EP1848457A2 - Vaccins contre neisseria meningitidis - Google Patents

Vaccins contre neisseria meningitidis

Info

Publication number
EP1848457A2
EP1848457A2 EP05823115A EP05823115A EP1848457A2 EP 1848457 A2 EP1848457 A2 EP 1848457A2 EP 05823115 A EP05823115 A EP 05823115A EP 05823115 A EP05823115 A EP 05823115A EP 1848457 A2 EP1848457 A2 EP 1848457A2
Authority
EP
European Patent Office
Prior art keywords
protein
dna
polypeptide
sequence
nmb
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Withdrawn
Application number
EP05823115A
Other languages
German (de)
English (en)
Inventor
Christoph Marcel Tang
Yanwen Li
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Ip2ipo Innovations Ltd
Original Assignee
Imperial Innovations Ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from PCT/GB2004/005441 external-priority patent/WO2005060995A2/fr
Application filed by Imperial Innovations Ltd filed Critical Imperial Innovations Ltd
Publication of EP1848457A2 publication Critical patent/EP1848457A2/fr
Withdrawn legal-status Critical Current

Links

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/04—Peptides having up to 20 amino acids in a fully defined sequence; Derivatives thereof
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • C07K14/22—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Neisseriaceae (F)
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/30—Macromolecular organic or inorganic compounds, e.g. inorganic polyphosphates
    • A61K47/42—Proteins; Polypeptides; Degradation products thereof; Derivatives thereof, e.g. albumin, gelatin or zein
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/04—Antibacterial agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies

Definitions

  • the present invention relates to vaccines and their use, and in particular to vaccines for meningococcal disease.
  • Microbial infections remain a serious risk to human and animal health, particularly in light of the fact that many pathogenic microorganisms, particularly bacteria, are or may become resistant to anti-microbial agents such as antibiotics.
  • Vaccination provides an alternative approach to combating microbial infections, but it is often difficult to identify suitable imrnunogens for use in vaccines which are safe and which are effective against a range of different isolates of a pathogenic microorganism, particular a genetically diverse microorganism.
  • vaccines which use as the immunogen substantially intact microorganisms, such as live attenuated bacteria which typically contain one or mutations in a virulence-deterrnining gene, not all microorganisms are amenable to this approach, and it is not always desirable to adopt this approach for a particular microorganism where safety cannot always be guaranteed.
  • some microorganisms express molecules which mimic host proteins, and these are undesirable in a vaccine.
  • Neisseria meningitidis which causes meningococcal disease, a life threatening infection which in the Europe, North America, developing countries and elsewhere remains an important cause of childhood mortality despite the introduction of the conjugate serogroup C polysaccharide vaccine.
  • infections caused by serogroup B strains (NmB) which express an cc2-8 linked polysialic acid capsule, are still prevalent.
  • serogroup in relation to N. meningitidis refers to the polysaccharide capsule expressed on the bacterium.
  • the common serogroup in the UK causing disease is B, while in Africa it is A.
  • Meningococcal septicaemia continues to carry a high case fatality rate; and survivors are often left with major psychological and/or physical disability. After a non-specific prodromal illness, meningococcal septicaemia can present as a fulminant disease that is refractory to appropriate anti-microbial therapy and full supportive measures. Therefore, the best approach to combating the public health menace of meningococcal disease is through prophylactic vaccination.
  • meningitidis infections are based on the polysaccharide capsule located on the surface of bacterium (Anderson et al (1994) Safety and immunogenicity of meningococcal A and C polysaccharide conjugate vaccine in adults. Infect Immun.
  • the most validated immunologic correlate of protection against meningococcal disease is the serum bactericidal assay (SBA).
  • SBA serum bactericidal assay
  • the SBA evaluates the ability of antibodies (usually IgG2a subclass) in serum to mediate complement deposition on the bacterial cell surface, assembly of the membrane attack complex, and bacterial lysis.
  • a known number of bacteria are exposed serial dilutions of the sera with a defined complement source. The number of surviving bacteria is determined, and the SBA is defined as the reciprocal of the highest dilution of serum that mediates 50% killing.
  • the SBA is predictive of protection against serogroup C infections, and has been widely used as a surrogate for immunity against NmB infections.
  • the SBA is a ready marker of immunity for the pre-clinical assessment of vaccines, and provides a suitable endpoint in clinical trials.
  • the key to a successful vaccine is to define antigen(s) that elicit protection against a broad range of disease isolates irrespective of serogroup or clonal group.
  • a genetic screening method (which we have termed Genetic Screening for Immunogens or GSI) was used to isolate antigens that are conserved across the genetic diversity of microbial strains and this is exemplified in relation to meningococcal strains.
  • the GSI method relates to a method for identifying a polypeptide of a microorganism which polypeptide is associated with an immune response in an animal which has been subjected to the microorganism, the method comprising the steps of (1) providing a plurality of different mutants of the microorganism; (2) contacting the plurality of mutant microorganisms with antibodies from an animal which has raised an immune response to the microorganism or a part thereof, under conditions whereby if the antibodies bind to the mutant microorganism the mutant microorganism is killed; (3) selecting surviving mutant microorganisms from step (2); (4) identifying the gene containing the mutation in any surviving mutant microorganism; and (5) identifying the polypeptide encoded by the gene. It will be appreciated that by the way in which the polypeptides have been identified, they are highly relevant as antigenic polypeptides.
  • genes identified by the GSI method are the NBM0341 (TspA), NMB0338, NMB1345, NMB0738, NBM0792 (NadC family), NMB0279, NMB2050, NMB1335 (CreA), NMB2035, NMB1351 (Fmu and Fmv), NMB1574 (HvC), NMB1298 (rsuA), NMB1856 (LysR family), NMBOl 19, NMB1705 (rfak), NMB2065 (HemK), NMB0339, NMB0401 (putA), NMB 1467 (PPX), NMB2056, NMB0808, NMB0774 (upp), NMA0078, NMB0337 (branched-chain amino acid transferase), NMB0191 (ParA family), NMB1710 (glutamate dehydrogenase (gdhA), NMB0062 (rfbA-1), NMB1583 (MsB), NBM0341 (TspA),
  • these genes form part of the genome that has been sequenced, as far as the inventors are aware, they have not been isolated, the polypeptides they encode have not been produced (and have not been isolated), and there is no indication that the polypeptides they encode may be useful as a component of a vaccine.
  • the invention includes the isolated genes as above and in the Examples and variants and fragments and fusions of such variants and fragments, and includes the polypeptides that the genes encode as described above, along with variants and fragment thereof, and fusions of such fragments and variants. Variants, fragments and fusions are described hi more detail below.
  • the variants, fragments and fusions of the given genes above are ones which encode a polypeptide which gives rise to neutralizing antibodies against N. meningitidis.
  • the variants, fragments and fusions of the polypeptide whose sequence is given above are ones which gives rise to neutralizing antibodies against N. meningitidis.
  • the neutralising antibodies may be produced in any animal with an immune system, for example a rat, mouse or rabbit.
  • the invention also includes isolated polynucleotides encoding the polypeptides whose sequences are given in the Example (preferably the isolated coding region) or encoding the variants, fragments or fusions.
  • the invention also includes expression vectors comprising such polynucleotides and host cells comprising such polynucleotides and vectors (as is described in more detail below).
  • the polypeptides described in the Examples are antigens identified by the method of the invention.
  • Variants of the gene may be made, for example by identifying related genes in other microorganisms or in other strains of the microorganism, and cloning, isolating or synthesizing the gene.
  • variants of the gene are ones which have at least 70% sequence identity, more preferably at least 85% sequence identity, most preferably at least 95% sequence identity with the genes as given above.
  • replacements, deletions and insertions may be tolerated.
  • the degree of similarity between one nucleic acid sequence and another can be determined using the GAP program of the University of Wisconsin Computer Group.
  • Variants of the gene are also ones which hybridise under stringent conditions to the gene.
  • stringent we mean that the gene hybridises to the probe when the gene is immobilised on a membrane and the probe (which, in this case is >200 nucleotides in length) is in solution and the immobilised gene/hybridised probe is washed in 0.1 x SSC at 65°C for 10 min. SSC is 0.15 M NaCl/0.015 M Na citrate.
  • Fragments of the gene may be made which are, for example, 20% or 30% or 40% or 50% or 60% or 70% or 80% or 90% of the total of the gene.
  • Preferred fragments include all or part of the coding sequence.
  • the variant and fragments may be fused to other, unrelated, polynucleotides.
  • the polynucleotide encodes a polypeptide which is immunogenic and is reactive with the antibodies from an animal which has been subjected to the microorganism from which the gene was identified.
  • the antigen may be the polypeptide as encoded by the gene identified above, and the sequence of the polypeptide may readily be deduced from the gene sequence.
  • the antigen may be a fragment of the identified polypeptide or may be a variant of the identified polypeptide or may be a fusion of the polypeptide or fragment or variant.
  • a particular aspect of the invention provides a polypeptide comprising the amino acid sequence selected from any one of SEQ ID Nos 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68; or a fragment or variant thereof or a fusion of such a fragment or variant.
  • the invention provides the following isolated proteins, or fragments or variants thereof, or fusion of these: NMB0341, NMB 1583,
  • NMB1345 NMB0738, NMB0792, NMB0279, NMB2050, NMB1335,
  • Fragments of the identified polypeptide may be made which are, for example, 20% or 30% or 40 % or 50% or 60% or 70% or 80% or 90% of the total of the polypeptide. Typically, fragments are at least 10, 15, 20, 30, 40 , 50, 100 or more amino acids, but less than 500, 400, 300 or 200 amino acids.
  • Variants of the polypeptide may be made. By “variants” we include insertions, deletions and substitutions, either conservative or non-conservative, where such changes do not substantially alter the normal function of the protein. By “conservative substitutions” is intended combinations such as GIy, Ala; VaI, He, Leu; Asp, GIu; Asn, GIn; Ser, Thr; Lys, Arg; and Phe, Tyr. Such variants may be made using the well known methods of protein engineering and site-directed mutagenesis.
  • variants are those encoded by variant genes as discussed above, for example from related microorganisms or other strains of the microorganism.
  • variant polypeptides typically have at least 70% sequence identity, more preferably at least 85% sequence identity, most preferably at least 95% sequence identity with the polypeptide identified using the method of the invention.
  • the percent sequence identity between two polypeptides may be determined using suitable computer programs, for example the GAP program of the University of Wisconsin Genetic Computing Group and it will be appreciated that percent identity is calculated in relation to polypeptides whose sequence has been aligned optimally.
  • the alignment may alternatively be carried out using the Clustal W program (Thompson et al, (1994) Nucleic Acids Res 22, 4673-80). The parameters used may be as follows:
  • Fast pairwise alignment parameters K-tuple(word) size; 1, window size; 5, gap penalty; 3, number of top diagonals; 5. Scoring method: x percent.
  • the fusions may be fusions with any suitable polypeptide.
  • the polypeptide is one which is able to enhance the immune response to the polypeptide it is fused to.
  • the fusion partner may be a polypeptide that facilitates purification, for example by constituting a binding site for a moiety that can be immobilised in, for example, an affinity chromatography column.
  • the fusion partner may comprise oligo-histidine or other amino acids which bind to cobalt or nickel ions. It may also be an epitope for a monoclonal antibody such as a Myc epitope.
  • variant polypeptides or polypeptide fragments, or fusions of these are typically ones which give rise to neutralizing antibodies against N. meningitidis.
  • the invention also includes, therefore, a method of making an antigen as described above, and antigens obtainable or obtained by the method.
  • the polynucleotides of the invention may be cloned into vectors, such as expression vectors, as is well known on the art.
  • vectors may be present in host cells, such as bacterial, yeast, mammalian and insect host cells.
  • the antigens of the invention may readily be expressed from polynucleotides in a suitable host cell, and isolated therefrom for use in a vaccine.
  • Typical expression systems include the commercially available pET expression vector series and E. coli host cells such as BL21.
  • the polypeptides expressed may be purified by any method known in the art.
  • the antigen is fused to a fusion partner that binds to an affinity column as discussed above, and the fusion is purified using the affinity column (eg such as a nickel or cobalt affinity column).
  • the antigen or a polynucleotide encoding the antigen is particularly suited for use as in a vaccine.
  • the antigen is purified from the host cell it is produced in (or if produced by peptide synthesis purified from any contaminants of the synthesis).
  • the antigen contains less that 5% of contaminating material, preferably less than 2%, 1%, 0.5%, 0.1%, 0.01%, before it is formulated for use in a vaccine.
  • the antigen desirably is substantially pyrogen free.
  • the invention further includes a vaccine comprising the antigen, and method for making a vaccine comprising combining the antigen with a suitable carrier, such as phosphate buffered saline.
  • a suitable carrier such as phosphate buffered saline.
  • an antigen of the invention Whilst it is possible for an antigen of the invention to be administered alone, it is preferable to present it as a pharmaceutical formulation, together with one or more acceptable carriers.
  • the carrier(s) must be "acceptable” in the sense of being compatible with the antigen of the invention and not deleterious to the recipients thereof. Typically, the carriers will be water or saline which will be sterile and pyrogen free.
  • the vaccine may also conveniently include an adjuvant. Active immunisation of the patient is preferred.
  • one or more antigens are prepared in an immunogenic formulation containing suitable adjuvants and carriers and administered to the patient in known ways.
  • suitable adjuvants include Freund's complete or incomplete adjuvant, muramyl dipeptide, the "Iscoms" of EP 109 942, EP 180 564 and EP 231 039, aluminium hydroxide, saponin, DEAE-dextran, neutral oils (such as miglyol), vegetable oils (such as arachis oil), liposomes, Pluronic polyols or the Ribi adjuvant system (see, for example GB-A-2 189 141). "Pluronic" is a Registered Trade Mark.
  • the patient to be immunised is a patient requiring to be protected from infection with the microorganism.
  • the invention also includes a pharmaceutical composition comprising a polypeptide of the invention or variant or fragment thereof, or fusion of these, or a polynucleotide of the invention or a variant or fragment thereof or fusion of these, and a pharmaceutically acceptable carrier as discussed above.
  • the aforementioned antigens of the invention may be administered by any conventional method including oral and parenteral (eg subcutaneous or intramuscular) injection.
  • the treatment may consist of a single dose or a plurality of doses over a period of time.
  • the vaccine of the invention may be useful in the fields of human medicine and veterinary medicine.
  • the vaccines of the invention when containing an appropriate antigen or polynucleotide encoding an antigen, are useful in man but also in, for example, cows, sheep, pigs, horses, dogs and cats, and in poultry such as chickens, turkeys, ducks and geese.
  • the invention also includes a method of vaccinating an individual against a microorganism, the method comprising administering to the individual an antigen (or polynucleotide encoding an antigen) or vaccine as described above.
  • the invention also includes the use of the antigen (or polynucleotide encoding an antigen) as described above in the manufacture of a vaccine for vaccinating an individual.
  • the antigen of the invention may be used as the sole antigen in a vaccine or it may be used in combination with other antigens whether directed at the same or different disease microorganisms.
  • the antigen obtained which is reactive against NmB may be combined with components used in vaccines for the A and/or C serogroups. It may also conveniently be combined antigenic components which provide protection against Haemophilus and/or Streptococcus pneumoniae.
  • the additional antigenic components may be polypeptides or they may be other antigenic components such as a polysaccharide. Polysaccharides may also be used to enhance the immune response (see, for example, Makela et al (2002) Expert Rev. Vaccines 1, 399-410).
  • the antigen is the polypeptide encoded by any of the genes as described above (and in the Examples), or a variant or fragment or fusion as described above (or a polynucleotide encoding said antigen), and that the disease to be vaccinated against is Neisseria meningitidis infection (meningococcal disease).
  • GSI GSI is described in more detail in PCT/GB2005/005441 (published as WO 2005/060995 on " 7 July 2005).
  • TspA is a surface antigen which elicits strong CD4+ T cell responses and is recognized by sera from patients (Kizil et al (1999) Infect Immun. 67, 3533-41).
  • NMB0338 is a gene of previously unknown function which encodes a polypeptide that is predicted to contain two transmembrane domains, and is located at the cell surface.
  • the amino acid sequence encoded by NMB0338 is: MERNGVFGKIVGNRILRMSSEHAAASYPKPCKSFKLAQSWFRVRSCLGGVFIYGA NMKLIYTVIKIIILLLFLLLAVINTDAVTFSYLPGQKFDLPLIVYLFGAFWGII FGMFALFGRLLSLRGENGRLRAEVKKNARLTGKELTAPPAQNAPESTKQP
  • JVwB JVwB for GSI aside from the public health imperative: a) the bacterium is genetically tractable; b) killing of the bacterium by effector immune mechanism is straightforward to assay; c) the genome sequences are available for three isolates of different serogroups and clonal lineages (IV-A, ET-5, and ET-37 for serogroups A, B 5 and C, respectively); and d) well-characterised clinical resources are available for this work.
  • GSI has two potential limitations. First, targets of bactericidal antibodies may be essential. This is unlikely as all known targets of bactericidal antibodies in JVmB are non-essential, and no currently licensed bacterial vaccine targets an essential gene product. Second, sera will contain antibodies to multiple antigens, and, loss of a single antigen may not affect the survival of mutants. We have already shown that even during selection with sera raised against the homologus strain, relevant antigens were still identified using appropriate dilutions of sera.
  • GSI GSI will rapidly pinpoint the subset of surface proteins that elicit bactericidal activity, allowing more detailed analysis of a smaller number of candidates.
  • pre- and post-immunisation samples provided by the Meningococcal Reference Laboratory
  • OMVs outer membrane vesicle
  • Murine 1 Defined antigenic exposure.
  • GSI is a high-throughput analysis performed using simple, available techniques. Antigens which elicit bactericidal antibodies in humans and which mediate killing of multiple strains can be identified rapidly as GSI is flexible with respect to the bacterial strain and sera used. Mutants selected using human sera are analysed in the same way as those selected by murine sera.
  • Proteins which are targets of bactericidal antibodies that are recognised by sera from convalescent patients and vaccines are expressed in E. coli using commercially available vectors.
  • the corresponding open reading frames are amplified by PCR from MC58, and ligated into vectors such as pCR Topo CT or pBAD/His, to allow protein expression under the control of a T7 or arabinose- inducible promoter, respectively.
  • Purification of the recombinant proteins from total cellular protein is performed via the His Tag fused to the C terminus of the protein on a Nickel or Cobalt column.
  • SBAs will be performed against MC58 (the homologous strain), and the sequenced serogroup A and C strains with the rabbit immune serum.
  • the assay will be performed in triplicate on at least two occasions. SBAs of >8 will be considered significant. The results provide evidence of whether the protein candidates can elicit bactericidal antibodies as recombinant proteins.
  • mice are immunised on days 0 and 21, and on day 28 receive live bacterial challenge of 10 or 10 7 CFU of MC58 intraperitoneally in iron dextran (as the supplemental iron source).
  • the model is similar to that described for evaluation of the protective efficacy of immunisation with Tbps Danve et al (1993) Vaccine 11, 1214-1220.
  • Non-immunised animals develop bacteraemia within 4 hours of infection, and show signs of systemic illness by 24 hours.
  • PorA is an outer membrane protein that elicits bactericidal antibodies, but which is not a lead vaccine candidate because of extensive antigenic variation (Bart et al (1999) Infect Immun. 67, 3832- 3846.
  • mice Six week old, BALB/c mice (group size, 35 animals) receive 25 ⁇ g of recombinant protein with Freund's incomplete adjuvant subcutaneously on days day 0 and 21, then are challenged with 10 6 (15 animals) or 10 7 (15 animals) CFU of MC58 intraperitoneally on day 28. Two challenge doses are used to examine the vaccine efficacy at a high and low challenge dose; sera are obtained on day 28 from the remaining five animals in each group, and from five animals before the first immunisation and stored at -7O 0 C for further immunological assays. Animals in control groups receive either i) adjuvant alone, ii) recombinant refolded PorA, and iii) a live, attenuated Nm strain.
  • bacteraemia is maximal at this time. The results are analysed using a two-tailed Student-T test to determine if there is a significant reduction in bacteraemia in vaccinated animals.
  • mutants were constructed by in vitro mutagenesis. Genomic DNA from N. meningitidis was subjected to mutagenesis with a Tn5 derivative containing a marker encoding resistance to kanamycin, and an origin of replication which is functional in E. coli. These elements are bound by composite Tn5 ends. Transposition reactions were carried out with a hyperactive variant of Tn5 and the DNA repaired with T4 DNA polymerase and ligase in the presence of ATP and nucleotides. The repaired DNA was used to transform N. meningitidis to kaiiamycin resistance. Southern analysis confirmed that each mutant contained a single insertion of the transposon only.
  • SBAs Serum bactericidal assays
  • Bacteria were grown overnight on solid media (brain heart infusion media with Levanthals supplement) and then re-streaked to solid media for four hours on the morning of experiments. After this time, bacteria were harvested into phosphate buffered saline and enumerated. SBAs were performed in a 1 ml volume, containing a complement source (baby rabbit or human) and approximately 10 5 colony forming units. The bacteria were collected at the end of the incubation and plated to solid media to recover surviving bacteria.
  • Genomic DNA will be recovered from mutants of interest by standard methods and digested with PvuTL, EcoRV, and Dral for three hours, then purified by phenol extraction. The DNA will then be self-ligated in a 100 microlitre volume overnight at 16 0 C in the presence of T4 DNA ligase, precipitated, then used to transform E. coli to kanamycin resistance by electroporation.
  • GSI has been used to screen a library of approximately 40,000 insertional mutants of MC58.
  • the library was constructed by in vitro Tn5 mutagenesis, using a transposon harbouring the origin of replication from pACYC184.
  • MC58 was chosen as it is a sero group B isolate of JV. meningitidis, and the complete genome sequence of this strain is known.
  • the library is always screened in parallel with the wild-type strain as a control, and the number of colonies recovered from the library and the wild-type is shown. Selection with murine sera
  • the screen identified several mutants with enhanced resistance to serum killing: This was confirmed by isolating individual mutants, reconstructing the mutation in the original genetic background, and re-testing the individual mutants for their susceptibility to complement mediated lysis against the wild-tye.
  • the transposon insertions areinthefollowing gene:
  • polypeptide indicates that it is predicted to have two membrane spanning domains, from residues 54 to 70 and 88 to 107.
  • fragments from the regions 1 to 53, and 108 to the end (C-terminal) may be particularly useful as immunogens.
  • NMB2056 Protein sequence MNGKYYYGTGRRKSSVARVFLIKGTGQIIVNGRPVDEFFARETSRMWRQPLVLTENAES FDIKVNVVGGGETGQSGAIRHGITRALIDFDAALKPALSQAGFVTRDAR ⁇ VERKKPGLRK
  • NMB1710 Glutamate dehydrogenase(gdhA) DNA sequence ATGACTGACCTGAACACCCTGTTTGCCAACCTCAAACAACGCAATCCCAATCAGGAGCCG TTCCATCAGGCGGTTGAAGAAGTCTTCATGAGTCTCGATCCGTTTTTGGCA ⁇ AAAATCCG AAATACACCC ⁇ GCAAAGCCTGCTGGAACGCATCGTCGAACCCGAACGCGTCGTGATGTTC CGCGTAACCTGGCAGGACGATAAAGGGCAAGTCCAAGTCAACCGGGGCTACCGCGTGCAA ATGAGTTCCGCCATCGGTCCTTACAAAGGCGGCCTGCGCTTCCATCCGACCGTCGATTTG GGCGTATTG ⁇ A ⁇ TTCCTCGCTTTTG ⁇ ACAAGTGTTCA ⁇ AA ⁇ CGCCTTGACCACCCTGCCT ATGGGCGGCGGCAAAGGCGGTTCCGACTTCGACCCCAAAGGCAAATCCGATGCCGAAGTA ATGCGCTTCTGCCAAGCCTTTATGACCGAACTCTACCGCCACATCGGCGG
  • NMB1333 Amino acid sequence MRYKPLLLALMLVFSTPAVAAHDAAHNRSAEVKKQTKNKKEQPEAAEGKKEKGKNGAVKD KKTGGKEAAKEGKESKKTAKNRKEAEKEATSRQSARKGREGDKKSKAEHKKAHGKPVSGS KEKNAKTQPENKQGKKEAKGQGNPRKGGK ⁇ EKDTVSANKKVRSDKNGKAVKQDKKYREEK N ⁇ KTDSDELKAAVAAATNDVENKKALLKQSEGMLLHVSNSLKQLQEERIRQERIRQARGN LASVNRKQREAWDKFQKLNTELNRLKTEVAATKAQISRFVSGNYKNSQPNAVALFLKNAE PGQKNRFLRYTRYVNASNREWKDLEKQQKALAVQEQKINNELARLKKIQANVQSLLKKQ GVTDAAEQTESRRQNAKIAKDARKLLEQKGNEQQLNKLLSNLEKKKAEHR
  • NMB1036 Amino acid sequence MTAQTLYDKLWNSHWREEEDGTVLLYIDRHLVHEVTSPQAFEGLKMAGRKLWRIDSVVS TADHNTPTGDWDKGIQDPISKLQVDTLDKNIKEFGALAYFPFMDKGQGIVHVMGPEQGAT LPGMTWCGDSHTSTHGAFGALAHGIGTSEVEHTM ⁇ TQCIT ⁇ KKSKSMLISVDGKLKAGV TAKDVALYIIGQIGTAGGTGYAIEFGGEAIRSLSMESRMTLCNMAIEAGARSGMVAVDQT TIDYVKDKPFAPEGEAWDKAVEYWRTLVSDEGAVFDKEYRFNAEDIEPQVTWGTSPEMVL DISSKVPNPAEETDPVKRSGMERALEYMGLEAGTPLNEIPVDIVFIGSCTNSRIEDLREA AAIAKDRKKAANVQRVLIVPGSGLVKEQAEKEGLDKIFIEAGFEWREPGCSMCLAMNADR LTPGQRC
  • NMB1176 Nucleic acid sequence ATGAAAGACAAGCACGATTCTTCCGCCATGCGGCTGGACAAATGGCTTTGGGCGGCACGT TTTTTCA ⁇ GACCCGTTCCCTTGCGCAAAAGCACATCGAACTGGGTAGGGTTCAAGTAAAC GGCTCGAAGGTCAAAAACAGTAAAACCATAGACATCGGCGATATTATCGACCTGACGCTC AATTCCCTTCCCTATAAAATCAAGGTTA ⁇ AGGTTTGAACCACCAACGCCGCCCGGCATCC GAGGCGCGGCTTCTGTATGAAGAGGACGCGAAAACGGCAACATTGAGGGAAGAGCGCAAA CAGCTCGACCAATTCAGCCGCATCACTTCCGCCTATCCCGACGGCAGACCGACCAAGCGC GACCGCCGCCAACTGGACAGGCTGAAAAAAAAGGAGACTGGTAA
  • CAGGCTTTATCCGAAGCAGAAAAAGCGCAAGGCAAGATTTTGATGTGCTGCACCACTGCG CAA ⁇ GCG ⁇ TATCAACATCAACATCCCCGGCTACAAAGCCGATGCCCTACCCGTCCGCACC CTGCCCGCACGCATCGAAAGTATTATTTTCAA ⁇ C ⁇ CGATGTCGCCCTCCTGAA ⁇ CTTGCC CTGCCCAAAGCCCCGCCGTTTGCCTTCTACGCCGGGCAATACATTGATTTACTGCTGCCG GGCA ⁇ CGTCAGCCGCAGCTACTCCATCGCCAATTTACCCGACCAAGAAGGCATTTTGGAA CTGCACATCCGCAGGCACGAAAACGGTGTCTGCTCGGAAATGATTTTCGGCAGCGAACCC

Abstract

L'invention porte sur divers polypeptides ou un variant ou un fragment de ceux-ci ou sur la fusion du variant ou du fragment, ces polypeptides étant utiles dans un vaccin. Le polypeptide peut-être un polypeptide comprenant la séquence d'acides aminés sélectionnés parmi une quelconque de ces séquences: SEQ ID Nos (2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 54, 56, 58, 60, 62, 64, 66, 68). L'invention porte également sur un fragment ou un variant de ces polypeptides ou sur une fusion de ce fragment ou de ce variant qui est utile dans un vaccin pour lutter contre Neisseira meningitidis.
EP05823115A 2004-12-23 2005-12-23 Vaccins contre neisseria meningitidis Withdrawn EP1848457A2 (fr)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
PCT/GB2004/005441 WO2005060995A2 (fr) 2003-12-23 2004-12-23 Vaccins
PCT/GB2005/005113 WO2006067518A2 (fr) 2004-12-23 2005-12-23 Vaccins et leur utilisation

Publications (1)

Publication Number Publication Date
EP1848457A2 true EP1848457A2 (fr) 2007-10-31

Family

ID=36282716

Family Applications (1)

Application Number Title Priority Date Filing Date
EP05823115A Withdrawn EP1848457A2 (fr) 2004-12-23 2005-12-23 Vaccins contre neisseria meningitidis

Country Status (10)

Country Link
EP (1) EP1848457A2 (fr)
JP (1) JP2008525008A (fr)
KR (1) KR20070094762A (fr)
CN (2) CN101115502A (fr)
AU (1) AU2005317835A1 (fr)
CA (1) CA2592156A1 (fr)
MX (1) MX2007007886A (fr)
NO (1) NO20073256L (fr)
RU (1) RU2007127921A (fr)
WO (1) WO2006067518A2 (fr)

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AU2006328153A1 (en) * 2005-12-23 2007-06-28 Imperial Innovations Limited Neisseria meningitidis vaccines and their use

Family Cites Families (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB9814902D0 (en) * 1998-07-10 1998-09-09 Univ Nottingham Screening of neisserial vaccine candidates against pathogenic neisseria

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
See references of WO2006067518A2 *

Also Published As

Publication number Publication date
MX2007007886A (es) 2008-01-16
CN101370514A (zh) 2009-02-18
KR20070094762A (ko) 2007-09-21
WO2006067518A2 (fr) 2006-06-29
WO2006067518A3 (fr) 2006-11-23
JP2008525008A (ja) 2008-07-17
NO20073256L (no) 2007-09-17
CA2592156A1 (fr) 2006-06-29
CN101115502A (zh) 2008-01-30
AU2005317835A1 (en) 2006-06-29
RU2007127921A (ru) 2009-01-27

Similar Documents

Publication Publication Date Title
AU2009329782B2 (en) Modified Streptococcus pneumonia pneumolysin (PLY) polypeptides
JPH10513349A (ja) 微生物蛋白質と、この蛋白質を産生する微生物と、該蛋白質のワクチンおよび結核検出での利用
PL197449B1 (pl) Wyizolowane polipeptydy, immunogenne fragmenty tych polipeptydów, wyizolowane polinukleotydy, wektor ekspresyjny, komórka gospodarza zawierająca taki wektor, sposób wytwarzania polipeptydu, sposób ekspresji polinukleotydu, kompozycja szczepionki, przeciwciało immunospecyficzne w stosunku do polipeptydu lub jego immunogennego fragmentu, sposób diagnozowania zakażenia Neisseria meningitidis, zastosowania kompozycji zawierającej polipeptyd lub jego immunogenny fragment, lub polinukleotyd i kompozycja terapeutyczna do leczenia choroby wywołanej przez Neisseria meningitidis
NZ532297A (en) Virulence genes, proteins, and their use in treating conditions associated with infection by Neisseria or gram-negative bacteria
CN107349423B (zh) 一种脑膜炎球菌抗原组合及其应用
US6835384B1 (en) Nucleic acids and polypeptides specific of the neisseria genus pathogenic strains
WO2006067518A2 (fr) Vaccins et leur utilisation
US20080138357A1 (en) Vaccines Against Neisseria Meningitidis
US20090226479A1 (en) Vaccines and their use
US20070275017A1 (en) Identification of Antigenically Important Neisseria Antigens by Screening Insertional Mutant Libraries with Antiserum
WO2009094006A2 (fr) Antigènes de protéine de membrane externe de bordetella et leurs procédés de fabrication et d'utilisation
US20030049265A1 (en) Heliobacter pylori antigen
JP2004534524A (ja) 病原性および共生ワクチン抗原
CA2547537A1 (fr) Proteine nmb0928 et utilisation dans des formulations pharmaceutiques
US20090208521A1 (en) Pharmaceutical compositions containing protein nma0939
RU2336900C2 (ru) Белок nmb1125 и его применение в фармацевтических композициях
CA2647465A1 (fr) Composition pharmaceutique comprenant la proteine nmb0606
EP1980266A1 (fr) Nouveaux facteurs de virulence de la pneumonie à streptocoques
CA2241023A1 (fr) Nouveaux polynucleotides et polypeptides dans des mycobacteries pathogenes et leur utilisation dans des diagnostics, des vaccins et des cibles de chimiotherapie
NZ502423A (en) Polynucleotide sequences, designated GS, in pathogenic mycobacteria and their use in vaccines

Legal Events

Date Code Title Description
PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

AK Designated contracting states

Kind code of ref document: A2

Designated state(s): AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IS IT LI LT LU LV MC NL PL PT RO SE SI SK TR

17P Request for examination filed

Effective date: 20070719

REG Reference to a national code

Ref country code: HK

Ref legal event code: DE

Ref document number: 1106707

Country of ref document: HK

DAX Request for extension of the european patent (deleted)
STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE APPLICATION HAS BEEN WITHDRAWN

18W Application withdrawn

Effective date: 20080126

REG Reference to a national code

Ref country code: HK

Ref legal event code: WD

Ref document number: 1106707

Country of ref document: HK