ⁇ g/ml, 100 ⁇ g/ml or 500 ⁇ g/ml.
  • a subject with abnormal level of anti-GluR3 autoantibodies is a subject suffering from epilepsy and having a serum level of anti-GluR3 autoantibodies superior to ⁇ g/ml, 10 ⁇ g/ml, 100 ⁇ g/ml or 500 g/ml.
  • the presence or the level of anti-GluR3 autoantibodies with agonistic activity in a biological sample can be determined, for example, as described below.
  • a biological sample e.g. serum sample
  • One method for detecting anti-GluR3 autoantibodies with agonistic activity from serum sample of a subject is described in the Examples. Any other methods for detecting functional activity of GluR3 receptor induced in the presence of the test antibodies can be used.
  • GluR3 receptor refers to an ionotrophic glutamate receptor comprising at least one GluR3 subunit.
  • anti-GluR3 autoantibodies with agonistic activity from serum are first purified (due to their characteristic of being anti-GluR3 antibodies) and then tested in appropriate functional activity assays.
  • said activity is detected by elicited current evoked from GluR3-expressing oocytes in the presence of such autoantibodies.
  • the serum level of anti-GluR3 antibodies with agonistic activity is considered abnormal when the agonistic activity detected with purified anti-GluR3 antibodies from a test sample is significantly higher, for example, at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or at least 100% higher than the agonistic activity detected with antibodies from a control sample (e.g. serum samples from healthy donors or patients not suffering from Rasmussen's encephalitis or epilepsy).
  • a control sample e.g. serum samples from healthy donors or patients not suffering from Rasmussen's encephalitis or epilepsy.
  • the serum level of anti-GluR3 antibodies with agonistic activity is considered abnormal when any significant agonistic activity is detected with purified anti- GluR3 antibodies from a test sample whereas no significant agonistic activity is detected in control samples (e.g. serum samples from healthy donors or patients not suffering from Rasmussen's encephalitis or epilepsy).
  • Rasmussen's encephalitis Methods for diagnosing Rasmussen's encephalitis are known. Diagnosis of Rasmussen's encephalitis is based on age of onset and clinico-pathological findings. Rasmussen's encephalitis typically manifest in the age of 14 months to 14 years. Most patients with Rasmussen's encephalitis have seizures as initial symptoms and at a later stage also hemiparesis, cognitive impairment and dysphasia. Radiological/pathological findings are typically a progressive, usually unilateral, cerebral atrophy; and an encephalitis-like pathological picture.
  • epilepsy is a common chronic neurological disorder characterized by recurrent unprovoked seizures, methods for diagnosing this disorder are well-known. 3. Detection and characterization of anti-GluR3 autoantibodies in Rasmussen's encephalitis patients or Epilepsy patients
  • Enzyme Linked Immunosorbent Assay for detecting anti-GluR3 autoantibodies have been described in the art (see Cohen-Kashi Maline et al., Neurochem Res. 2006, 31 , 1181-1190 or Wiendl et al., Neurobiology 2001 , 57, 1511-1514).
  • Immulon 96-well plates (Dynatech, Germany) are coated passively overnight at 4°C with 50 ⁇ of 20 ⁇ g/mL of free peptide in phosphate buffered saline (PBS)+0.05%Tween 20. After blocking unreacted sites of the plates with PBS + 10% bovine serum albumin (BSA), serum (dilutions 1 :10 to 1 :10000) or cerebrospinal fluid (directly to 1 :100) is added (100 ⁇ -Jwell) and incubated for 2 hours at 37°C.
  • PBS phosphate buffered saline
  • GluR3 peptides can be used:
  • NNENPMVQQFIQRWVRLDER (SEQ ID NO:1 , GluR3A1 , aa 274-293),
  • FIQRWVRLDEREFPEAKNAP (SEQ ID NO:2, GluR3A1 , aa 283-302)
  • NEYERFVPFSDQQISNDSAS (SEQ ID NO:3, GluR3B1 , aa 400-419),
  • RFVPFSDQQISNDSASSENR SEQ ID NO:4, GluR3B2, aa 404-423
  • NEYERFVPFSDQQISND (SEQ ID NO:8, a variant of SEQ ID NO:3)
  • RKAGYWNEYERFVPFSDQQISNDSASSENR (SEQ ID NO: 11 ).
  • Class ll-associated invariant chain peptide SEQ ID NO:5, LPKPPKPVSKMRMATPLLMQALPM also called CLIP peptide, aa 97-120.
  • the cut-off for anti-GluR3 positivity in a patient suffering from Rasmussen's Encephalitis or epilepsy can be defined for example as mean OD ⁇ 3 SD of the controls (e.g. healthy donors).
  • Agonistic activity of anti-GluR3 autoantibodies can be measured by detecting whole cell current recorded from voltage-clamped GluR3 expressing oocytes as described in detail in Neurochem Res (2006) 31 :1 181-1190.
  • Oocytes are obtained from commercial suppliers or are surgically removed from adult female Xenopus laevis frogs and defollicuiated. Stage V-VI oocytes are selected and injected with about 25ng (in 50nl) of cRNA transcripts from cDNA of rat or human GIuR3. Electrophysiological studies are performed 3-7 days post-injection of the cRNA into the oocytes using a two-electrode voltage clamp system. The responses (currents) of GluR3 expressing oocytes with test purified anti-GluR3 antibodies can be compared with corresponding test concentrations of a known AMPA receptor agonist (as a positive control). As a negative control, similar concentrations of a purified IgG antibody can be used and anti-GluR3 antibodies can be tested on oocytes that do not express GluR3 to ensure the responses are mediated by the expressed GluR3.
  • anti-GluR3 autoantibodies from serum samples of patients can be performed as described in Neurochem Res (2006) 31 :1181-1190. Shortly, anti-GluR3 antibodies can be purified by affinity chromatography on an affinity column prepared using Affi-Gel 15 support (Bio-Red laboratories). GluR3B peptides are coupled to washed beads resuspended in a binding buffer. The gel is transferred to the column for use.
  • GluR3 activation may be accomplished by anti-GIuR3 autoantibodies with agonistic activity purified from patients, antagonism of said activation may be performed by adding a 1 H-quinazoline-2,4-dione of formula (I).
  • a patient population, with a normal control is dosed 1-3 times per day for a week or longer tested.
  • the test is designed to allow for improvement, i.e. that there is a measurable parameter increase of the impaired function.
  • Patients are tested at the beginning and at the end of the dosage period and the results are compared and analyzed.
  • Trial B Deficit population A patient population with a deficit associated with Rasmussen's encephalitis is dosed 1-3 times per day for a week or longer and tested. The test is designed to allow for improvement, i.e. that there is a measurable parameter increase of the impaired function. The patients are tested at the beginning and at the end of the dosage period and the results are compared and analyzed. Exemplary parameters to test could include fewer or absence of seizures, a reduction of cognitive impairment or a reduction of dysphasia. Also measurable could be visualization of the reversal of some of the neuronal structural defects (by imaging), such as a reduction of brain areas showing atrophy or a pathological picture suggesting encephalitis.
  • Conditions that artificially impair a function are one way to test enhancement of that function. Such conditions are, for example, sleep deprivation and pharmacological challenges.
  • a patient population with diagnosis of partial seizures with or without generalization according to the seizure classification of the International League against Epilepsy is dosed 1-3 times per day for a week or longer and tested.
  • the test is designed to allow improvements in seizure frequency or severity.
  • patients are required to have had at least 4 or more partial seizures per month in the 3 months preceding the clinical trial and for the period of the trial no changes in their existing antiepileptic drug dosing regimen are allowed.
  • the patient makes records of date and time of each seizure and description of the seizure type. Efficacy variables are the percent reduction in average weekly seizure rate, percent of seizure-free days and patient global impression of improvement.
  • the invention relates to the use of a 1 H-quinazoline-2,4-dione of formula (I) for the treatment, prevention or delay of progression of Rasmussen's encephalitis or epilepsy in a subject in need of such treatment, wherein said subject being selected among those having abnormal serum level of anti-GluR3 autoantibodies.
  • the invention relates to a 1H-quinazoline-2,4-dione of formula (I) for the treatment, prevention or delay of progression of Rasmussen's encephalitis or epilepsy in a subject in need of such treatment, wherein said subject being selected among those having abnormal serum level of anti-GluR3 autoantibodies.
  • the invention relates to a pharmaceutical composition
  • a pharmaceutical composition comprising a 1 H-quinazoline-2,4-dione of formula (I) for the treatment, prevention or delay of progression of Rasmussen's encephalitis or epilepsy in a subject in need of such treatment, wherein said subject being selected among those having abnormal serum level of anti-GluR3 autoantibodies.
  • the invention relates to the use of a 1 H-quinazoline-2,4-dione of formula (I) for the manufacture of a medicament for the treatment, prevention or delay of progression of Rasmussen's encephalitis or epilepsy in a subject in need of such treatment, wherein said subject being selected among those having abnormal serum level of anti- GluR3 autoantibodies.
  • the invention relates to a kit comprising a 1 H-quinazoline-2,4- dione of formula (I) and appropriate means for purifying and/or detecting anti-GluR3 autoantibodies from biological samples, for example, serum sample, and optionally, instructions for use in selecting patients with an abnormal serum level of anti-GluR3 autoantibodies, for the treatment of Rasmussen's encephalitis or epilepsy.
  • a kit comprising a 1 H-quinazoline-2,4- dione of formula (I) and appropriate means for purifying and/or detecting anti-GluR3 autoantibodies from biological samples, for example, serum sample, and optionally, instructions for use in selecting patients with an abnormal serum level of anti-GluR3 autoantibodies, for the treatment of Rasmussen's encephalitis or epilepsy.
  • the invention relates to the use of a 1 H-quinazoline-2,4-dione of formula (I) for the treatment, prevention or delay of progression of Rasmussen's encephalitis or epilepsy in a subject in need of such treatment, wherein said subject being selected among those having abnormal serum level of anti-GluR3 autoantibodies with agonistic activity.
  • the invention relates to a 1 H-quinazoline-2,4-dione of formula (I) for the treatment, prevention or delay of progression of Rasmussen's encephalitis or epilepsy in a subject in need of such treatment, wherein said subject being selected among those having abnormal serum level of anti-GluR3 autoantibodies with agonistic activity.
  • the invention relates to a pharmaceutical composition
  • a pharmaceutical composition comprising a 1 H-quinazoline-2,4-dione of formula (I) for the treatment, prevention or delay of progression of Rasmussen's encephalitis or epilepsy in a subject in need of such treatment, wherein said subject being selected among those having abnormal serum level of anti-GluR3 autoantibodies with agonistic activity.
  • the invention relates to the use of a 1 H-quinazoline-2,4-dione of formula (I) for the manufacture of a medicament for the treatment, prevention or delay of progression of Rasmussen's encephalitis or epilepsy in a subject in need of such treatment, wherein said subject being selected among those having abnormal serum level of anti- GluR3 autoantibodies with agonistic activity.
  • the invention relates to a kit comprising a 1 H-quinazoline-2,4- dione of formula (I) and appropriate means for purifying and/or detecting anti-GluR3 autoantibodies from biological samples, for example, serum sample, and optionally, instructions for use in selecting patients with an abnormal serum level of anti-GluR3 autoantibodies with agonistic activity.
  • 96-well flat-bottom streptavidin-coated plates (Nunc, Roskilde, DK) were washed three times with washing buffer before 100 ⁇ of biotinylated peptide was pipetted into each well. Control experiments were performed using each serum in wells containing no peptide (NSB). Samples were also incubated with 100 pg/ml of peptide to specifically inhibit the signal. After 1 h-incubation at room temperature with 200rpm-stirring, plates were washed.
  • 96-well flat-bottom plates (Nunc, Roskilde, Dk) were washed 5 times with 400 ⁇ / ⁇ TBST before 100 ⁇ of peptide at 2 ⁇ g/ml was pipetted into each well. Plates were then blocked with 5%BSA. Control experiments were performed using wells uncoated with peptide for all sera tested (to measure NSB). Samples were also incubated with 100 ⁇ g ml of peptide to inhibit specifically the signal. Human samples were diluted from 1/10 to 1/100 in assay buffer containing 1 % BSA and added to pre-determined wells at ⁇ ⁇ /well, in duplicate. Samples were left to incubate on the plate at RT for 1.5h under 200rpm-stirring.
  • the inhibition assay using peptide preincubated with the sample to abolish the signal obtained with the coated peptide may be used for final confirmation of the positivity of the human sample against the GluR3b peptide.
  • IgG autoantibody assay the following two biotin labeled peptides (No 1 and 2) were used to coat the streptavidin plate, and peptide No.5 (SEQ ID NO:6) was used as free peptide for the inhibition test.
  • peptide No.5 SEQ ID NO:6
  • No 5 the same peptide (No 5) was used as free peptide for the inhibition test as well.
  • IgG assay 21 healthy volunteer samples were screened to set the negative cut off value (NCO). 18 epilepsy patient samples were also screened. The positive controls of rabbit anti-GluR2 Ab spiked in serum and healthy sample H015 showed high binding signal. Both of these signals, along with the positive signal from P006, could be significantly blocked using excess amounts of free peptide.
  • the IgM assay 22 healthy volunteer samples were screened to set the negative cut off value (NCO). 22 epilepsy patient samples were also screened. The positive control of healthy sample H015 could only partially be blocked with free peptide. However, epilepsy sample P018 showed a positive binding signal that could be completely blocked with free peptide.
  • Oral bioavailability of the compounds of the invention may be demonstrated using any generally known test in which the compound is administered orally and a biological effect observed.
  • Oral bioavailability of the compounds of the invention in the treatment of epilepsy or Rasmussen's encephalitis, e.g. Rasmussen's encephalitis, may be further quantified by the Maximal Electroshock test, which demonstrates that the compounds are orally bioavailable, penetrate the blood brain barrier and bind to the target receptor.
  • the oral bioavailability was tested using the audiogenic mouse test (Audiogenic seizures, R.L. Collins; Chapter 14, pages: 347-372. In: Experimental Models of Epilepsy; By: Pupura, Penny, Tower, Woodbury, Walter, Raven Press, New York, 1972. Standard Book Number: 0-911216-26-X) and/or the MES test. Where the MES test was used (as described below), the result is given in Table 1.
  • a compound could give 0%, 20%, 40%, 60%, 80% or 100% protection.
  • Compounds of the invention were given at a dose of 50 mg/kg, p.o., 1 hour prior to induction of convulsions (i.e. "pre-treatment time -1 h").
  • ED50 values (ED: effective dose) were calculated using GraphPad Prism, v4.02.
  • mouse blood was collected for determination of compounds' blood exposure.

Landscapes

  • Health & Medical Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Public Health (AREA)
  • General Health & Medical Sciences (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Chemical & Material Sciences (AREA)
  • Veterinary Medicine (AREA)
  • Epidemiology (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Organic Chemistry (AREA)
  • Neurosurgery (AREA)
  • Engineering & Computer Science (AREA)
  • Pain & Pain Management (AREA)
  • Neurology (AREA)
  • Biomedical Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Chemical & Material Sciences (AREA)

Abstract

La présente invention concerne l'utilisation d'antagonistes des récepteurs AMPA compétitifs pour le traitement, la prévention ou le ralentissement de la progression de l'encéphalite de Rasmussen et/ou de certaines formes d'épilepsie.
EP10766293A 2009-10-20 2010-10-20 Utilisation de 1h-quinazoline-2,4-diones Withdrawn EP2490691A1 (fr)

Priority Applications (1)

Application Number Priority Date Filing Date Title
EP10766293A EP2490691A1 (fr) 2009-10-20 2010-10-20 Utilisation de 1h-quinazoline-2,4-diones

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US25333609P 2009-10-20 2009-10-20
EP10170544 2010-07-22
EP10766293A EP2490691A1 (fr) 2009-10-20 2010-10-20 Utilisation de 1h-quinazoline-2,4-diones
PCT/EP2010/065805 WO2011048150A1 (fr) 2009-10-20 2010-10-20 Utilisation de 1h-quinazoline-2,4-diones

Publications (1)

Publication Number Publication Date
EP2490691A1 true EP2490691A1 (fr) 2012-08-29

Family

ID=42829396

Family Applications (1)

Application Number Title Priority Date Filing Date
EP10766293A Withdrawn EP2490691A1 (fr) 2009-10-20 2010-10-20 Utilisation de 1h-quinazoline-2,4-diones

Country Status (2)

Country Link
EP (1) EP2490691A1 (fr)
WO (1) WO2011048150A1 (fr)

Family Cites Families (12)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5529898A (en) * 1993-08-19 1996-06-25 Duke University Methods of detecting disorders of the central nervous system by detecting autoantibodies which specifically bind ionotropic glutamate receptors
GB9400680D0 (en) * 1994-01-14 1994-03-09 Sandoz Ltd Improvements in or relating to organic compounds
US5731410A (en) * 1994-11-28 1998-03-24 University Of Utah Research Foundation Peptide for blocking autoantibody-evoked activation of glutamate receptor type 3 (GLUR3)
GB0128996D0 (en) 2001-12-04 2002-01-23 Novartis Ag Organic compounds
SE0201943D0 (sv) 2002-06-20 2002-06-20 Astrazeneca Ab New use
EP1677788A1 (fr) 2003-10-31 2006-07-12 AstraZeneca AB Alcynes iii
CA2549967A1 (fr) 2003-10-31 2005-05-19 Astrazeneca Ab Alkynes i
WO2005044267A1 (fr) 2003-10-31 2005-05-19 Astrazeneca Ab Alkynes ii
WO2005079802A1 (fr) 2004-02-12 2005-09-01 Merck & Co., Inc. Amides bipyridyles en tant que modulateurs du récepteur-5 métabotropique du glutamate
GB0507298D0 (en) 2005-04-11 2005-05-18 Novartis Ag Organic compounds
GB0508319D0 (en) 2005-04-25 2005-06-01 Novartis Ag Organic compounds
CA2627630A1 (fr) 2005-12-20 2007-06-28 Novartis Ag Derives d'acide nicotinique en tant que modulateurs des recepteurs metabotropiques du glutamate

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
See references of WO2011048150A1 *

Also Published As

Publication number Publication date
WO2011048150A1 (fr) 2011-04-28

Similar Documents

Publication Publication Date Title
JP6986180B2 (ja) 細胞内抗原に対して指向された単一ドメイン抗体
JP5666423B2 (ja) Sykチロシンキナーゼタンパク質が関与している代謝経路を阻害する分子および前記分子を同定するための方法
Ahuja et al. Anticonvulsant evaluation of clubbed indole-1, 2, 4-triazine derivatives: A synthetic approach
IL234326A (en) Sick imidazopyrazine inhibitors
US20160208011A1 (en) Ccr3 modulation in the treatment of aging-associated impairments, and compositions for practicing the same
US20190185862A9 (en) Ccr3 modulation in the treatment of aging-associated impairments, and compositions for practicing the same
KR20110011669A (ko) Rho 키나제를 억제하고 학습 및 기억력을 개선하기 위한 화합물
TW200524928A (en) Substituted naphthyridine derivatives as inhibitors of macrophage migration inhibitory factor and their use in the treatment of human diseases
KR20120102083A (ko) α7 양성 알로스테릭 조절제로서의 모르폴리노티아졸
AU2017235665B2 (en) Treatment of cognitive and mood symptoms in neurodegenerative and neuropsychiatric disorders with alpha5-containing GABAA receptor agonists
CN102083454A (zh) 诊断、预防和治疗骨量疾病的方法
UA124783C2 (uk) ФАРМАКОЛОГІЧНО АКТИВНІ АЛІЦИКЛІЧНО ЗАМІЩЕНІ ПОХІДНІ ПІРАЗОЛО[1,5-a]ПІРИМІДИНУ
US20140018376A1 (en) Use of 1H-Quinazoline-2,4-Diones
EP2490691A1 (fr) Utilisation de 1h-quinazoline-2,4-diones
EP3108883A1 (fr) Utilisations thérapeutiques d'inhibiteurs non peptidiques de la voie de signalisation de la calcineurine - nfat
WO2012063513A1 (fr) Procédé de traitement de troubles mentaux
JP2023534190A (ja) GABAAα5アゴニストの多形および認知障害の処置において使用する方法
WO2018212312A1 (fr) Procédé de criblage
JP7072260B2 (ja) マックル・ウェルズ症候群の治療用医薬組成物
AU2010274921B2 (en) 1H-quinazoline-2, 4 -diones for use in the treatment of neuronal ceroid lipofuscinosis
AU2011376333A1 (en) Use of 1H-quinazoline- 2, 4 -diones for use in the prevention or treatment photosensitive epilepsy
Kass Investigation of the roles of cyclic AMP dependent regulation of the hyperpolarization-activated cyclic nucleotide-gated type 4 channel in neuronal circuits
WO2020168068A1 (fr) Antagoniste des récepteurs du pacap de type petite molécule et ses utilisations
EP2585070A1 (fr) Emploi de 1h-quinazoline-2,4-diones
Numis et al. Article type: Full length original research paper

Legal Events

Date Code Title Description
PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

17P Request for examination filed

Effective date: 20120521

AK Designated contracting states

Kind code of ref document: A1

Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO RS SE SI SK SM TR

DAX Request for extension of the european patent (deleted)
17Q First examination report despatched

Effective date: 20150925

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN

18D Application deemed to be withdrawn

Effective date: 20160206