EP1819722A1 - Modulation of ovulation - Google Patents
Modulation of ovulationInfo
- Publication number
- EP1819722A1 EP1819722A1 EP05823157A EP05823157A EP1819722A1 EP 1819722 A1 EP1819722 A1 EP 1819722A1 EP 05823157 A EP05823157 A EP 05823157A EP 05823157 A EP05823157 A EP 05823157A EP 1819722 A1 EP1819722 A1 EP 1819722A1
- Authority
- EP
- European Patent Office
- Prior art keywords
- seq
- gdf
- isolated peptide
- ovulation
- homolog
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
- C07K7/04—Linear peptides containing only normal peptide links
- C07K7/08—Linear peptides containing only normal peptide links having 12 to 20 amino acids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0006—Contraceptive vaccins; Vaccines against sex hormones
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P15/00—Drugs for genital or sexual disorders; Contraceptives
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P15/00—Drugs for genital or sexual disorders; Contraceptives
- A61P15/08—Drugs for genital or sexual disorders; Contraceptives for gonadal disorders or for enhancing fertility, e.g. inducers of ovulation or of spermatogenesis
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/475—Growth factors; Growth regulators
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/22—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against growth factors ; against growth regulators
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
- C07K7/04—Linear peptides containing only normal peptide links
- C07K7/06—Linear peptides containing only normal peptide links having 5 to 11 amino acids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
Definitions
- the present invention relates the identification of a novel domain of functional significance on GDF-9 and GDF-9B molecules and to agonists and antagonists which interact therewith to modulate the biological activity of these molecules to alter mammalian ovarian function and ovulation rate.
- GDF-9 and GDF-9B are expressed in the oocyte of the developing follicle and play a role in mammalian fertility (Fitzpatrick et al, 1998).
- GDF9 is a member of the transforming growth factor beta (TGF ⁇ ) superfamily (McPherron and Lee, 1993) which is expressed in oocytes from the primary stage of follicular development until ovulation (McGrath et al, 1995; Laitinen et al, 1998).
- TGF ⁇ transforming growth factor beta
- GDF9B is closely related to GDF9 (Dube et al, 1998; Laitinen et al, 1998) and is expressed in mouse oocytes at the same time as GDF9, but in human primary follicles slightly later than GDF9.
- GDF9 and GDF9B have now been shown to be expressed in the developing oocyte in humans (Aaltonen et al, 1999), rodents (Laitinen et al, 1998; Dube et al, 1998; Jaatinen et al, 1999), ruminants (Bodensteiner et al, 1999; Bodensteiner et al, 2000; Galloway et al, 2000) and marsupials (Eckery et al, 2002).
- sheep expression of GDF9 can be seen in primordial follicles whereas GDF9B is expressed in primary follicles (Bodensteiner et al, 1999; Galloway et al, 2000).
- GDF9 and GDF9B are coded as prepropeptides containing a signal peptide, a proregion and a C-terminal mature region which is the biologically active peptide. Cleavage of the mature region from the proregion is carried out by an intracellular furin-like protease, and occurs at a conserved furin protease cleavage site.
- GDF9 and GDF9B are biologically active as dimers, and although GDF9 and GDF9B do not contain the cysteine molecule responsible for covalent interchain disulphide bonding seen in nearly all members of the family, these molecules are thought to be biologically active as dimers (Galloway et al, 2000; Yan et al, 2001). However it is unclear whether the physiologically active dimers are homodimers (GDF9-GDF9 and i GDF9B-GDF9B), or heterodimers (GDF9-GDF9B) or whether all three dimer forms play a role.
- GDF9 homodimers play a more important role in the mouse but in sheep the GDF9B homodimers are the most bioactive (Yan et ah, 2001). It is unclear whether any such difference is related to the fact that sheep are mono-ovulatory animals (maturing usually only one egg per cycle) whereas mice are poly- ovulatory.
- GDF9 and GDF9B play crucial roles in controlling and maintaining fertility in mammals, and understanding the nature of their actions is essential for the development of therapies.
- the present invention is based on the identification of a novel domain of functional significance on the GDF-9 and GDF-9B molecules and to agonists and antagonists that interact therewith. More specifically, the present invention is based on the identification and characterisation of a domain of functional significance around the N-terminal end of the mature GDF-9 and GDF- 9B molecules, wherein the N-terminal domain of GDF-9 comprises the amino acid sequence: DQESASSELKKPLVPASVNLSEYFKQFLFPQNEC (SEQ ID NO: 1); and the N-terminal domain of GDF-9B comprises the amino acid sequence: QAGSIASEVPGPSREHDGPESNQC (SEQ ID NO: 2).
- the present invention is thus directed to an isolated fragment of the GDF-9 N-terminal domain, having the ability to modulate ovulation in a female mammal, wherein said GDF-9 N-terminal domain consists of the amino acid sequence DQESASSELKKPLVPASVNLSEYFKQFLFPQNEC (SEQ ID NO: 1), or a functional derivative, homolog, analog or mimetic thereof.
- the peptide fragment comprises at least one amino acid from positions 1-9 or 25- 34 of SEQ ID NO: 1.
- the present invention is also directed to an isolated peptide fragment of the GDF-9B N- terminal domain, having the ability to modulate ovulation in a female mammal, wherein said GDF-9B N-terminal domain consists of the amino acid sequence QAGSIASEVPGPSREHDGPESNQC (SEQ ID NO: 2), or a functional derivative, homolog, analog or mimetic thereof.
- the peptide fragment comprises at least one amino acid from positions 1-5 or 21-23 of SEQ ID NO: 2.
- amino acid symbols correspond to the one letter code as set out in Table 1, below.
- the isolated peptide fragments of the invention preferably comprise at least 5 contiguous amino acids of SEQ ID NO: 1 or SEQ ID NO: 2, or a functional derivative, homolog, analog or mimetic thereof. More preferably, the peptide fragments comprise at least 8, at least 10, at least 12, at least 14, at least 16, at least 18 or at least 20 contiguous amino acids of SEQ ID NO: 1 or SEQ ID NO: 2, or a functional derivative, homolog, analog or mimetic thereof.
- peptide fragments of the invention are selected from the group comprising: DQESASSELKKPLV(C) (SEQ IDNO: 3); SEYFKQFLFPQNEC (SEQ ID NO: 4);
- QAGSIASEVPGPSR(C) (SEQ ID NO: 5); and SREHDGPESNQC (SEQ ID NO: 6); or a functional derivative, homolog, analog or mimetic thereof.
- Amino acids in parentheses refer to amino acids which are optionally added for conjugation purposes.
- the present invention is also directed to an antibody or antibody fragment that binds to one or more of the peptide fragments of the invention.
- the present invention provides a method of modulating the ovulation rate of a female mammal, said method comprising the step of administering to said mammal an effective amount of one or more isolated peptide fragments and/or antibodies or antibody fragments of the invention that are capable of interacting with the N-terminal domain of GDF -9 and/or GDF-9B as defined above, and altering the biological activity thereof.
- the invention provides a method of modulating the ovulation rate of a female mammal, comprising administering to said mammal an effective amount of one or more peptides selected from SEQ ID NOs 3-6, or a functional variant thereof, and/or an antibody or antibody fragment that binds thereto.
- the present invention provides a use of one or more isolated peptide fragments of the invention and/or an antibody or antibody fragment that binds thereto, in the manufacture of a medicament for modulating the ovulation rate of a female mammal.
- the invention provides a use of one or more peptides selected from the group comprising SEQ ID NOs 3-6 or a functional variant thereof, and/or an antibody or antibody fragment that binds thereto, in the manufacture of a medicament of modulating the ovulation rate of a female mammal.
- the present invention provides a pharmaceutical composition
- a pharmaceutical composition comprising one or more isolated peptide fragments of the invention that are capable of interacting with the N-terminal domain of GDF-9 and/or GDF-9B defined above, together with a pharmaceutically acceptable carrier or excipient.
- the composition comprises one or more peptides selected from the group comprising SEQ ID NOs 3-6 or a functional variant thereof, together with a pharmaceutically acceptable carrier or excipient.
- the composition may additionally or alternatively comprise an antibody or antibody fragment that binds to one or more of said peptides, together with a pharmaceutically acceptable carrier or excipient.
- Figure 1 shows the position of peptides of SEQ ID NOs 3 and 4 on GDF-9
- Figure 2 shows the position of peptides of SEQ ID NOs 5 and 6 on GDF-9B;
- Figures 3a and 3b show the sequence homology of GDF9 and GDF-9B from a number of different species and the N-terminal domain consensus sequences;
- Figure 4 shows the effect of treatment with GDF-9 and GDF-9B peptides on antral follicle development in bovine.
- A control, keyhole limpet haemocyanin (KXH) alone;
- B KLH- GDF-9 (SEQ ID NO: 7);
- C KLH-GDF-9B (SEQ ID NO: 5);
- D KLH-GDF-9 and KLH-GDF- 9B (SEQ ID NOS: 5 and 7);
- Figure 5 shows the effect of a polyclonal antibody from sheep immunized against ovine GDF-9 peptide SEQ ID NO 3 or SEQ ID NO 4, or GDF-9B peptide SEQ ID NO 5 on ovine (o) GDF-9 and oGDF-9B stimulated 3 H-thymidine incorporation of rat granulosa cells when added directly to the bioassay.
- the horizontal line indicates the level of response of the granulosa cells treated with control media (i.e. media without oGDF-9 or oGDF-9B).
- Data presented are the mean and standard error of the mean of 4 replicate experiments.
- Figure 7 shows the effect of differing doses of a polyclonal antibody from sheep immunized against ovine GDF-9 peptide SEQ ID NO 4 on ovine (o) GDF-9 and oGDF-9B stimulated 3 H- thymidine incorporation of rat granulosa cells when added directly to the bioassay.
- Data presented are the mean and standard error of the mean of 4 replicate wells from one pool of granulosa cells; and
- Figure 8 shows the effect of differing doses of a polyclonal antibody from sheep immunized against ovine GDF-9B peptide SEQ ID NO 5 on ovine (o) GDF-9 and oGDF-9B stimulated 3 H- thymidine incorporation of rat granulosa cells when added directly to the bioassay. Data presented are the mean and standard error of the mean of 4 replicate wells from one pool of granulosa cells.
- the present invention provides a novel domain of functional significance at the N-terminal end of GDF-9 and GDF-9B. It is postulated that stimulation or inhibition of this domain by agonists or antagonists that interact therewith will be effective in modulating the ovulation rate of a female mammal.
- sequences of the N-terminal domains were compared with the corresponding sequences of the GDF-9 and GDF-9B proteins in a number of different species and a consensus sequence determined as shown in Figures 3a and 3b for GDF-9 and GDF-9B respectively.
- peptides were then synthesised which corresponded with sequences within the N- terminal domains and which were anticipated to have an agonistic or antagonistic effect on the biological activity of GDF-9 and/or GDF-9B when administered in vivo.
- peptides were designed to be on the outside of the molecule according to its three dimensional structure; in a flexible region of the molecule; at least nine amino acids in length; non homologous with other TGF beta family members; non convergent with other known proteins; in areas that did not contain a glycosylation site; and so that they could be coupled to a carrier protein. It was considered that the combination of these factors would result in peptides that would be highly specific across species and would not have cross-reactivity problems.
- the present invention is directed to an isolated fragment of the GDF-9 N-terminal domain, having the ability to modulate ovulation in a female mammal, wherein said GDF-9 N-terminal domain consists of the amino acid sequence DQESASSELKKPLVPASVNLSEYFKQFLFPQNEC (SEQ ID NO: 1).
- the amino acid symbols correspond to the one letter code as set out in Table 1 , below.
- the isolated peptide fragment comprises at least one amino acid for positions 1 to 9 or 25 to 34 of SEQ ID NOr I.
- the peptide comprises at least 5 contiguous amino acids of SEQ ID NO: 1, or a functional derivative, homolog, analog or mimetic thereof. More preferably, the peptide comprises at least 8, at least 10, at least 12, at least 14, at least 16, at least 18 or at least 20 contiguous amino acids of SEQ ID NO: 1, or a functional derivative, homolog, analog or mimetic thereof.
- peptides is selected from the group comprising:
- DQESASSELKKPLV(C) (SEQ ID NO: 3); and SEYFKQFLFPQNEC (SEQ ID NO: 4); or a functional derivative, homolog, analog or mimetic thereof.
- Amino acids in parentheses refer to amino acids optionally added for conjugation purposes.
- the invention is also directed to an antibody or antibody fragment that binds to one or more GDF-9 peptides of the invention.
- the present invention is directed to an isolated peptide fragment of the GDF-9B N-terminal domain, having the ability to modulate ovulation in a female mammal, wherein said GDF-9B N-terminal domain consists of the amino acid sequence: QAGSIASEVPGPSREHDGPESNQC (SEQ ID NO: 2), or a functional derivative, homolog, analog or mimetic thereof.
- the amino acid symbols correspond to the one letter code as set out in Table 1 below.
- the isolated peptide fragment comprises at least one amino acid from positions 1 to 5 or 21 to 23 of SEQ ID NO: 2.
- the peptide comprises at least 5 contiguous amino acids of SEQ ID NO: 2 or a functional derivative, analog, homolog or mimetic thereof. More preferably, the peptide comprises at least 8, at least 10, at least 12, at least 14, at least 16, at least 18 or at least 20 contiguous amino acids of SEQ ID NO: 2, or a functional derivative, homolog, analog or mimetic thereof.
- the peptide is selected from the group comprising: QAGSIASEVPGPSR(C) (SEQ ID NO: 5); and
- SREHDGPESNQC (SEQ ID NO: 6); or a functional derivative, homolog, analog or mimetic thereof.
- the invention is also directed to an antibody or antibody fragment that binds to one or more GDF-9B peptides of the invention.
- Amino acids in parentheses refer to amino acids optionally added for conjugation purposes.
- the peptides of the present invention may be synthesised using known technology.
- Analogs, derivatives or variants of the peptides of the invention may include sequence modifications or non-sequence modifications.
- Non-sequence modifications can include acetylation, methylation, phosphomethylation, carboxilation or glycosylation.
- N-terminal peptides exemplified in the present invention are shown in relation to their position on the N-terminal portion of GDF-9 and GDF-9B in figures 1 and 2, respectively.
- Preferred analogs include peptides who's sequence differs from those of the invention by one or more conservative amino acid substitutions, deletions or insertions which do not affect the biological activity of the peptide.
- Conservative substitutions typically include the substitution of one amino acid for another with similar characteristics, e.g., substitutions within the following groups: valine, glycine; glycine, alanine; valine, isoleucine, leucine; aspartic acid, glutamic acid; asparagine, glutamine; serine, threonine; lysine, arginine; and phenylalanine, tyrosine.
- Glutamine Q D-GIn, Asn, D-Asn, GIu, D-GIu, Asp, D-Asp
- Glutamic Acid E D-GIu, D-Asp, Asp, Asn, D-Asn, GIn, D-GIn
- Lysine K D-Lys, Arg, D-Arg, homo-Arg, D-homo-Arg,
- Phenylalanine F D-Phe, Tyr, D-Thr, L-Dopa, His, D-His, Trp,
- Tyrosine Y D-Tyr Phe, D-Phe, L-Dopa, His, D-His
- analogs include peptides with modifications which influence peptide stability. Such analogs may contain, for example, one or more non-peptide bonds (which replace the peptide bonds) in the peptide sequence. Also included are analogs that include residues other than naturally occurring L-amino acids, e.g. D-amino acids or non-naturally occurring synthetic amino acids, e.g. beta or gamma amino acids and cyclic analogs.
- the invention provides a use of the agonists and antagonists of the invention, in a method of modulating the ovulation rate of a female mammal, including human and non- human mammals.
- non-human mammals include sheep, cattle, goats, deer, pigs, horses, camelids, possums, non-human primates such as marmosets, cats, dogs and other commercially important species.
- the method may comprise administering to said mammal an effective amount of one or more of said agonists or antagonists or a functional variant thereof, or an antibody or antibody fragment that binds thereto.
- N-terminal domain peptides of GDF-9 and GDF-9B of a particular mammal to be treated will be used in the methods of the present invention.
- Examples of GDF-9 and GDF-9B peptides from different species, and which correspond to the specific N- terminal peptides of SEQ ID NOs 3-6, are as shown in Table Ia, below.
- QAGSIASEVPGPSR(C) SREHDGPESNQC cow QAGSIASEVPGPSR SREHDGPESNLC deer QAGSIASEVPGPSR SREHDGPESNQC dog QAGSITSGVPSSSR SRDHDGPKSNQC cat QTDSITSGVPGPFR FREHDGLKSNQC possum QVGPVRSEAPGQS S LEQTQC chimpanzee QADGISAEVTASSS SSKHSGPENNQC human QADGISAEVTASSS SSKHSGPENNQC mouse QACSIESDASCPSQ SQEHDGSVNNQC rat QTCSIASDVPCPSQ SQEQDRSVNNQC rabbit QAGSIASEVPGSSR SRVHDGTENNQC pig QAGSIASEVLGPSR SREHDGPESNQC goat QAGSIASEVPGPSR SREHDGPESNQC sheep QAGSIASEVPGPSR SREHDGPESNQC
- DQESASSELKKPIiV(C) SEYFKQFLFPQNEC cow DQESVSSELKKPLV SEYFKQFLFPQNEC dog GQDTVSLELHKPLA SEYLKHFLFPQHEC chimpanzee GQETVSSELKKPLG SEYFKQFLLPQNEC cat GQETIGLEPQKPLV SEYFKQFLFPQNEC goat DQESVSSELKKPLV SEYFKQFLFPQNEC human GQETVSSELKKPLG SEYFRQFLLPQNEC mouse GQKAIRSEAKGPLL SEYFKQFLFPQNEC sheep DQESASSELKKPLV SEYFKQFLFPQNEC pig AQDTVSSELKKPLV SEYFKQFLFPQNEC possum DERTGDPKAKSPKM SEYFKQFLFPENEC rabbit GQDAVGSQLKQPLV SEYFKQFVFPQDEC rat GQKTLSSETKKPLT SEYFRQ
- FIGS. 3a and 3b The amino acid alignment of mature GDF-9 and GDF-9B of a number of species is shown in figures 3a and 3b. These alignment sequences were generated with the multiple alignment programme of Vector NTI. This programme uses the Clustal W algorithm (Thompson et al., 1994). The region encoding the mature region of the protein was identified and the nucleotide sequence was used to generate the predicted protein sequence. The sequences (GenBank accession number) used for alignment were as follows.
- GDF-9 cow (NM_174681), goat (AH014112), sheep (AP078545), pig (NMJ)01001909), dog (XM_538624), cat (in house data base), possum (AY033826), rabbit (in house data base), mouse (NM_008110), rat (NM_021672), chimpanzee (XMJ27008) and human (NM_005260).
- GDF-9B cow (AY572412), deer (in house data base), dog (XM_549005), cat (in house data base), possum (AH012378), chimpanzee (XM_529247), human (AF082350), mouse (NM_021670), rabbit (in house data base), pig (AF458070), goat (in house data base) and sheep (AF236079).
- the modulation of the ovulation rate may comprise an increase or decrease in the ovulation rate of the female mammal by the administration of an agonist or antagonist of the invention to said animal resulting in antibodies being raised in vivo to said agonist or antagonist which in turn bind to the N-terminal domain of GDF-9 and/nr GDF-9B to affect the biological activity thereof.
- binding of the N-terminal domain of GDF-9 and/or GDF-9B by an agonist/antagonist, and in particular by one or more antibodies raised against one or more peptides selected from the group comprising SEQ ID NOs: 3-6 results in altered circulating concentration of biologically active GDF-9 and/or GDF-9B.
- an agonist or antagonist of the invention that results in a decrease of approximately 50% in the circulating levels of active GDF-9 and/or GDF-9B will result in an increase in ovulation rate, whilst an agonist or antagonist that results in a reduction in the circulation concentration of active GDF-9 and/or GDF-9B to approximately zero, will result in a decrease in ovulation and sterilisation in a female mammal.
- the agonist or antagonist of the invention is an antibody which binds to the consensus N-terminal domains of GDF-9 and/or GDF-9B of SEQ ID NOs: 1 and 2.
- antibody encompasses fragments or analogues of antibodies which retain the ability to bind to a consensus binding domain defined herein, including but not limited to Fv, Fc, F(ab) 2 fragments, ScFv molecules and the like.
- the antibody may be polyclonal or monoclonal, but is preferably monoclonal.
- Such antibodies may be prepared by any technique known in the art for example (Juengel et al, 2002) for administration to an animal, i.e. for use in passive immunisation.
- antibodies may be produced in vivo by administration of an antigen in a suitable adjuvant, i.e. for use in active immunisation.
- suitable adjuvants include Freund's complete or incomplete adjuvant, or similar immunostimulatory agent.
- the antibodies of the present invention may also be produced by genetic engineering methods such as chimeric and humanised monoclonal antibodies, comprising both human and non-human portions, which can be made using standard recombinant DNA techniques.
- the present invention further contemplates the use of one or more agonists and/or antagonists of the present invention in combination with one or more active ingredients known to modulate ovulation rate to enhance the effect on ovulation.
- the active ingredients may be selected from the group comprising GDF-9; GDF-9B; BMPRII; BMPIB receptor (ALK6); ALK5 and BMP6; or functional fragments or variants thereof.
- the invention contemplates the use of BMPlB receptor in combination with an antibody or antibody fragment (Fc) that binds to a peptide of SEQ ID NOs: 5 or 6, in the modulation of ovulation in a female mammal.
- the present invention further provides a pharmaceutical composition comprising at least one agonist or antagonist of the present invention together with a pharmaceutically acceptable carrier useful for the modulation of ovulation rate.
- compositions of the present invention may comprise, in addition to one or more agonists or antagonists of the present invention, a pharmaceutically acceptable excipient, carrier, buffer, stabiliser or other material well known in the art. Such materials should be non-toxic and should not interfere with the efficacy of the active ingredient.
- a pharmaceutically acceptable excipient such materials should be non-toxic and should not interfere with the efficacy of the active ingredient.
- the precise nature of the carrier or other material will be dependent upon the desired nature of the pharmaceutical composition, and the route of administration e.g. oral, intravenous, cutaneous, subcutaneous, intradermal, intramuscular or intraperitoneal.
- compositions for oral administration may be in tablet, lozenge, capsule, powder, granule or liquid form.
- a tablet or other solid oral dosage form will usually include a solid carrier such as gelatine, starch, mannitol, crystalline cellulose, or other inert materials generally used in pharmaceutical manufacture.
- liquid pharmaceutical compositions such as a syrup or emulsion, will generally include a liquid carrier such as water, petroleum, animal or vegetable oils, mineral oil or synthetic oil.
- the active ingredient will be in the form of a parenterally acceptable aqueous solution which is pyrogen- free and has suitable pH, isotonicity and stability.
- the invention contemplates the use of one or more additional modulators of ovulation to be co-administered with the pharmaceutical composition of the present invention to give an additive or synergistic effect to the treatment regime.
- additional modulators of ovulation include follicle stimulating hormone, Androvax (an androsteindione protein vaccine conjugate), and steroid hormone.
- Such modulators may be administered either separately, sequentially or simultaneously with at least one agonist or antagonist of the present invention depending upon whether ovulation is to be increased or decreased as will be appreciated by a skilled worker.
- Administration of the pharmaceutical composition of the invention is preferably in a "therapeutically effective amount", this being sufficient to show the desired benefit to the individual.
- the actual amount administered, and rate and time-course of administration, will depend on the nature and severity of the female mammals underlying condition. Prescription of treatment, e.g. decisions on dosage etc., is within the responsibility of general practitioners and other medical doctors, and typically takes account of the disorder to be treated, the condition of the individual patient, the site of delivery, the method of administration and other factors known to practitioners. Examples of the techniques and protocols mentioned above can be found in Remington's Pharmaceutical Sciences, 16th edition, Oslo, A. (ed), 1980.
- peptide sequences were: DQESASSELKKPLV(C) (SEQ ID NO: 3);
- Peptides of SEQ ID NOs: 3-5 resulted in shutdown of ovulation rate in the majority of animals within 2 weeks after the first booster injection. The shutdown of ovulation rate was maintained until the termination of the experiment. The peptide of SEQ ID NO:6 did not achieve significant shutdown of ovulation rate until the third observation (after 3 booster injections) and only achieved shutdown in 50% of animals. However, by the last booster injection, nine out of ten animals showed a shutdown in ovulation rate (Table 3). Shutdown of ovulation was measured by observation of the ovary whereby the ovary lacked externally visible corpora lutea. Ewes that were deemed to be in oestrus as assessed by observation of the uterus were excluded from the results of Table 3. TABLE 2
- KLH-Peptide (SEQ ID NO:6) 1/10 2/10 5/10 * 5/10 * 9/10 ***
- Two 15-mer peptides were synthesised corresponding to the N-terminal domains of the bovine GDF-9 and GDF-9B protein sequence and including, wherein necessary, additional residues to facilitate conjugation to KLH to generate an antigen.
- the peptide sequences were: DQESVSSELKKPLV(C) (SEQ ID NO: 7); and
- SEQ ID NO: 7 is a functional variant of SEQ ID NO: 3, comprising a single amino acid change (A-> V at amino acid position 5).
- Ovarian activity was determined by visual examination of the ovary. Ovulation rate was assigned based on the number of corpora lutea visible on the surface of the ovary. Corpora lutea were determined to be regressed (and thus not counted in ovulation rate score) if it appeared non functional by morphological criteria (small, lacking vascularization, pale colour) with an additional functional corpora lutea present or was non functional by morphological (small, lacking vascularization, pale colour) and endocrinological criteria (low levels of progesterone in blood samples collect at time of ovarian collection and 2 weeks previously). Follicular development was assessed on 5 ⁇ m histological sections stained with hematoxylin and eosin.
- Peripheral venous blood samples were collected (10 ml by heparinised vaccutainer) at the times of primary and first and second booster and also at 12 days after the first booster and again just before slaughter.
- the plasma samples were analyzed for antibody titres and progesterone concentrations.
- mice were assigned as normal (ovulation rate of 1) or affected (ovulation rate of 0 or >2) with each treatment group compared to KLH-control group.
- NS not significantly different.
- **P ⁇ 0.01 values presented are means ⁇ standard error of the mean
- the antigen coated onto the microtitre plates was 200 ng ovine GDF-9 mature protein or 100 ng ovine GDF-9B mature protein.
- Antibodies were detected using a 1 :20,000 dilution of a rabbit anti-bovine IgG. Sera from heifers was diluted to 1 :500. This is a 40 times less dilution than was required for sheep sera in experiment 1, above, suggesting that the dose of GDF-9 and/or GDF-9B peptides given to bovine was a 'weak' dose.
- the present invention provides compositions and methods for modulating the ovulation rate and therefore fertility in female mammals including humans.
- Bone morphogenetic protein 15 and growth differentiation factor 9 cooperate to regulate granulosa cell function. Reproduction 129:473-480.
Abstract
Description
Claims
Applications Claiming Priority (4)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
NZ53694304A NZ536943A (en) | 2004-12-02 | 2004-12-02 | Modulation of ovulation |
NZ53903905 | 2005-03-24 | ||
NZ54117005 | 2005-07-08 | ||
PCT/NZ2005/000313 WO2006059913A1 (en) | 2004-12-02 | 2005-12-02 | Modulation of ovulation |
Publications (2)
Publication Number | Publication Date |
---|---|
EP1819722A1 true EP1819722A1 (en) | 2007-08-22 |
EP1819722A4 EP1819722A4 (en) | 2009-09-09 |
Family
ID=36565307
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
EP05823157A Withdrawn EP1819722A4 (en) | 2004-12-02 | 2005-12-02 | Modulation of ovulation |
Country Status (6)
Country | Link |
---|---|
EP (1) | EP1819722A4 (en) |
JP (1) | JP2008521891A (en) |
AU (1) | AU2005310356A1 (en) |
BR (1) | BRPI0518809A2 (en) |
CA (1) | CA2589898A1 (en) |
WO (1) | WO2006059913A1 (en) |
Families Citing this family (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2006130022A1 (en) * | 2005-05-30 | 2006-12-07 | Agresearch Limited | Modulation of ovulation by agonists and antagonists of bmprii |
EP2228070B1 (en) | 2005-07-18 | 2016-09-07 | Adelaide Research & Innovation Pty Ltd | Modulation of granulosa cell apoptosis |
BRPI0706173C1 (en) * | 2007-11-23 | 2011-02-22 | Brasil Pesquisa Agropec | method for mass identification of animals with increased prolificacy |
WO2019213690A1 (en) | 2018-05-09 | 2019-11-14 | Monash University | Agentand method forenhancing fertility |
Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO1999017797A1 (en) * | 1997-10-06 | 1999-04-15 | The Johns Hopkins University School Of Medicine | Use of growth differenciation factor-9 (gdf-9) as a contraceptive |
US6191261B1 (en) * | 1993-01-12 | 2001-02-20 | The Johns Hopkins University School Of Medicine | Growth differentiation factor-9 antibodies and methods |
Family Cites Families (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
NZ519330A (en) * | 2002-05-30 | 2004-12-24 | George Henry Davis | New sequences for altering mammalian ovarian function and ovulation rate |
-
2005
- 2005-12-02 CA CA002589898A patent/CA2589898A1/en not_active Abandoned
- 2005-12-02 WO PCT/NZ2005/000313 patent/WO2006059913A1/en active Application Filing
- 2005-12-02 JP JP2007544297A patent/JP2008521891A/en active Pending
- 2005-12-02 AU AU2005310356A patent/AU2005310356A1/en not_active Abandoned
- 2005-12-02 BR BRPI0518809-1A patent/BRPI0518809A2/en not_active Application Discontinuation
- 2005-12-02 EP EP05823157A patent/EP1819722A4/en not_active Withdrawn
Patent Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US6191261B1 (en) * | 1993-01-12 | 2001-02-20 | The Johns Hopkins University School Of Medicine | Growth differentiation factor-9 antibodies and methods |
WO1999017797A1 (en) * | 1997-10-06 | 1999-04-15 | The Johns Hopkins University School Of Medicine | Use of growth differenciation factor-9 (gdf-9) as a contraceptive |
Non-Patent Citations (3)
Title |
---|
JUENGEL J L ET AL: "Growth differentiation factor 9 and bone morphogenetic protein 15 are essential for ovarian follicular development in sheep" BIOLOGY OF REPRODUCTION, SOCIETY FOR THE STUDY OF REPRODUCTION, CHAMPAIGN, IL, US, vol. 67, 4 October 2002 (2002-10-04), pages 1777-1789, XP002999768 ISSN: 0006-3363 * |
MCNATTY KP ET AL: "The Effects of Immunizing Sheep with Different BMP15 or GDF9 Peptide Sequences on Ovarian Follicular Activity and Ovulation Rate" BIOLOGY OF REPRODUCTION, vol. 76, 8 November 2006 (2006-11-08), pages 552-560, XP002538978 DOI: 10.1095/biolreprod.106.054361 * |
See also references of WO2006059913A1 * |
Also Published As
Publication number | Publication date |
---|---|
BRPI0518809A2 (en) | 2008-12-09 |
AU2005310356A1 (en) | 2006-06-08 |
WO2006059913A1 (en) | 2006-06-08 |
CA2589898A1 (en) | 2006-06-08 |
WO2006059913A9 (en) | 2008-05-22 |
EP1819722A4 (en) | 2009-09-09 |
JP2008521891A (en) | 2008-06-26 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20050272028A1 (en) | Myostatin and mimetics thereof | |
CN101522707B (en) | Myostatin antagonists | |
CN110036024A (en) | Muscle performance improves compound | |
Robert et al. | The recognition of hypothalamo-neurohypophysial functions by developing T cells | |
WO2006059913A1 (en) | Modulation of ovulation | |
US20060253912A1 (en) | Nucleotide and amino acid sequences of oocyte factors for altering ovarian follicular growth in vivo or in vitro | |
CA1330420C (en) | Compositions containing growth hormone peptide fragments | |
ES2259458T3 (en) | HUMAN PERSEFINE. | |
NZ536943A (en) | Modulation of ovulation | |
US20090304698A1 (en) | Modulation of ovulation | |
WO2006059914A1 (en) | Modulation of ovulation | |
EP0303488B1 (en) | Biologically active molecules | |
WO2006130022A1 (en) | Modulation of ovulation by agonists and antagonists of bmprii | |
CN101120014A (en) | Modulation of ovulation | |
AU2002317634B8 (en) | Modulation of insulin-regulated aminopeptidase (IRAP)/Angiotensin IV (AT4) receptor activity | |
Hasegawa et al. | Evaluation of the contraceptive potential of recombinant proteins and synthetic peptides of zona pellucida (ZP) | |
Cook | Mutational analysis of the activin and inhibin subunits and the potential for receptor interactions | |
Christensen | for the Degree of Doctor of Philosophy in the Department of Animal and Poultry Science | |
NZ521152A (en) | Assays for detecting the presence of myostatin and antagonists or agonists thereof using isolated myoblasts | |
NZ521151A (en) | Truncated mature myostatin proteins and Piedmontese alleles and uses thereof in promoting muscle growth | |
MXPA97009618A (en) | Hue stimulating factors |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
17P | Request for examination filed |
Effective date: 20070626 |
|
AK | Designated contracting states |
Kind code of ref document: A1 Designated state(s): AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IS IT LI LT LU LV MC NL PL PT RO SE SI SK TR |
|
DAX | Request for extension of the european patent (deleted) | ||
RIC1 | Information provided on ipc code assigned before grant |
Ipc: A61P 15/08 20060101ALI20090730BHEP Ipc: A61K 39/395 20060101ALI20090730BHEP Ipc: C07K 14/495 20060101ALI20090730BHEP Ipc: C07K 14/51 20060101ALI20090730BHEP Ipc: C07K 16/22 20060101ALI20090730BHEP Ipc: A61K 38/10 20060101ALI20090730BHEP Ipc: C07K 7/08 20060101AFI20060619BHEP Ipc: C07K 14/475 20060101ALI20090730BHEP |
|
A4 | Supplementary search report drawn up and despatched |
Effective date: 20090807 |
|
STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN |
|
18D | Application deemed to be withdrawn |
Effective date: 20091105 |