EP1804817A2 - Verfahren zur förderung der wundheilung - Google Patents
Verfahren zur förderung der wundheilungInfo
- Publication number
- EP1804817A2 EP1804817A2 EP05795551A EP05795551A EP1804817A2 EP 1804817 A2 EP1804817 A2 EP 1804817A2 EP 05795551 A EP05795551 A EP 05795551A EP 05795551 A EP05795551 A EP 05795551A EP 1804817 A2 EP1804817 A2 EP 1804817A2
- Authority
- EP
- European Patent Office
- Prior art keywords
- product
- growth factor
- wound healing
- wound
- patient
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/01—Hydrolysed proteins; Derivatives thereof
- A61K38/012—Hydrolysed proteins; Derivatives thereof from animals
- A61K38/018—Hydrolysed proteins; Derivatives thereof from animals from milk
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/01—Hydrolysed proteins; Derivatives thereof
- A61K38/012—Hydrolysed proteins; Derivatives thereof from animals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/19—Cytokines; Lymphokines; Interferons
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/14—Prodigestives, e.g. acids, enzymes, appetite stimulants, antidyspeptics, tonics, antiflatulents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
- A61P17/02—Drugs for dermatological disorders for treating wounds, ulcers, burns, scars, keloids, or the like
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/02—Nutrients, e.g. vitamins, minerals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P41/00—Drugs used in surgical methods, e.g. surgery adjuvants for preventing adhesion or for vitreum substitution
Definitions
- the present invention relates to methods for using Product R, a peptide- nucleic acid composition, to promote wound healing and/or treat loss of appetite or fatigue in patients suffering from a wound.
- the methods are applicable for treating a wide variety of wounds, including ulcers and burn injuries.
- Wound healing is the process through which the repair of damaged tissue(s) is accomplished. Wounds can range from minor abrasions to complicated life-threatening deep lacerations. Wounds can be classified in general into two main classes: 1) acute wounds, such as those acquired through trauma, surgical wounds, burn injuries or the wounds to donor sites for autologous skin grafts; and 2) chronic wounds, such as venous homeostasis ulcers, diabetic ulcers and decubitus ulcers, which are of long duration and progressive.
- the evolution of the wound healing process is described in three main phases: 1) The inflammatory or cleansing stage; 2) the proliferative or granulation phase; and 3) the maturation and remodeling or epithelialization phase.
- the inflammatory stage occurs during the first few days after trauma.
- the wounded area begins its attempts to restore its normal state by constricting blood vessels to control bleeding. Platelets and thromboplastin are formed in the wound to produce clots.
- An inflammatory reaction with the influx of polymorphonuclear leukocytes to begin cleaning the wound of dead tissue and contaminating organisms occurs.
- the inflammatory process serves mainly to cleanse the wound. Too much inflammation interferes with the process of wound healing.
- the proliferative stage of wound healing can last about three weeks or longer. Fibroblasts produce collagen to begin the granulation process in the wound. The wound gradually contracts, blood vessels are formed to nourish new tissue and a covering epithelial layer is formed.
- the maturation and remodeling stage may last up to two years (even up to five years for the healing of burns).
- the formation of new collagen changes the shape of the wound and increases the strength of the scar that forms; however, scar tissue is at best
- Burn wounds are also marked by a production of endogenous cytokines (Stallo et al., 2003, Burns 29:641-647).
- interleukin-1- beta IL-lbeta
- Tumor necrosis factor-alpha TNF-alpha
- IFN-gamma Interferon-gamma appears to play a role during the proliferative phase.
- Interleukin-1 beta induces fever, adrenocorticotropic hormone (ACTH) release, enhances the.synthesis of TNF-alpha and IFN-gamma and activates PMNs.
- Interleukin-2 activates macrophages, T-cells and NK-cells.
- Interleukin-6 induces fever and enhances the release of acute phase reactants from the liver.
- Immunomodulators have been shown to promote wound healing.
- alpha thymosin a T cell stimulator
- has shown positive activity in wound healing (Malinda et al., 1998, J. Immunol. 160:1001-1006).
- Lacerations tend to become more inflamed than clean surgical wounds, including wounds resulting from surgical amputations, and are more difficult to heal. At a simple level this may be due to the trauma of the laceration that results in dead tissue and contamination with bacteria, requiring a greater inflammatory response to cleanse the wound.
- vascular perfusion of traumatized tissue may be compromised by damage to both large and small blood vessels and lymphatic channels.
- Bacterial wound infection is the most common local cause for prolonged wound healing. Human skin is typically colonized by a number of microorganisms, including Candida albicans, Staphylococcus epidermidis, Staphylococcus aureus, and some Streptococcus strains. Thus, any wound which exposes underlying tissues to the environment becomes infected with at least resident microbial flora. Wounds which are well tended and in highly vascularized tissue resist infection, while those in ischemic tissue are much more susceptible to infection.
- Medications used to treat disorders can produce impaired wound healing.
- Chemotherapy used to eliminate dividing cells in cancer patients, also suppresses the ability of such a patient to heal wounds, which is also dependent upon new cell growth.
- Steroids negatively impact all three phases of wound repair, inhibiting the initial inflammatory response, slowing the production of new epithelium and vascular tissue, and weakening the collagen matrix in the scar tissue (Bryant, 1987, J Enterostomal Therapy, 14: 262-66).
- the physical condition of the patient is also important in wound healing. As age increases, the ability to repair injured tissue decreases, as the skin becomes thinner and the number of fibroblasts and amount of total skin collagen decrease (Shuster et al., 1975, Br. J. Dermatol. 93: 639-43). Disease states such as alcoholism, anemia, diabetes, malnutrition, shock, and uremia lead to impaired oxygen and nutrient delivery to the wound site, thereby inhibiting the healing process. Also, diseases leading to monocytopenia can significantly impair wound healing.
- Reticulose ® emerged as an antiviral product in the 1930's. While it was originally believed to be a product composed of peptone, peptides and nucleic acids, the precise composition remains unidentified. A method for preparing Reticulose ® is provided in U.S. Patent No. 5,849,196, herein incorporated by reference in its entirety. Nevertheless, Reticulose " has demonstrated an ability to inhibit rapidly the course of several viral diseases. It is nontoxic, miscible with tissue fluids and blood sera and free from anaphylactogenic properties.
- the components present in the conventional composition of Reticulose that are greater than 15 kDa in molecular weight are more effective in treating viral diseases such as HIV, influenza virus, herpes simplex virus, etc., while the components having a molecular weight in a range of approximately 1 to 15 KDa function as phagocytosis inhibitors.
- Reticulose ® suffers from several disadvantages: 1) the method of preparation does not ensure that each preparation produces the finished components in the same ratio, i.e., the final product is not reproducible; 2) the conventional method of preparation produces a wide range of the finished components, which makes the quality control of the preparation extremely difficult, if possible, because too many parameters need to be determined; 3) the presence of the higher molecular weight components, such as 25 KDa component, essentially peptides, increases the risk of hypersensitivity or immune reaction and renders the product less stable. Therefore, it is desirable to have a product devoid of the deficiencies of conventional Reticulose ® while maintaining its therapeutic properties. [0018] U.S. Patent Nos.
- Product R a composition derived from the same starting materials as used in preparing Reticulose ® , but distinct from Reticulose ® . For example, material greater than 14 kDa molecular weight is removed when preparing Product R.
- Product R is an immunomodulator with a favorable safety profile affecting the production of pro-inflammatory chemokines and cytokines, driving the immune response towards a normal state. In particular, Product R modulates the expression of chemokines and cytokines.
- Product R stimulates macrophages to produce pro ⁇ inflammatory cytokines and chemokines, including MCP-I, IL-8 and IL-6 (Lazzarino et ah, 2001 , Cytokine, 14:234-239; Lazzarino et al., 2000, Immunol. Lett. 74: 189-195).
- Product R inhibits the synthesis of these pro ⁇ inflammatory chemokines.
- Product R may also increase levels of IL-2R.
- IL-2R can stimulate populations of both T and B cells.
- the present invention provides methods for promoting wound healing in a patient, comprising administering to said patient an amount of Product R effective to promote wound healing.
- the present invention also provides methods for treating loss of appetite and fatigue in a patient, preferably a patient suffering from a wound or burn injury, comprising administering to said patient an amount of Product R effective to treat loss of appetite and fatigue.
- Product R comprises nucleotides and peptides have molecular weights not more than 14 KDa and substantially not more than 8 KDa, wherein said nucleotides and peptides are breakdown products of casein, peptone, RNA and serum albumin, and wherein said composition has a light absorption spectrum with typical absorption ratios of 2.0 ( ⁇ 10%) at 260 nm/280 nm and 1.4 ( ⁇ 10%) at 260 nm/230 nm.
- the patient is a human.
- the amount of Product R effective to promote wound healing and/or treat loss of appetite and fatigue is in a range from about 0.5 microliters to about 100 microliters per kilogram of body weight per day, or from about 2.5 microliters to about 40 microliters per kilogram of body weight per day, or from about 10 microliters to about 25 microliters per kilogram of body weight per day.
- Product R is administered parenterally, topically or systemically.
- i IRT ra Idup U t R 1 jIis F ad I fm!
- Ilin ftistere 1 Id TF t Po rpica Hl rily Ti to a wound in a dose adequate to encompass the total area of the wound.
- the methods of the invention can be employed to promote wound healing in a wide variety of wounds.
- the wound is a result of decubitus ulcers, diabetic ulcers, surgical wounds or burn injury.
- the present invention also encompasses methods for promoting wound healing in a patient, comprising administering to said patient an amount of Product R effective to promote wound healing and an effective amount of another medicament.
- the present invention also encompasses methods for treating loss of appetite or fatigue in a patient, preferably a patient suffering from a wound or burn injury, comprising administering to said patient an amount of Product R effective to promote wound healing and an effective amount of another medicament.
- the other medicament is an antibiotic, a biological response modifier, e.g., a cytokine, or a wound healing factor.
- the present invention also comprises pharmaceutical compositions and kits comprising 1) an amount of Product R effective to promote wound healing; 2) a biological response modifier or a wound healing factor agent; and 3) a pharmaceutically acceptable carrier.
- Antibiotics useful in the methods of the invention include, but are not limited to, penicillin, cephalosporin, griseofulvin, bacitracin, polymyxin B, amphotericin B, erythromycin, neomycin, streptomycin, tetracycline, vancomycin, gentamicin, and rifamycin.
- Biological response modifiers useful in the methods and compositions of the invention include, but are not limited to, interferon- ⁇ , interferon- ⁇ , interleukin-2, interleukin-4, interleukin-6, and tumor necrosis factor.
- Wound healing factors useful in the methods and compositions of the invention include, but are not limited to, interferon (IFN)- ⁇ , IFN- ⁇ , interleukin (IL)-I, IL-2, IL-4, IL-5, IL-15, tumor necrosis factor, flt-1 ligand, arginine, connective tissue growth factor, adenosine, cyclic adenosine monophosphate, the fibroblast growth factor family, tumor growth factor- ⁇ , tumor growth factor- ⁇ (1 and 2), vascular endothelial growth factor, the epidermal growth factor family, the platelet derived growth factor family, the insulin-like growth factor family, nitric oxide, macrophage- stimulating protein, and macrophage-derived growth factor.
- Product R can promote the wound healing process, particularly when administered topically, i.e., to the surface of the wound site, or systemically.
- the present invention provides methods and compositions for Product R so delivered can be used for all wound types, acute or chronic, such that the wound undergoes healing more rapidly than similar wounds left to heal naturally or which are treated with currently available methods. Without being bound by any theory, Product R is believed to modulate the immune system to promote wound healing.
- Product R (AVRl 18; Advanced Viral Research Corp., Yonkers, NY) is a composition comprising the breakdown products of casein, peptone, RNA, and serum albumin.
- the manufacturing process, composition, and the chemical and physical and some biological properties of Product R are described in U.S. Patent Nos. 6,303,153 and 6,528,098, both of which are herein incorporated by reference in their entireties.
- Product R has been used as a synonym of Reticulose ® in some literature.
- Product R is a therapeutic composition for treating viral infections and stimulating the immune system comprising nucleotides and peptides have molecular weights not more than 14 KDa and substantially not more than 8 KDa 5 wherein said nucleotides and peptides are breakdown products of casein, peptone, RNA and serum albumin, and wherein said composition has a light absorption spectrum with typical absorption ratios of 2.0 ( ⁇ 10%) at 260 nm/280 nm and 1.4 ( ⁇ 10%) at 260 nm/230 mm.
- Product R is prepared according to the following manner.
- the starting materials casein, beef peptone, RNA, bovine serum albumin (BSA), and sodium hydroxide are suspended in proportions of, by weight, 35-50% (casein), 15-40% (beef peptone), 10-25% (RNA), 1-10% (BSA) and 5-25% (sodium hydroxide) in an appropriate volume of distilled water.
- AU starting materials are generally available or otherwise can be readily prepared by a person of ordinary skill in the art.
- RNA is suitable for the intended purpose of the present invention
- plant RNA is preferred and yeast RNA is the most preferred.
- the ratio of total proteins versus the volume of distilled water is generally about 1.5-2.5 to about 100 by weight, preferably about 2.2 to about 100 by weight. This means that every 1.5-2.5 grams of the total proteins are suspended in about 100 milliliters of distilled water.
- RNA may be completely hydrolyzed into nucleotides. ⁇ er.au ⁇ ocI ; ⁇ ving ⁇ r the.s ⁇ tio,p, l .is 11 G.poled down to room temperature, and then allowed to stay at a temperature of 3° to 8 0 C for at least 12 hours to precipitate insoluble elements.
- the cooled solution may be centrifuged at a temperature below 8 0 C to remove the precipitates.
- the resulting solution is then filtered through a 2 micron and a 0.45 micron filters under an inert gas such as nitrogen or argon at a pressure of about 1-6 psi.
- the solution is filtered again through a pyrogen retention filter, preferably 0.2 micron.
- the solution may be cooled at 3 to 8 0 C again for at least about 12 hours and filtered again in the same way as described above.
- the resulting filtrate is then assayed for total nitrogen content using methods known to a person of ordinary skill in the art such as Kjeldahl method (Kjeldahl, Z. 1983, Anal. Chem., Vol. 22:366), and its improvements. Based on the assay, the filtrate is then diluted with chilled distilled water to an appropriate volume having a preferred total nitrogen content ranging from 165 to 210 mg/ml.
- Product R so produced contains essentially nucleotides, nucleosides and free nucleic acid bases of low molecular weights from a complete hydrolysis of RNA and small peptides from partial hydrolysis of the proteins. It is possible that the base hydrolysis of the proteins also produces free amino acids.
- the final filtrate is then filled and sealed into appropriate vials, such as 2 ml or 10 ml glass vials under an inert gas.
- appropriate vials such as 2 ml or 10 ml glass vials under an inert gas.
- the filled vials are autoclaved for final sterilization, after which they are ready for use.
- Product R contains two major components, which are exhibited as two bands having molecular weights of 5.2 kDa and 4.3 kDa on a SDS-polyacrymide gel electrophoresis, namely peptide-A and peptide-B, respectively.
- Peptide-A is a 31 amino acid long peptide of 5.2 KDa molecular weight derived from bovine casein. It is a straight chain peptide lacking any cysteine- remarkable for six p r roline residues sp r aced throug °hout the molecule and four basic glutamine residues.
- Peptide-B comprises a 21 amino acid long linear peptide of 4.3 KDa molecular weight covalently linked at the hydroxyl group of a serine residue at position 18 to a diadenosine dinucleotide unit through a diphosphodiester linkage at the 3 '-position.
- Peptide- A and peptide-B are present in the Product R composition in an approximately equal amount and the total amount of these two peptides is about 4.8-5.3 mg/ml, determined by a Lowry protein assay.
- the sequence of peptide A is: KVLPVPQKAVPYPQRDMPIQAFLLYQEPVLG (SEQ ID NO. 1).
- the sequence of peptide B is: GEIPD AGGRTVD YYVGFSDSV (SEQ ID NO. 2).
- Product R also comprises nucleosides, nucleoside diphosphates and nucleoside monophosphates. There are sixteen identified constituent compounds present in the Product R formulation - 3 nucleosides, two nucleoside diphosphates and eight nucleoside monophosphates, together with two peptides (one of them a peptide-nucleic acid conjugate) and sodium chloride.
- the methods of the present invention are applicable for treating any type of wound to promote wound healing.
- the methods of the present invention are also applicable for treating conditions, such as loss of appetite and fatigue, in a patient, preferably a patient suffering from a wound or burn injury. Certain wounds heal normally without therapeutic intervention. In these cases, the methods of the invention can quicken the healing process.
- wound healing disorders lead to a delayed healing of wounds or to chronic wounds. These disorders can be caused by the nature of the wound (e.g. large-area wounds, deep and mechanically expanded operation wounds, burns, trauma, decubitus), medicinal treatment of the patients
- Acute wound a wound caused by trauma or surgery; usually requiring limited local care.
- Chronic wound a wound which takes longer than usual to heal because of underlying conditions, such as pressure, diabetes mellitus, poor circulation, poor nutritional state, immunodeficiencies, or infection.
- Full-thickness wound tissue destruction extending through the second layer of skin (dermis) to involve subcutaneous tissue and possibly muscle or bone.
- Laceration a torn or jagged wound.
- Partial-thickness wound tissue destruction through the first layer of skin
- Diabetic ulcer an ulcer caused by trauma or pressure secondary to neuropathy or vascular disease related to diabetes mellitus.
- Pressure ulcer an ulcer caused by poor blood supply from pressure, also called a bedsore or pressure sore.
- Venous ulcer local losses of epidermis and various levels of dermis and subcutaneous tissue, occurring over or near the malleoli of the distal lower extremities; caused by edema and other sequellae of impaired venous return.
- Burns [0058] Superficial (first-degree burn): damage limited to the epidermis characterized by erythema, hyperemia, tenderness, and pain.
- Partial-thickness (second-degree burn): superficial to deep partial-thickness wound characterized by large blisters, edema, pain, and wet, weeping, and shiny surface.
- the individual, patient or subject in whom promotion of wound healing, or treatment of loss of appetite or fatigue, is desired is an animal, preferably a mammal, a non- human animal or primate, and most preferably human.
- animal as used herein includes, but is not limited to, companion animals, such as cats and dogs; zoo animals; wild animals, including deers, foxes and racoons; farm animals, livestock and fowl, including horses, cattle, sheep, pigs, turkeys, ducks, and chickens, as well as any rodents.
- the methods of the invention comprise administering an amount of Product
- An amount of Product R effective to promote wound healing, or treat loss of appetite or fatigue within the meaning of the present invention can be determined by a patient's attending physician or veterinarian. Such amounts are readily ascertained by one of ordinary skill in the art and can enable accelerated wound healing when administered in accordance with the present invention.
- Factors which influence what an amount of Product R effective to promote wound healing, or treat loss of appetite or fatigue will be include, the specific activity of the therapeutic agent being used, the wound type (mechanical or thermal, full or partial thickness, etc.), the size of the wound, the wound's depth (if full thickness), the absence or presence of infection, time elapsed since the injury's infliction, and the age, physical condition, existence of other disease states, and nutritional status of the patient. Additionally, other medication the patient may be receiving will effect the determination of the amount of Product R to administer.
- the amount of Product R effective to promote wound healing, or treat loss of appetite or fatigue is in a range from about 0.5 microliters to about 100 microliters per kilogram of body weight per day, or from about 2.5 microliters to about 40 microliters per kilogram of body weight per day, or from about 10 microliters to about 25 microliters per kilogram of body weight per day.
- "about” entails normal experimental variation.
- Product R may be administered to the patient according to the conventional doses or any dosages that are apparent to a person of ordinary skill in the art.
- the desired dose may be administered as two, three or more sub-doses at appropriate intervals, generally equally spread in time, throughout the day.
- the dosage used for topical administration to the wound will vary depending on the size and location of the wound, and will preferably encompass the entire wound area. £90643- ... a , j ,
- administration for Product R may include, without limitation, oral, topical, parenteral, sublingual, rectal, vaginal, ocular, and intranasal.
- Parenteral administration includes subcutaneous injections, intravenous, intramuscular, intraperitoneal, intrapleural, intrasternal injection or infusion techniques.
- Product R is administered topically.
- Product R can be used systemically, by the subcutaneous route, to stabilize a wounded patient. It will be appreciated that the preferred route may vary with, for example, the condition and age of the recipient.
- Product R is administered by both systemic and topical routes to promote the wound healing, or treat loss of appetite or fatigue,.
- systemic and topical administration of Product R can be used acutely to stabilize the wounded patient.
- Product R then can be used topically to promote wound healing, or treat loss of appetite or fatigue, as the patient is further stabilized, has undergone any necessary surgery to debride the wound, and has entered the recuperative phase.
- the present invention also encompasses methods for promoting wound healing in a patient, comprising administering to said patient an amount of Product R effective to promote wound healing and an effective amount of another medicament.
- the present invention also encompasses methods for treating loss of appetite or fatigue in a patient, preferably a patient suffering from a wound or burn injury, comprising administering to said patient an amount of Product R effective to promote wound healing, or treat loss of appetite or fatigue, and an effective amount of another medicament.
- the other medicament is an antibiotic, a biological response modifier, e.g., a cytokine, or a wound healing factor.
- Antibiotics useful in the methods of the invention include, but are not limited to, penicillin, cephalosporin, griseofulvin, bacitracin, polymyxin B, amphotericin B, erythromycin, neomycin, streptomycin, tetracycline, vancomycin, gentamicin, and rifamycin.
- Biological response modifiers useful in the methods of the invention include, but are not limited to, interferon- ⁇ , interferon- ⁇ , interleukin-2, interleukin-4, interleukin-6, and tumor necrosis factor.
- Wound healing factors useful in the methods of the invention include, but are not limited to, interferon (IFN)- ⁇ , IFN- ⁇ , interleukin (IL)-I, TL-I 3 IL-4, IL-5, IL-15, tumor necrosis factor, flt-1 ligand, arginine, connective tissue growth factor, adenosine, cyclic adenosine monophosphate, the fibroblast growth factor family, tumor growth factor- ⁇ , tumor growth factor- ⁇ (1 and 2), vascular endothelial growth factor, the epidermal growth factor family, the platelet derived growth factor family, the insulin-like growth factor family, nitric oxide, macrophage-stimulating protein, and macrophage-derived growth factor.
- IFN interferon
- IL interleukin
- TL-I 3 IL-4 IL-5
- IL-15 tumor necrosis factor
- flt-1 ligand arginine
- connective tissue growth factor adenosine
- in combination refers to the use of more than one prophylactic and/or therapeutic agents.
- the use of the term “in combination” does not restrict the order in which prophylactic and/or therapeutic agents are administered to a subject with a disorder.
- a first prophylactic or therapeutic agent can be administered prior to (e.g., up to 1 minute, 5 minutes, 15 minutes, 30 minutes, 45 minutes, 1 hour, 2 hours, 4 hours, 6 hours, 12 hours, 24 hours, 48 hours, 72 hours, 96 hours, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 8 weeks, or 12 weeks before), concomitantly with, or subsequent to (e.g., up to 1 minute, 5 minutes, 15 minutes, 30 minutes, 45 minutes, 1 hour, 2 hours, 4 hours, 6 hours, 12 hours, 24 hours, 48 hours, 72 hours, 96 hours, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 8 weeks, or 12 weeks after) the administration of a second prophylactic or therapeutic agent to a subject which had, has, or is susceptible to a wound.
- the prophylactic or therapeutic agents are administered to a subject in a sequence and within a time interval such that the agent of the invention can act together with the other agent to provide an increased benefit than if they were administered otherwise. Any additional prophylactic or therapeutic agent can be administered in any order with the other additional prophylactic or therapeutic agents.
- the effects/efficacy of treatment of a wound according to the present invention can be detected, for example, on the level of the molecular and cellular agents involved in the immune response (e.g. , macrophages, B cells, or T cells) or on the level of an affected tissue including, but not limited to, stimulation of macrophages to secrete growth factors, synthesis and cross-linking of collagen, and decrease in wound size, using standard methods well known to one of ordinary skill in the art.
- the level of the molecular and cellular agents involved in the immune response e.g. , macrophages, B cells, or T cells
- an affected tissue including, but not limited to, stimulation of macrophages to secrete growth factors, synthesis and cross-linking of collagen, and decrease in wound size, using standard methods well known to one of ordinary skill in the art.
- compositions of the present invention comprise at least one administered ingredient, i.e., Product R, as above defined, together with one or more acceptable carriers thereof and optionally one or more additional medicaments. Suitable additional medicaments are provided in Section 4.2.
- the carrier(s) must be "pharmaceutically acceptable" in the sense of being compatible with the other ingredients of the formulation jand; njpt in vivo use, in the patient).
- Product R in a pharmaceutical formulation is sterile.
- the formulations may conveniently be presented in unit-dose or multi-dose containers, e.g., sealed ampules and vials.
- Preferred unit dosage formulations are those containing a daily dose or unit, daily sub-dose, or an appropriate fraction of the administered ingredient.
- compositions of the invention can be in the form of a solid, liquid or gas
- compositions of the invention can be formulated so as to allow a compound of the invention to be bioavailable upon administration of the composition to a subject.
- Compositions can take the form of one or more dosage units, where for example, a tablet can be a single dosage unit, and a container of a compound of the invention in aerosol form can hold a plurality of dosage units.
- a syringe containing a unit dose of Product R is also provided.
- the pharmaceutical preparation can be in liquid form, for example, solutions, syrups or suspensions, or can be presented as a drug product for reconstitution with water or other suitable vehicle before use.
- Such liquid preparations can be prepared by conventional means with pharmaceutically acceptable additives such as suspending agents (e.g., sorbitol syrup, cellulose derivatives or hydrogenated edible fats); emulsifying agents (e.g., lecithin or acacia); non-aqueous vehicles (e.g., almond oil, oily esters, or fractionated vegetable oils); and preservatives (e.g. , methyl or propyl-p- hydroxybenzoates or sorbic acid).
- suspending agents e.g., sorbitol syrup, cellulose derivatives or hydrogenated edible fats
- emulsifying agents e.g., lecithin or acacia
- non-aqueous vehicles e.g., almond oil, oily esters, or fractionated vegetable oils
- preservatives e.g. , methyl or propyl-p- hydroxybenzoates or sorbic acid
- compositions can take the form of, for example, tablets or capsules prepared by conventional means with pharmaceutically acceptable excipients such as binding agents (e.g., pregelatinized maize starch, polyvinyl pyrrolidone or hydroxypropyl methylcellulose); fillers (e.g., lactose, microcrystalline cellulose or calcium hydrogen phosphate); lubricants (e.g. , magnesium stearate, talc or silica); disintegrants (e.g., potato starch or sodium starch glycolate); or wetting agents (e.g., sodium lauryl sulphate).
- binding agents e.g., pregelatinized maize starch, polyvinyl pyrrolidone or hydroxypropyl methylcellulose
- fillers e.g., lactose, microcrystalline cellulose or calcium hydrogen phosphate
- lubricants e.g. , magnesium stearate, talc or silica
- disintegrants e.g., potato
- the compounds for use according to the present invention are conveniently delivered in the form of an aerosol spray presentation from pressurized packs or a nebulizer, with the use of a suitable propellant, e.g., dichlorodifluoromethane, trichlorofluoromethane, dichlorotetrafluoroethane, carbon dioxide pressurized aerosol the dosage unit can be determined by providing a valve to deliver a metered amount.
- a suitable propellant e.g., dichlorodifluoromethane, trichlorofluoromethane, dichlorotetrafluoroethane, carbon dioxide pressurized aerosol
- the dosage unit can be determined by providing a valve to deliver a metered amount.
- Capsules and cartridges of, e.g., gelatin for use in an inhaler or insufflator can be formulated containing a powder mix of the compound and a suitable powder base such as lactose or starch.
- the compounds can be formulated for parenteral administration by injection, e.g., by bolus injection or continuous infusion.
- Formulations for injection can be presented in unit dosage form, e.g. , in ampoules or in multi-dose containers, with an added preservative.
- the compositions can take such forms as suspensions, solutions or emulsions in oily or aqueous vehicles, and can contain formulatory agents such as suspending, stabilizing and/or dispersing agents.
- the active ingredient can be in powder form for constitution with a suitable vehicle, e.g., sterile pyrogen-free water, before use.
- the compounds can be formulated in compositions such as creams, lotions, gels, opthalmic drops, ointments, solutions, suspensions, shampoos, or other forms known to one of skill in the art and described in, for example, Remington's Pharmaceutical Sciences, 16th and 18th eds., Mack Publishing, Easton Pa. (1980 & 1990), and Introduction to Pharmaceutical Dosage Forms, 4th ed., Lea & Febiger, Philadelphia (1985). Actual methods for preparing pharmaceutical compositions are known or apparent to those skilled in the art and are described in detail in, for example, Remington's Pharmaceutical Sciences, 16th and 18th eds., Mack Publishing, Easton Pa. (1980 & 1990).
- the compounds can also be formulated in rectal compositions such as suppositories or retention enemas, e.g., containing conventional suppository bases such as cocoa butter or other glycerides.
- the compounds can also be formulated as a depot preparation.
- Such long acting formulations can be administered by implantation (e.g., subcutaneously or intramuscularly) or by intramuscular injection.
- the compounds can be formulated with suitable polymeric or hydrophobic materials (e.g., as an emulsion in an acceptable oil) or ion exchange resins, or as sparingly soluble derivatives, for example, as a sparingly soluble salt.
- suitable polymeric or hydrophobic materials e.g., as an emulsion in an acceptable oil
- ion exchange resins e.g., as sparingly soluble derivatives, for example, as a sparingly soluble salt.
- Liposomes and emulsions are well known examples of delivery vehicles or carriers for hydrophilic drugs.
- kits for carrying out the methods and/or therapeutic regimens of the invention comprise in one or more containers, Product R.
- such kits comprise in one or more containers an amount of Product R effective to promote wound healing, or treat loss of appetite or fatigue, in pharmaceutically acceptable form.
- ( gRppduct R j in ⁇ ⁇ ijr ⁇ tjainer of a kit of the invention may be in the form of a pharmaceutically acceptable solution, e.g., in combination with sterile saline, dextrose solution, or buffered solution, or other pharmaceutically acceptable sterile fluid.
- Product R may be lyophilized or desiccated; in this instance, the kit optionally further comprises in a container a pharmaceutically acceptable solution (e.g. , saline, dextrose solution, etc.), preferably sterile, to reconstitute Product R to form a solution for injection purposes.
- a pharmaceutically acceptable solution e.g. , saline, dextrose solution, etc.
- kits of the invention further comprises a needle or syringe, preferably packaged in sterile form, for injecting Product R, and/or a packaged alcohol pad. Instructions are optionally included for administration of Product R by a clinician or by the patient.
- Kits are also provided for carrying out the combination therapies of the present invention.
- a kit comprises a first container containing Product R and a second container containing an additional medicament. Suitable additional medicaments are provided in Section 4.2.
- the kit may for example comprise metal or plastic foil, such as a blister pack.
- the kit may be accompanied by one or more reusable or disposable device(s) for administration (e.g, syringes, needles, dispensing pens) and/or instructions for administration.
- Animal models can optionally be used to demonstrate use of particular formulations and/or dosages of Product R in wound healing. Suitable animal models for wound healing are known to one of ordinary skill in the art.
- the reaction is autoclaved at about 9 lbs pressure and 200-230 0 F for a::perk) j d , o
- the autoclave was stopped and the reaction flask and contents were permitted to slowly cool to ambient temperature.
- the reaction was then cooled for at least six hours at about 3-8° C.
- the resulting solution was filtered through 2 micron and 0.45 micron filters using an inert gas such as nitrogen or argon at low pressure (1-6 psi). In a similar manner, the solution was filtered again through 0.2 micron pyrogen retention filters.
- the resulting filtrate was sampled and assayed for total nitrogen. A calculation was then performed to determine the quantity of cooled water for injection to be added to the filtrate to yield a diluted filtrate with a nitrogen content between about 165-210 mg/100 ml, the final volume is approximately 5 liters.
- the pH was then adjusted with either concentrated HCl (reagent grade ACS) or 1.0 normal NaOH to about 7.3-7.6.
- the diluted solution was then filtered again through 0.2 micron filters with inert gas at low pressure.
- the final filtrate was then filled and sealed into 2 ml glass ampoules or 2mL vials while in an inert gas atmosphere. The ampoules or vials were collected and autoclaved for final sterilization at 240° F and 20 to 30 psi pressure for about 30 minutes. Following the sterilization cycle, the ampules with Product R were cooled and washed.
- AU quantities are subject to plus or minus 2.5% variation for pH, volume, and analytical adjustments.
- Example 2 The patient was an 85 year old active male suffering from a chronic skin ulcer on the right leg due to venous insufficiency. The patient generally enjoyed good health. He has a history of chronic iron deficiency anemia on the basis of small amounts of bleeding from the bowel due to small arterio-venous malformations. [0090] The patient previously had bilateral vein strippings of the lower extremities for varicose veins. Prior to Product R treatment, the patient developed a superficial skin ulcer under the lateral malleolus of the right tibia. He applied ointments and creams such as antibiotic ointments and zinc oxide cream. The lesion would heal with formation of an eschar but then the ulcer would re-open. [0091] Product R was applied topically to the open lesion, which measured 3/8 inch, twice a day by dropping liquid Product R on the lesion from an insulin syringe. Within seven days, the chronic ulcer epithelialized and healed.
- the margins of the wound are no longer detached from the underlying tissue so that a hand no longer can be placed under the skin of the wound. From the beginning time point when Product R therapy was initiated, to eight months subsequently, the length of the wound decreased from 10 cm to approximately 4 1/2 cm. The two smaller decubitus ulcers have closed and healed.
- the patient has shown marked increase in her mental awareness and her general physical condition, including her appetite, greatly improved. The patient suffered no side effects from either topical or systemic therapy with Product R. The patient is maintaining treatment with Product R topically to the wound and by subcutaneous injection.
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US60532004P | 2004-08-27 | 2004-08-27 | |
PCT/US2005/030798 WO2006026604A2 (en) | 2004-08-27 | 2005-08-29 | Methods for promoting wound healing |
Publications (2)
Publication Number | Publication Date |
---|---|
EP1804817A2 true EP1804817A2 (de) | 2007-07-11 |
EP1804817A4 EP1804817A4 (de) | 2009-11-11 |
Family
ID=36000687
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
EP05795551A Withdrawn EP1804817A4 (de) | 2004-08-27 | 2005-08-29 | Verfahren zur förderung der wundheilung |
Country Status (5)
Country | Link |
---|---|
EP (1) | EP1804817A4 (de) |
JP (1) | JP2008511652A (de) |
AU (1) | AU2005279921A1 (de) |
CA (1) | CA2578212A1 (de) |
WO (1) | WO2006026604A2 (de) |
Families Citing this family (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US6528098B2 (en) | 1996-10-22 | 2003-03-04 | Advanced Viral Research Corp. | Preparation of a therapeutic composition |
US20120219511A1 (en) * | 2009-09-29 | 2012-08-30 | Igor Arturovich Petropavlov | Oral care compositions containing human recombinant interleukin-1 |
SI2986615T1 (sl) | 2013-04-18 | 2019-05-31 | Qbiotics Limited | Postopki in pripravki za celjenje ran |
CN108339112B (zh) * | 2016-12-30 | 2023-04-21 | 亚宝药业集团股份有限公司 | 一种用于促进创伤愈合、褥疮修复、术后应激性溃疡愈合的营养组合物 |
Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5902786A (en) * | 1997-04-15 | 1999-05-11 | Advanced Viral Research Corp. | Treatment of basal cell carcinoma with product R, a peptide-nucleic acid preparation |
US20030206962A1 (en) * | 1997-04-15 | 2003-11-06 | Hirschman Shalom Z. | Method for treating cancer patients undergoing chemotherapy |
Family Cites Families (7)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5849196A (en) * | 1996-10-07 | 1998-12-15 | Immune Modulation Maximum | Composition containing peptides and nucleic acids and methods of making same |
US6528098B2 (en) * | 1996-10-22 | 2003-03-04 | Advanced Viral Research Corp. | Preparation of a therapeutic composition |
US6303153B1 (en) * | 1996-10-22 | 2001-10-16 | Advanced Viral Research Corp. | Preparation of a therapeutic composition |
CA2285572A1 (en) * | 1997-04-15 | 1998-10-22 | Advanced Viral Research Corp. | A method for treating papillomavirus infections |
AU6968098A (en) * | 1997-04-15 | 1998-11-11 | Advanced Viral Research Corp. | Topical treatment of skin diseases and eye afflictions |
US5807839A (en) * | 1997-04-15 | 1998-09-15 | Advanced Viral Research Corp. | Method for stimulating red blood cell production |
US20020107184A1 (en) * | 1997-11-04 | 2002-08-08 | Shalom Z. Hirschman | Method for treating melanoma |
-
2005
- 2005-08-29 WO PCT/US2005/030798 patent/WO2006026604A2/en active Application Filing
- 2005-08-29 CA CA002578212A patent/CA2578212A1/en not_active Abandoned
- 2005-08-29 AU AU2005279921A patent/AU2005279921A1/en not_active Abandoned
- 2005-08-29 EP EP05795551A patent/EP1804817A4/de not_active Withdrawn
- 2005-08-29 JP JP2007530256A patent/JP2008511652A/ja active Pending
Patent Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5902786A (en) * | 1997-04-15 | 1999-05-11 | Advanced Viral Research Corp. | Treatment of basal cell carcinoma with product R, a peptide-nucleic acid preparation |
US20030206962A1 (en) * | 1997-04-15 | 2003-11-06 | Hirschman Shalom Z. | Method for treating cancer patients undergoing chemotherapy |
Non-Patent Citations (1)
Title |
---|
See also references of WO2006026604A2 * |
Also Published As
Publication number | Publication date |
---|---|
EP1804817A4 (de) | 2009-11-11 |
JP2008511652A (ja) | 2008-04-17 |
AU2005279921A1 (en) | 2006-03-09 |
WO2006026604A3 (en) | 2006-12-07 |
CA2578212A1 (en) | 2006-03-09 |
WO2006026604A2 (en) | 2006-03-09 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US7858582B2 (en) | Ophthalmic hGM-CSF preparation | |
AU1462392A (en) | Use of gm-csf and g-csf to promote accelerated wound healing | |
RU2712635C1 (ru) | Композиции для содействия заживлению кожных язв и ран | |
JP2805224B2 (ja) | 血小板減少症治療剤 | |
US9233126B2 (en) | Platelet-rich plasma compositions | |
US7645733B2 (en) | Tissue protective cytokines for the treatment and prevention of sepsis and the formation of adhesions | |
WO2006026604A2 (en) | Methods for promoting wound healing | |
CN112933214A (zh) | 一种促进伤口愈合的组合物 | |
BG62239B1 (bg) | Приложение на лизозимен димер | |
RU2209074C2 (ru) | Состав для лечения ожогов | |
Gültekin et al. | Treatment of a full-thickness skin wound in gluteal region of the Vervet monkey with topical insulin. | |
US6123937A (en) | Applications of lysozyme dimer | |
US20070025963A1 (en) | Methods for reduction of scar tissue formation | |
RU2228763C1 (ru) | Способ лечения гнойных ран | |
EP2089050A2 (de) | Il-17b zur anwendung in der wundheilung | |
RU2148988C1 (ru) | Усовершенствованная лекарственная форма человеческого интерферона-свеча | |
RU2152214C1 (ru) | Способ лечения острого остеомиелита | |
RU2202356C2 (ru) | Способ стимуляции репаративных процессов длительно незаживающих ран и трофических язв | |
EP1888085A1 (de) | Verfahren für die palliative versorgung mit avr118 | |
RU2115428C1 (ru) | Способ лечения иммуносупрессии при сепсисе у человека | |
US20190321412A1 (en) | Methods and compositions using dehydrated human amnion/chorion membrane allograft and amnionic membrane allograft suspensions for the treatment of hair loss | |
CN116585457A (zh) | 一种用于治疗难愈性创面的组合物及其制剂与应用 | |
TW202202145A (zh) | 促進傷口癒合的有機鍺藥物及其使用方法 | |
MXPA03006346A (es) | Composiciones de cianoacrilato para el tratamiento profilactico o terapeutico de enfermedades que se manifiestan por si mismas en el tejido cutaneo y/o danan al mismo. | |
RU2271218C2 (ru) | Способ местного лечения папилломавирусной инфекции урогенитального тракта у женщин |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
17P | Request for examination filed |
Effective date: 20070326 |
|
AK | Designated contracting states |
Kind code of ref document: A2 Designated state(s): AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IS IT LI LT LU LV MC NL PL PT RO SE SI SK TR |
|
AX | Request for extension of the european patent |
Extension state: AL BA HR MK YU |
|
RIN1 | Information on inventor provided before grant (corrected) |
Inventor name: WILNER, ELI |
|
RA4 | Supplementary search report drawn up and despatched (corrected) |
Effective date: 20090914 |
|
A4 | Supplementary search report drawn up and despatched |
Effective date: 20090914 |
|
STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN |
|
18D | Application deemed to be withdrawn |
Effective date: 20091229 |