EP1660527A1 - Isoliertes photoprotein berovin, sowie dessen verwendung - Google Patents

Isoliertes photoprotein berovin, sowie dessen verwendung

Info

Publication number
EP1660527A1
EP1660527A1 EP04764112A EP04764112A EP1660527A1 EP 1660527 A1 EP1660527 A1 EP 1660527A1 EP 04764112 A EP04764112 A EP 04764112A EP 04764112 A EP04764112 A EP 04764112A EP 1660527 A1 EP1660527 A1 EP 1660527A1
Authority
EP
European Patent Office
Prior art keywords
photoprotein
nucleic acid
berovin
sequence
acid molecules
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Withdrawn
Application number
EP04764112A
Other languages
English (en)
French (fr)
Inventor
Stefan Golz
Svetlana Markova
Ludmila Burakova
Ludmila Frank
Eugene Vysotski
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Bayer Pharma AG
Original Assignee
Bayer Healthcare AG
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Bayer Healthcare AG filed Critical Bayer Healthcare AG
Publication of EP1660527A1 publication Critical patent/EP1660527A1/de
Withdrawn legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/43504Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates
    • C07K14/43595Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates from coelenteratae, e.g. medusae

Definitions

  • the invention relates to the photoprotein berovin, its nucleotide and amino acid sequence, and the activity and use of the photoprotein berovin.
  • Photoproteins Bioluminescence is the phenomenon of light generation by living things. It is the result of biochemical reactions in cells in which the chemical energy is released in the form of light quanta (so-called cold emission through chemiluminescence). Light generated in this way is monochromatic, because it is emitted at a discrete electron transition, but can be shifted into longer-wave spectral ranges by secondary fluorescent dyes (e.g. fluorescent proteins in the case of light jellyfish of the genus Aequora).
  • secondary fluorescent dyes e.g. fluorescent proteins in the case of light jellyfish of the genus Aequora
  • the biological function is diverse: around 90% of all living things shine in the sea depth between 200 and 1000 m (mesopelagial).
  • the light signals are used here for partner advertising, deception and as bait. Fireflies and fireflies also use the light signals to find partners.
  • GFP green fluorescent protein
  • Table 2 Overview of some photoproteins. The organism from which the protein has been isolated, the name of the photoprotein and a selection of patents or applications are given.
  • Bioluminescence is widely used in technology today, e.g. in the form of bio-indicators for environmental pollution or in biochemistry for the sensitive detection of proteins, for the quantification of certain compounds or as so-called “reporters” in the study of cellular gene regulation.
  • the photoproteins differ not only because of their nucleotide and amino acid sequence, but also because of their biochemical and physical properties. It could be shown that changing the amino acid sequence of photoproteins can change the physical and biochemical properties. Examples of mutagenized photoproteins are described in the literature (US 6,495,355; US 5,541,309; US 5,093,240; Shimomura et al., 1986).
  • Reporter or indicator genes are generally referred to as genes whose gene products can be easily detected using simple biochemical or histochemical methods. There are at least 2 types of reporter genes.
  • Resistance genes are genes whose expression gives a cell resistance to antibiotics or other substances, the presence of which in the growth medium leads to cell death if the resistance gene is missing.
  • Reporter genes are used in genetic engineering as merged or unfused indicators. The most common reporter genes include beta-galactosidase (Alam et al., 1990), alkaline phosphatase (Yang et al., 1997; Cullen et al., 1992), luciferases and other photoproteins (Shinomura, 1985; Phillips GN, 1997; Snowdowne et al., 1984).
  • Luminescence is the radiation of photons in the visible spectral range, this being done by excited emitter molecules. In contrast to fluorescence, the energy is not supplied from outside in the form of radiation of shorter wavelength.
  • Chemiluminescence is a chemical reaction that leads to an excited molecule that glows when the excited electrons return to the ground state. If this reaction is catalyzed by an enzyme, one speaks of bioluminescence.
  • the enzymes involved in the reaction are generally referred to as luciferases.
  • the species Beroe abyssicola belongs to the Cnidaria, especially to the Medusas. Isolation of the cDNA
  • reaction products were incubated for 30 minutes at 37 ° C. with proteinase K and the cDNA was precipitated with ethanol.
  • the expression cDNA bank was carried out using the “SMART cDNA Library Construction Kit” from Clontech (USA) according to the manufacturer's instructions.
  • the cloning was carried out into the expression vector pTriplEx2 (Clontech; USA).
  • the expression vectors were electroplated into bacteria of strain E. coli XLl-Blue transformed.
  • the bacteria were plated on LB culture media and incubated for 24 hours at 37 ° C. Replica plating was then carried out by transferring the bacteria to a further culture medium plate using a nitrocellulose filter. The replica plate was again incubated for 24 hours at 37 ° C. and the grown bacterial colonies were transferred to LB liquid medium. After the addition of IPTG (final concentration 0.1 mM), the bacteria were incubated for 4 hours at 37 ° C. on a shaker. The bacteria were harvested by centrifugation and the bacterial mass was resuspended in 0.5 ml digestion buffer (5 mM EDTA, 20 mM Tris-HCL pH 9.0) at 0 ° C. The bacteria were then disrupted using ultrasound.
  • IPTG final concentration 0.1 mM
  • the lysates were incubated at 4 ° C. for 3 hours after the addition of coelenterazines (final concentration 10E-07 M). The bioluminescence was then measured after the addition of calcium chloride (final concentration 20 mM) in the luminometer.
  • a photoprotein was identified.
  • the photoprotein was referred to as berovin, and the photoprotein berovin is shown in detail below.
  • the photoprotein berovin shows the highest homology at the amino acid level to obelin from Obelia longissima with an identity of 29% (shown in Example 5). At the nucleic acid level, the identity is below 30% (shown in Example 6).
  • the BLAST method was used for sequence comparison (Altschul et al., 1997).
  • the invention also relates to functional equivalents of berovin.
  • Functional equivalents are proteins that have comparable physicochemical properties and are at least 70% homologous to SEQ LO NO: 2. A homology of at least 80% or 90% is preferred. A homology of at least 95% is particularly preferred.
  • the photoprotein berovin is suitable as a reporter gene for cellular systems, especially for receptors, for ion channels, for transporters, for transcription factors or for inducible systems.
  • the photoprotein berovin is suitable as a reporter gene in bacterial and eukaryotic systems, especially in mammalian cells, in bacteria, in yeast, in Bakulo, in plants.
  • the photoprotein berovin is suitable as a reporter gene for cellular systems in combination with bioluminescent or chemiluminescent systems, especially systems with luciferases, with oxygenases, with phosphatases.
  • the photoprotein berovin is particularly suitable as a fusion protein for receptors, for ion channels, for transporters, for transcription factors, for proteinases, for kinases, for phosphodiesterases, for hydrolases, for peptidases, for transferases, for membrane proteins, for glycoproteins.
  • the photoprotein berovin is particularly suitable for immobilization by antibodies, by biotin, by magnetic or magnetizable carriers.
  • the photoprotein berovin is suitable as a protein for energy transfer systems, especially FRET (Fluorescence Resonance Energy Transfer), BRET (Bioluminescence Resonance Energy Transfer), FET (field effect transistors), FP (fluorescence polarization), HTRF (Homogeneous time-resolved fluorescence) systems.
  • FRET Fluorescence Resonance Energy Transfer
  • BRET Bioluminescence Resonance Energy Transfer
  • FET field effect transistors
  • FP fluorescence polarization
  • HTRF Homogeneous time-resolved fluorescence
  • the photoprotein berovin is suitable as a label for substrates or ligands especially for proteases, for kinases, for transferases.
  • the photoprotein berovin is suitable for expression in bacterial systems especially for titer determination, as a substrate for biochemical systems especially for proteinases and kinases.
  • the photoprotein berovin is particularly suitable as a marker coupled to antibodies, coupled to enzymes, coupled to receptors, coupled to ion channels and other proteins.
  • the photoprotein berovin is particularly suitable as a reporter gene for pharmacological drug searches in HTS (High Throughput Screening).
  • the photoprotein berovin is suitable as a component of detection systems especially for ELISA (enzyme-linked immunosorbent assay), for immunohistochemistry, for western blot, for confocal microscopy.
  • ELISA enzyme-linked immunosorbent assay
  • the photoprotein berovin is suitable as a marker for the analysis of interactions, especially for protein-protein interactions, for DNA-protein interactions, for DNA-RNA interactions, for RNA-RNA interactions, for RNA-protein interactions (DNA : deoxyribonucleic acid; RNA: ribonucleic acid;).
  • the photoprotein berovin is suitable as a marker or fusion protein for expression in transgenic organisms, especially in mice, in rats, in hamsters and other mammals, in primates, in fish, in worms, in plants.
  • the photoprotein berovin is suitable as a marker or fusion protein for analyzing embryonic development.
  • the photoprotein berovin is suitable as a marker via a coupling mediator, specifically via biotin, via NHS (N-hydroxysulfosuccimide), via CN-Br.
  • the photoprotein berovin is suitable as a reporter coupled to nucleic acids, especially to DNA, to RNA.
  • the photoprotein berovin is suitable as a reporter coupled to proteins or peptides.
  • the photoprotein berovin is suitable as a reporter for measuring intra- or extracellular calcium concentrations.
  • the photoprotein berovin is suitable for the characterization of signal cascades in cellular systems.
  • the photoprotein berovin coupled to nucleic acids or peptides is particularly suitable as a probe for Northern blots, for Southern blots, for Western blots, for ELISA, for nucleic acid sequencing, for protein analysis, chip analysis.
  • the photoprotein berovin is suitable for labeling pharmacological formulations, especially infectious agents, antibodies, and "small molecules”.
  • the photoprotein berovin is suitable for geological investigations especially for ocean, groundwater and river currents.
  • the photoprotein berovin is suitable for expression in expression systems, especially in in vitro translation systems, in bacterial systems, in yeast systems, in Bakulo systems, in viral systems, in eukaryotic systems.
  • the photoprotein berovin is suitable for the visualization of tissues or cells during surgery, especially for invasive, non-invasive, and minimally invasive.
  • the photoprotein berovin is also suitable for marking tumor tissues and other phenotypically modified tissues, especially for histological examinations and surgical interventions.
  • the invention also relates to the purification of the photoprotein berovin, especially as a wild-type protein, as a fusion protein, as a mutagenized protein.
  • the invention also relates to the use of the photoprotein berovin in the field of cosmetics, in particular bath additives, lotions, soaps, body colors, toothpaste, body powders.
  • the invention also relates to the use of the photoprotein berovin for coloring food, bath additives, ink, textiles and plastics.
  • the invention also relates to the use of the photoprotein berovin for coloring paper, especially greeting cards, paper products, wallpapers, handicrafts.
  • the invention also relates to the use of the photoprotein berovin for coloring liquids, especially for water pistols, for fountains, for drinks, for ice.
  • the invention also relates to the use of the photoprotein berovin for the production of toys, especially finger paint, and make-up.
  • the invention relates to nucleic acid molecules which encode the polypeptide disclosed by SEQ JJD NO: 2.
  • the invention relates to the polypeptide with the amino acid sequence disclosed in SEQ LD NO: 2.
  • the invention further relates to nucleic acid molecules selected from the group consisting of
  • nucleic acid molecules encoding a polypeptide which comprises the amino acid sequence disclosed by SEQ LD NO: 2;
  • nucleic acid molecules whose complementary strand hybridizes with a nucleic acid molecule from a) or b) under stringent conditions and which have the biological function of a photoprotein;
  • nucleic acid molecules which differ from those mentioned under c) due to the degeneracy of the genetic code
  • nucleic acid molecules which have a sequence homology of at least 95% to SEQ LD NO: 1 and whose protein product has the biological function of a photoprotein;
  • nucleic acid molecules which have a sequence homology of at least 65% to SEQ LD NO: 1 and whose protein product has the biological function of a photoprotein.
  • the invention also relates to nucleic acid molecules which have a sequence homology of at least 95%, 90%, 85%, 80%, 75%, 70%, 65% or 60% to SEQ JJD NO: 1 and code for a polypeptide which has the properties of a photoprotein.
  • the invention relates to the above-mentioned nucleic acid molecules in which the sequence contains a functional promoter 5 'to the sequence coding for the photoprotein.
  • the invention also relates to nucleic acid molecules as described above, which are part of recombinant DNA or RNA vectors.
  • the invention relates to organisms which contain such a vector.
  • the invention relates to oligonucleotides with more than 10 consecutive nucleotides which are identical or complementary to the DNA or RNA sequence of the berovin molecules or the further molecules according to the invention.
  • the invention relates to photoproteins which are encoded by the nucleotide sequences described above.
  • the invention relates to methods for expressing the photoprotein polypeptides according to the invention in bacteria, eukaryotic cells or in in vitro expression systems.
  • the invention also relates to methods for purifying / isolating a photoprotein polypeptide according to the invention.
  • the invention relates to peptides with more than 5 consecutive amino acids which are recognized immunologically by antibodies against the photoproteins according to the invention.
  • the invention relates to the use of the nucleic acids according to the invention, coding for photoproteins, as marker or reporter genes, in particular for pharmacological search for active substances and diagnostics.
  • the invention relates to the use of the photoproteins according to the invention or a nucleic acid according to the invention coding for a photoprotein as a marker or reporter or as a marker or reporter gene.
  • the invention relates to the use of the photoprotein berovin (SEQ ID NO: 2) or the use of a nucleic acid coding for the photoprotein berovin as a marker or reporter or as a marker or reporter gene, in particular for pharmacological active ingredient search and diagnostics.
  • the invention relates to the use of the nucleic acid shown in SEQ ID NO: 1 as a marker or reporter gene, in particular for pharmacological search for active substances and diagnostics.
  • the invention relates to the use of the peptide shown in SEQ ID NO: 3 and the nucleic acid sequence SEQ JD NO: 1 on which this is based as a marker or reporter gene, in particular for pharmacological search for active substances and diagnostics.
  • the invention also relates to polyclonal or monoclonal antibodies which recognize a polypeptide according to the invention.
  • the invention also relates to monoclonal or polyclonal antibodies which recognize the photoprotein berovin (SEQ JJD NO: 2).
  • Expression refers to the production of a molecule which, after the gene has been introduced into a suitable host cell, allows the transcription and translation of the foreign gene cloned into an expression vector.
  • Expression vectors contain the control signals required for the expression of genes in cells of prokaryotes or eukaryotes.
  • expression vectors can be constructed in two different ways.
  • transcription fusions the protein encoded by the cloned-in foreign gene is synthesized as an authentic, biologically active protein.
  • the expression vector carries all 5 'and 3 "control signals required for expression.
  • the protein encoded by the cloned-in foreign gene is expressed as a hybrid protein together with another protein that can be easily detected.
  • the additionally introduced protein part not only stabilizes the foreign gene cloned in in many cases Coded protein before degradation by cellular proteases, but can also be used for the detection and isolation of the hybrid protein formed.
  • the expression can be both transient and stable. Bacteria, yeasts, viruses and eukaryotic systems are suitable as host organisms.
  • protein purification The isolation of proteins (even after overexpression) is often referred to as protein purification.
  • a variety of established methods and processes are available for protein purification.
  • Solid-liquid separation is a basic operation in protein isolation. Both in the separation of the cells from the culture medium and in the clarification of the crude extract after cell disruption and removal of the cell debris, in the separation of precipitates after precipitation, etc., the process step is necessary. It is done by centrifugation and filtration. The cell wall must be destroyed or made permeable by obtaining intracellular proteins. Depending on the scale and organism, high-pressure homogenizers or agitator ball or glass bead mills are used. Mechanical cell integrations and ultrasound treatment are used on a laboratory scale.
  • Extracellular proteins are obtained in relatively dilute solutions. Like extracellular proteins, they must be concentrated before further use. In addition to the processes already mentioned, ultrafiltration has also proven itself - also on an industrial scale.
  • Inorganic salts as accompanying substances in proteins are often undesirable for specific applications. Among other things, you can removed by gel filtration, dialysis and diafiltration.
  • Numerous proteins are used as dry preparations. Vacuum, freeze and spray drying are important drying methods.
  • the photoprotein berovin is encoded by the following nucleotide sequence (SEQ LD NO: 1):
  • Figure 1 shows the plasmid map of the vector pTriplEX2-Berövin.
  • Figure 2 shows the plasmid map of the vector pcDNA3 -Berovin
  • Figure 3 shows the bioluminescence activity of berovin after bacterial expression.
  • Y RLU: relative light units
  • X dilution
  • black bars berovin
  • gray bars control lysate
  • Figure 4 shows the bioluminescent activity of berovin after expression in CHO cells.
  • Y RLU: relative light units
  • X ATP (logarithmic representation in mol / 1)
  • Figure 7 shows the alignment of berovin and obelin (Obelia longissima) at the amino acid level
  • the plasmid pTriplEx2 from Clontech was used as the vector for producing the construct shown below.
  • the derivative of the vector was named pTriplEx2 berovin.
  • the vector pTriplEx2-berovin was used to express berovin in bacterial systems.
  • FIG. 1 shows the plasmid map of the vector pTriplEX2-berovin.
  • the plasmid pcDNA3.1 (+) from Clontech was used as the vector for producing the construct shown below.
  • the derivative of the vector was named pcDNA3 berovin.
  • the vector pcDNA3 berovin was used to express berovin in eukaryotic systems.
  • FIG. 2 shows the plasmid map of the vector pcDNA3-berovin.
  • Bacterial expression was carried out in E. coli strain BL21 (DE3) by transforming the bacteria with the expression plasmids pTriplEX2 -Berovin and pTriplEX2.
  • the transformed bacteria were incubated in LB medium at 37 ° C. for 3 hours and expression was induced for 4 hours by adding EPTG to a final concentration of 1 mM.
  • the induced bacteria were harvested by centrifugation, resuspended in 50 mM Tris HCl (pH 9.0) + 5 mM EDTA and disrupted by ultrasound. The lysate was then centrifuged for 15 minutes at 13000 revolutions per minute (16000 rcf) and the supernatant was removed.
  • the supernatant (dilutions 1: 5; 1:10; 1:20 and 1:50 with Tris / HCl pH 9.0)) was mixed with coelenterazine (10E-07 M coelenterazine in Tris / HCl pH 9.0) for 3 hours incubated in the dark. Immediately after the addition of 5 mM calcium chloride, the bioluminescence was measured in the luminometer. The integration time of the measurement was 40 seconds.
  • FIG. 3 shows the results of the bioluminescence measurement of berovin in bacteria.
  • the constitutive eukaryotic expression was carried out in CHO cells by transfection of the cells with the expression plasmids pcDNA3-berovin and pcDNA3.1 (+) in transient experiments.
  • 10,000 cells per hole were plated in DMEM-F12 medium on 96-well microtiter plates and incubated at 37 ° C. overnight.
  • the transfection was carried out using the Fugene 6 kit (Röche) according to the manufacturer's instructions.
  • the transfected cells were incubated overnight at 37 ° C in DMEM-F12 medium.
  • the medium was then removed and replaced by 50 ⁇ l of coelenterazine (10E-07 M coelenterazine in PBS).
  • the cells were incubated for 3 hours at 37 ° C. and then ATP (adenosine triphosphate) was added to a final concentration of 1 ⁇ M.
  • the measurement was started immediately after the addition in the luminometer.
  • the integration time was 1 second with a total measurement
  • FIG. 4 shows the results of the bioluminescence measurement of berovin in CHO cells.
  • FIG. 7 shows the alignment of berovin with obelin (Obelia longissima) at the amino acid level.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Biophysics (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Zoology (AREA)
  • Biochemistry (AREA)
  • Toxicology (AREA)
  • General Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Medicinal Chemistry (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Peptides Or Proteins (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)

Abstract

Die Erfindung betrifft das Photoprotein Berovin, dessen Nukleotid- und Aminosäuresequenz, sowie die Aktivität und Verwendung des Photoproteins Berovin.

Description

Isoliertes Photoprotein Berovin, sowie dessen Verwendung
Die Erfindung betrifft das Photoprotein Berovin, dessen Nukleotid- und Arninosäuresequenz, sowie die Aktivität und Verwendung des Photoproteins Berovin.
Photoproteine Als Biolumineszenz bezeichnet man das Phänomen der Lichterzeugung durch Lebewesen. Sie ist das Ergebnis von biochemischen Reaktionen in Zellen, bei denen die chemische Energie in Form von Lichtquanten abgegeben wird (sog. kalte Emission durch Chemolumineszenz). Derartig erzeugtes Licht ist monochromatisch, denn es wird bei einem diskreten Elektronen-Übergang abgestrahlt, kann aber durch sekundäre Leuchtfarbstoffe (z.B. fluoreszierende Proteine bei .Leuchtquallen der Gattung Aequora) in längerwellige Spektralbereiche verschoben werden.
Die biologische Funktion ist vielfältig: In der Meerestiefe zwischen 200 und 1000 m (Mesopelagial) leuchten rund 90 % aller Lebewesen. Die Leuchtsignale werden hier zur Partnerwerbung, Täuschung und als Köder eingesetzt. Auch Glühwürmchen und Leuchtkäfer nutzen die Lichtsignale zur Partnersuche. Die Bedeutung des Leuchtens von Bakterien, Pilzen und einzelligen Algen ist dagegen unklar. Es wird vermutet, dass es zur Koordination von vielen , Einzel-Individuen einer großen Population eingesetzt wird oder eine Art biologische Uhr darstellt.
Eine Vielzahl an Coelenteraten ist biolumineszent (Morin et al., 1974). Diese Organismen
* emittieren blaues oder grünes Licht. Das 1962 als erstes Licht produzierendes Protein identifizierte Aequorin aus Aequoria victoria (Shimomura et al., 1969) emittierte als isoliertes Protein ein blaues Licht und nicht grünes Licht wie phänotypisch beobachtet bei Aequoria victoria. Später konnte das grün fluoreszierende Protein (GFP) aus Aequoria victoria isoliert werden, das aufgrund der Anregung durch das Aequorin die Meduse phänotypisch grün erscheinen lässt (Johnson et al., 1962; Hastings et al., 1969; Inouye et al., 1994). Als weitere Photoproteine konnten noch Clytin (Inouye et al., 1993), Mitrocomin (Fagan et al., 1993) und Obelin (Illarionov et al., 1995) identi- fiziert und beschrieben werden. Tabelle 1: Übersicht über einige Photoproteine. Angegeben sind der Name, der Organismus aus dem das Protein isoliert worden ist und die Identifikationsnummer (Acc. No.) des Datenbankeintrages.
Tabelle 2: Übersicht über einige Photoproteine. Angegeben sind der Organismus aus dem das Protein isoliert worden ist, der Name des Photoproteins und eine Auswahl an Patenten bzw. Anmeldungen.
Biolumineszenz wird heute in der Technik vielfältig genutzt, z.B. in Form von Bio-Indikatoren für Umweltverschmutzung oder in der Biochemie zum empfindlichen Nachweis von Proteinen, zur Quantifizierung bestimmter Verbindungen oder als sogenannte "Reporter" bei der Untersuchung zellulärer Gen-Regulation.
Die Photoproteine unterscheiden sich nicht nur aufgrund ihrer Nukleotid- und Arninosäuresequenz, sondern auch aufgrund ihrer biochemischen und physikalischen Eigenschaften. Es konnte gezeigt werden, dass durch die Veränderung der Aminosäuresequenz von Photoproteinen die physikalischen und biochemischen Eigenschaften verändert werden können. Beispiele von mutagenisierten Photoproteinen sind in der Literatur beschrieben (US 6,495,355; US 5,541,309; US 5,093,240; Shimomura et al., 1986).
Die Lichterzeugung durch die oben genannten Photoproteine erfolgt durch die Oxidation von Coelenterazin (Haddock et al., 2001; Jones et al., 1999).
Reportersysteme
Als Reporter- oder Indikatorgen bezeichnet man generell Gene, deren Genprodukte sich mit Hilfe einfacher biochemischer oder histochemischer Methoden leicht nachweisen lassen. Man unterscheidet mindestens 2 Typen von Reportergenen.
1. Resistenzgene. Als Resistenzgene werden Gene bezeichnet, deren Expression einer Zelle die Resistenz gegen Antibiotika oder andere Substanzen verleiht, deren Anwesenheit im Wachstumsmedium zum Zelltod führt, wenn das Resistenzgen fehlt.
2. Reportergene. Die Produkte von Reportergenen werden in der Gentechnologie als fusionierte oder unfusionierte Indikatoren verwendet. Zu den gebräuchlichsten Reportergenen gehört die beta-Galaktosidase (Alam et al., 1990), alkalische Phosphatase (Yang et al., 1997; Cullen et al., 1992), Luciferasen und andere Photoproteine (Shinomura, 1985; Phillips GN, 1997; Snowdowne et al., 1984).
Als Lumineszenz bezeichnet man die Abstrahlung von Photonen im sichtbaren Spektralbereich, wobei diese durch angeregte Emittermoleküle erfolgt. Im Unterschied zur Fluoreszenz wird hierbei die Energie nicht von Außen in Form von Strahlung kürzerer Wellenlänge zugeführt.
Man unterscheidet Chemolumineszenz und Biolumineszenz. Als Chemolumineszenz bezeichnet man eine chemische Reaktion die zu einem angeregten Molekül führt, das selbst leuchtet, wenn die angeregten Elektronen in den Grundzustand zurückkehren. Wird diese Reaktion durch ein Enzym katalysiert, spricht man von Biolumineszenz. Die an der Reaktion beteiligten Enzyme werden generell als Luziferasen bezeichnet.
Einordung der Spezies Beroe abyssicola
Eumetazoa → Ctenophora → Cyclocoela → Beroida → Beroe abyssicola
Die Spezies Beroe abyssicola gehört zu den Cnidaria, speziell zu den Medusen. Isolierung der cDNA
Zur Untersuchung der Biolumineszenz-Aktivität der Spezies Beroe abyssicola wurden Exemplare im Weißen Meer (Biologische Station Kartesh, Russland) gefangen und in flüssigem Stickstoff gelagert. Zur Erstellung der cDNA-Bibliotheken von Beroe abyssicola, wurde die poly(a)+ RNA mit Hilfe der „Straight A" Isolationsmethode von Novagen (USA) isoliert.
Zur Herstellung der cDNA wurde eine RT-PCR durchgeführt. Hierzu wurden 1 μg RNA mit Reverser Transkriptase (Superscribt Gold LT) nach folgendem Schema inkubiert:
PCR 1. 30 Sekunden 95°C 2. 6 Minuten 68°C 3. 10 Sekunden 95°C 4. 6 Minuten 68°C 17 Zyklen von Schritt 4 nach Schritt 3
Die Reaktionsprodukte wurden zur Inaktivierung der Polymerase für 30 Minuten bei 37°C mit Proteinase K inkubiert und die cDNA mit Ethanol präzipitiert. Die Expression-cDNA Bank wurde mit Hilfe des „SMART cDNA Library Construction Kits" der Firma Clontech (USA) nach Herstellerangaben durchgeführt. Die Klonierung erfolgte in den Expressionsvektor pTriplEx2 (Clontech; USA). Die Expressionsvektoren wurden durch Elektroporation in Bakterien des Stammes E. coli XLl-Blue transformiert.
Die Bakterien wurden auf LB-Nährböden plattiert und für 24 Stunden bei 37°C inkubiert. Anschließend wurde eine Replikaplattierung durchgeführt, indem die Bakterien mit Hilfe eines Nitrocellulosefilters auf eine weitere Nährbodenplatte übertragen wurde. Die Replikaplatte wurde wiederum für 24 Stunden bei 37°C inkubiert und die gewachsenen Bakterienkolonien in LB- Flüssigmedium übertragen. Nach der Zugabe von IPTG (Endkonzentration 0,1 mM) wurden die Bakterien für 4 Stunden bei 37°C auf einem Schüttler inkubiert. Die Bakterien wurden durch Zentrifugation geerntet und die Bakterienmasse in 0,5 ml Aufschlusspuffer (5 mM EDTA, 20 mM Tris-HCL pH 9,0) bei 0°C resuspendiert. Anschließend erfolgte der Aufschluss der Bakterien durch Ultraschall.
Die Lysate wurden nach der Zugabe von Coelenterazine (Endkonzentration 10E-07 M) bei 4°C für 3 Stunden inkubiert. Anschließend erfolgte die Messung der Biolumineszenz nach der Zugabe von Calziurnchlorid (Endkonzentration 20 mM) im Luminometer.
Es wurde ein Photoprotein identifiziert. Das Photoprotein wurde als Berovin bezeichnet, hn Folgenden wird das Photoprotein Berovin im einzelnen dargestellt. Berovin
Das Photoprotein Berovin zeigt die höchste Homologie auf A inosäureebene zu Obelin aus Obelia longissima mit einer Identität von 29 % (gezeigt in Beispiel 5). Auf Nukleinsäureebene liegt die Identität unter 30 % (gezeigt in Beispiel 6). Zum Sequenzvergleich wurde das BLAST- Verfahren verwendet (Altschul et al., 1997).
Die biolumineszenten Eigenschaften von Beroe species wurden schon zuvor phänomenologisch beschrieben (Ward et al., 1974; Ward et al. 1975).
Die Erfindung betrifft auch funktionelle Äquivalente von Berovin. Funktionelle Äquivalente sind solche Proteine, die vergleichbare physikochemische Eigenschaften haben und mindestens 70 % homolog sind zu SEQ LO NO: 2. Bevorzugt ist eine Homologie von mindestens 80 % oder 90 %. Besonders bevorzugt ist eine Homologie von mindestens 95 %.
Das Photoprotein Berovin eignet sich als Reportergen für zelluläre Systeme speziell für Rezeptoren, für Ionenkanäle, für Transporter, für Transkriptionsfaktoren oder für induzierbare Systeme.
Das Photoprotein Berovin eignet sich als Reportergen in bakteriellen und eukaryotischen Systemen speziell in Säugerzellen, in Bakterien, in Hefen, in Bakulo, in Pflanzen.
Das Photoprotein Berovin eignet sich als Reportergen für zelluläre Systeme in Kombination mit biolumineszenten oder chemolumineszenten Systemen speziell Systemen mit Luziferasen, mit Oxygenasen, mit Phosphatasen.
Das Photoprotein Berovin eignet sich als Fusionsprotein speziell für Rezeptoren, für Ionenkanäle, für Transporter, für Transkriptionsfaktoren, für Proteinasen, fürKinasen, für Phosphodiesterasen, für Hydrolasen, für Peptidasen, für Transferasen, für Membranproteine, für Glykoproteine.
Das Photoprotein Berovin eignet sich zur Immobilisierung speziell durch Antikörper, durch Biotin, durch magnetische oder magnetisierbare Träger.
Das Photoprotein Berovin eignet sich als Protein für Systeme des Energietransfers speziell der FRET- (Fluorescence Resonance Energy Transfer), BRET- (Bioluminescence Resonance Energy Transfer), FET (field effect transistors), FP (fluorescence polarization), HTRF (Homogeneous time-resolved fluorescence) Systemen.
Das Photoprotein Berovin eignet sich als Markierung von Substraten oder Liganden speziell für Proteasen, für Kinasen, für Transferasen. Das Photoprotein Berovin eignet sich zur Expression in bakteriellen Systemen speziell zur Titerbestirnmung, als Substrat für biochemische Systeme speziell für Proteinasen und Kinasen.
Das Photoprotein Berovin eignet sich als Marker speziell gekoppelt an Antikörper, gekoppelt an Enzyme, gekoppelt an Rezeptoren, gekoppelt an Ionenkanäle und andere Proteine.
Das Photoprotein Berovin eignet sich als Reportergen bei der pharmakologischen Wirkstoffsuche speziell im HTS (High Throughput Screening).
Das Photoprotein Berovin eignet sich als Komponente von Detektionssystemen speziell für ELISA (enzyme-linked immunosorbent assay), für Irnmunohistochemie, für Western-Blot, für die konfokale Mikroskopie.
Das Photoprotein Berovin eignet sich als Marker für die .Analyse von Wechselwirkungen speziell für Protein-Protein-Wechselwirkungen, für DNA-Protein-Wechselwirkungen, für DNA-RNA- Wechselwirkungen, für RNA-RNA- Wechselwirkungen, für RNA-Protein-Wechselwirkungen (DNA: desoxyribonucleic acid; RNA: ribonucleic acid; ).
Das Photoprotein Berovin eignet sich als Marker oder Fusionsprotein für die Expression in transgenen Organismen speziell in Mäusen, in Ratten, in Hamstern und anderen Säugetieren, in Primaten, in Fischen, in Würmern, in Pflanzen.
Das Photoprotein Berovin eignet sich als Marker oder Fusionsprotein zur Analyse der Embryonalentwicklung.
Das Photoprotein Berovin eignet sich als Marker über einen Kopplungsvermittler speziell über Biotin, über NHS (N-hydroxysulfosuccimide), über CN-Br.
Das Photoprotein Berovin eignet sich als Reporter gekoppelt an Nukleinsäuren speziell an DNA, an RNA.
Das Photoprotein Berovin eignet sich als Reporter gekoppelt an Proteine oder Peptide.
Das Photoprotein Berovin eignet sich als Reporter zur Messung von intra- oder extrazellulären Calziumkonzentrationen.
Das Photoprotein Berovin eignet sich zur Charakterisierung von Signalkaskaden in zellulären Systemen. Das an Nukleinsäuren oder Peptiden gekoppelte Photoprotein Berovin eignet sich als Sonde speziell für Northern-Blots, für Southern-Blots, für Western-Blots, für ELISA, für Nuklein- säuresequenzierungen, für Proteinanalysen, Chip-Analysen.
Das Photoprotein Berovin eignet sich Markierung von pharmakologischen Formulierungen speziell von infektiösen Agentien, von Antikörpern, von „small molecules".
Das Photoprotein Berovin eignet sich für geologische Untersuchungen speziell für Meeres-, Grundwasser- und Flussströmungen.
Das Photoprotein Berovin eignet sich zur Expression in Expressionssystemen speziell in in-vitro Translationssystemen, in bakteriellen Systemen, in Hefe Systemen, in Bakulo Systemen, in viralen Systemen, in eukaryotischen Systemen.
Das Photoprotein Berovin eignet sich zur Visualisierung von Geweben oder Zellen bei chirurgischen Eingriffen speziell bei invasiven, bei nicht-invasiven, bei minimal-invasiven.
Das Photoprotein Berovin eignet sich auch zur Markierung von Tumorgeweben und anderen phänotypisch veränderten Geweben speziell bei der histologischen Untersuchung, bei operativen Eingriffen.
Die Erfindung betrifft auch die Reinigung des Photoprotein Berovin speziell als wildtyp Protein, als Fusionsprotein, als mutagenisiertes Protein.
Die Erfindung betrifft auch die Verwendung des Photoprotein Berovin auf dem Gebiet der Kosmetik speziell von Badezusätzen, von Lotionen, von Seifen, von Körperfarben, von Zahn- creme, von Körperpudern.
Die Erfindung betrifft auch die Verwendung des Photoprotein Berovin zur Färbung speziell von Nahrungsmitteln, von Badezusätzen, von Tinte, von Textilien, von Kunststoffen.
Die Erfindung betrifft auch die Verwendung des Photoprotein Berovin zur Färbung von Papier speziell von Grußkarten, von Papierprodukten, von Tapeten, von Bastelartikeln.
Die Erfindung betrifft auch die Verwendung des Photoprotein Berovin zur Färbung von Flüssigkeiten speziell für Wasserpistolen, für Springbrunnen, für Getränke, für Eis.
Die Erfindung betrifft auch die Verwendung des Photoprotein Berovin zur Herstellung von Spielwaren speziell von Fingerfarbe, von Schminke. Die Erfindung betrifft Nukleinsäuremoleküle, die das Polypeptid offenbart durch SEQ JJD NO: 2 kodieren.
Die Erfindung betrifft das Polypeptid mit der Aminosäuresequenz, die in SEQ LD NO: 2 offenbart ist.
Die Erfindung bezieht sich des weiteren auf Nukleinsäuremoleküle, ausgewählt aus der Gruppe bestehend aus
a) Nukleinsäuremolekülen, die ein Polypeptid kodieren, welches die Aminosäuresequenz offenbart durch SEQ LD NO: 2 umfasst;
b) Nukleinsäuremolekülen, welche die durch SEQ JJD NO: 1 dargestellte Sequenz enthalten;
c) Nukleinsäuremolekülen, deren komplementärer Strang mit einem Nukleinsäuremolekül aus a) oder b) unter stringenten Bedingungen hybridisiert und welche die biologische Funktion eines Photoproteins aufweisen;
Eine stringente Hybridisierung von Nukleinsäuremolekülen kann zum Beispiel in einer wässrigen Lösung, die 0,2 x SSC (lx Standard saline-citrate = 150 mM NaCl, 15 mM Trinatriumcitrat) enthält, bei 68°C durchgeführt werden (Sambrook et al., 1989).
d) Nukleinsäuremolekülen, welche sich auf Grund der Degenerierung des genetischen Kodes von den unter c) genannten unterscheiden;
e) Nukleinsäuremolekülen, welche eine Sequenzhomologie von mindestens 95 % zu SEQ LD NO: 1 zeigen, und deren Proteinprodukt die biologische Funktion eines Photoproteins aufweist; und
f) Nukleinsäuremolekülen, welche eine Sequenzhomologie von mindestens 65 % zu SEQ LD NO: 1 zeigen, und deren Proteinprodukt die biologische Funktion eines Photoproteins aufweist.
Die Erfindung betrifft auch Nukleinsäuremoleküle, die eine Sequenzhomologie von mindestens 95 %, 90 %, 85 %, 80 %, 75 %, 70 %, 65 % oder 60 % zu SEQ JJD NO:l aufweisen und für ein Polypeptid kodieren, welches die Eigenschaften eines Photoproteins besitzt.
Die Erfindung betrifft die oben genannten Nukleinsäuremoleküle, bei denen die Sequenz einen funktionalen Promotor 5' zu der das Photoprotein kodierenden Sequenz enthält. Die Erfindung betrifft auch Nukleinsäuremoleküle wie vorhergehend beschrieben, die Bestandteil von rekombinanten DNA oder RNA Vektoren sind.
Die Erfindung betrifft Organismen, die einen solchen Vektor enthalten.
Die Erfindung bezieht sich auf Oligonukleotide mit mehr als 10 aufeinanderfolgenden Nukleo- tiden, die identisch oder komplementär zur DNA oder RNA Sequenz der Berovin Moleküle oder der weiteren erfindungsgemäßen Molekülen sind.
Die Erfindung betrifft Photoproteine, die durch die vorhergehend beschriebenen Nukleotid- sequenzen kodiert sind.
Die Erfindung bezieht sich auf Verfahren zur Expression der erfindungsgemäßen Photoprotein Polypeptide in Bakterien, eukaryontischen Zellen oder in in vitro Expressionssystemen.
Die Erfindung betrifft auch Verfahren zur Aufreinigung/Isolierung eines erfindungsgemäßen Photoprotein Polypeptides.
Die Erfindung bezieht sich auf Peptide mit mehr als 5 aufeinanderfolgenden Aminosäuren, die immunologisch durch Antikörper gegen die erfindungsgemäßen Photoproteine erkannt werden.
Die Erfindung betrifft die Verwendung der erfindungsgemäßen, für Photoproteine kodierende Nukleinsäuren als Marker- oder Reportergene, insbesondere für die pharmakologische Wirkstoffsuche und Diagnostik.
Die Erfindung betrifft die Verwendung der erfindungsgemäßen Photoproteine bzw. eine erfindungsgemäße, für ein Photoprotein kodierende Nukleinsäure als Marker oder Reporter bzw. als Marker- oder Reportergen.
Die Erfindung betrifft die Verwendung des Photoproteins Berovin (SEQ ID NO: 2) bzw. die Verwendung einer für das Photoprotein Berovin kodierenden Nukleinsäure als Marker oder Reporter bzw. als Marker oder Reportergen insbesondere für die pharmakologische Wirkstoffsuche und Diagnostik.
Die Erfindung betrifft die Verwendung der in SEQ ID NO: 1 dargestellten Nukleinsäure als Marker- oder Reportergen, insbesondere für die pharmakologische Wirkstoffsuche und Diagnostik.
Die Erfindung betrifft die Verwendung das in SEQ ID NO: 3 dargestellte Peptid und die hierzu zugrundeliegende Nukleinsäuresequenz SEQ JD NO: 1 als Marker- oder Reportergen, insbesondere für die pharmakologische Wirkstoffsuche und Diagnostik. Gegenstand der Erfindung sind auch polyklonale oder monoklonale Antikörper, welche ein erfindungsgemäßes Polypeptid erkennen.
Die Erfindung betrifft auch monoklonale oder polyklonale Antikörper, die das Photoprotein Berovin (SEQ JJD NO: 2) erkennen.
Expression der erfindungsgemäßen Photoproteine
Als Expression bezeichnet man die Produktion eines Moleküls, das nach dem Einbringen des Gens in eine geeignete Wirtszelle die Transkription und Translation des in einen Expressionsvektor klonierte Fremdgen erlaubt. Expressionsvektoren enthalten die für die Expression von Genen in Zellen von Prokaryonten oder Eukaryonten erforderlichen Kontrollsignale.
Expressionsvektoren können prinzipiell auf zwei verschiedene Weisen konstruiert werden. Bei den sogenannten Transkriptionsfusionen wird das vom einklonierten Fremdgen codierte Protein als authentisches, biologisch aktives Protein synthetisiert. Der Expressionsvektor trägt hierzu alle zur Expression benötigten 5'- und 3"- Kontrollsignale.
Bei den sogenannten Translationsfusionen wird das vom einklonierten Fremdgen codierte Protein als Hybridprotein zusammen mit einem anderen Protein exprimiert, das sich leicht nachweisen lässt. Die zur Expression benötigten 5λ- und 3"- Kontrollsignale inklusive des Startcodons und eventuell ein Teil der für die N-terminalen Bereiche des zu bildenden Hybridproteins codierenden Sequenzen stammen vom Vektor. Der zusätzlich eingeführte Proteinteil stabilisiert nicht nur in vielen Fällen das vom einklonierten Fremdgen codierte Protein vor dem Abbau durch zelluläre Proteasen, sondern lässt sich auch zum Nachweis und zur Isolierung des gebildeten Hybridproteins einsetzen. Die Expression kann sowohl transient als auch stabil erfolgen. Als Wirtsorganismen eignen sich sowohl Bakterien, Hefen, Viren als auch eukaryotische Systeme.
Reinigung der erfindungsgemäßen Photoproteine
Die Isolierung von Proteinen (auch nach Überexpression) wird häufig als Proteinreinigung bezeichnet. Zur Proteinreinigung steht eine Vielzahl an etablierten Methoden und Verfahren zur Verfügung.
Die Fest-Flüssig-Trennung ist eine Grundoperation bei Proteinisolierungen. .Sowohl bei der Abtrennung der Zellen vom Kulturmedium als auch bei der Klärung des Rohextraktes nach Zellaufschluss und Entfernung der Zelltrümmer, bei der Abtrennung von Niederschlägen nach Fällungen usw. ist der Verfahrensschritt erforderlich. Er erfolgt durch Zentrifugation und Filtration. Durch Gewinnung intrazellulärer Proteine muss die Zellwand zerstört bzw. durchlässig gemacht werden. Je nach Maßstab und Organismus werden dazu Hochdruckhomogenisatoren oder Rührwerkskugel- bzw. Glasperlenmühlen eingesetzt. Im Labormaßstab kommen u.a. mechanische Zellintegrationen und Ultraschallbehandlung zum Einsatz.
Sowohl für extrazelluläre als auch intrazelluläre Proteine (nach Zellaufschluss) sind verschiedene Fällungsverfahren mit Salzen (insbesondere Ammoniumsulfat) oder organischen Lösungsmitteln (Alkohole, Aceton) eine schnelle und effiziente Methode zur Konzentration von Proteinen. Bei der Reinigung intrazellulärer Proteine ist die Entfernung der löslichen Nukleinsäuren erstrebenswert (Fällung z.B. mit Streptomycin- oder Protaminsulfat). Bei der Gewinnung' extrazellulärer Proteine werden häufig Träger (z.B. Stärke, Kieselgur) vor Zugabe der Fällungsmittel zugesetzt, um besser handhabbare Niederschläge zu erhalten.
Für die Feinreinigung stehen zahlreiche chromatographische und Verteilungsverfahren zur Verfügung (Absorptions- und Ionenaustauschchromatographie, Gelfiltration, Affinitätschromatographie, Elektrophoresen). Eine Säulenchromatographie wird auch im technischen Maßstab angewandt. Für den Labormaßstab ist vor allem die Affinitätschromatographie von Bedeutung, die Reinigungsfaktoren bis zu mehreren 100 pro Schritt ermöglicht.
Extrazelluläre Proteine fallen in relativ verdünnten Lösungen an. Sie müssen ebenso wie extrazelluläre Proteine vor ihrer weiteren Verwendung konzentriert werden. Neben den schon erwähnten Verfahren hat sich - auch im industriellen Maßstab - die Ultrafiltration bewährt.
Anorganische Salze als Begleitstoffe von Proteinen sind für spezifische Anwendungen häufig unerwünscht. Sie können u.a. durch Gelfiltration, Dialyse und Diafiltration entfernt werden.
Zahlreiche Proteine kommen als Trockenpräparate zum Einsatz. Als Trocknungsverfahren sind die Vakuum-, Gefrier- und Sprühtrocknung von Bedeutung.
Nukleotid- und Aminosäuresequenzen
Das Photoprotein Berovin wird durch die folgende Nukleotidsequenz kodiert (SEQ LD NO: 1):
GAGTTTTAAACTTTATACAACACTACTTTATAAAATCTAATTTGAGCCAATCAAAATG ACTGAACGTCTGAACGAGCAGAACAACGAGAGTTACCGCTACCTGAGAAGCGTGGGA AACCAGTGGCAGTTCAACGTAGAGGACCTCCACCCCAAGATGTTGTCCCGTCTCTACA AGAGATTCGATACTTTCGATCTAGACAGTGACGGTAAGATGGAGATGGACGAGGTCTT GTACTGGCCCGACAGGATGAGGCAGCTGGTAAACGCTACTGATGAGCAGGTTGAGAA GATGCGGGATGCTGTGAGAGTTTTCTTTTTGCACAAGGGAGTGGAGCCAGTAAACGGT CTCCTCAGAGAGGACTGGGTGGAAGCTAACAGAGTCTTCGCTGAGGCTGAGAGAGAA AGAGAGCGACGAGGAGAACCTTCTCTTATCGCACTTCTCTCCAACTCTTACTACGATG TACTGGATGATGACGGTGATGGTACTGTTGACGTCGATGAATTAAAGACCATGATGAA AGCATTTGATGTGCCCCAGGAAGCTGCCTACACCTTCTTCGAGAAGGCAGACACTGAC AAGAGTGGAAAGTTGGAGAGAACAGAACTAGTTCATCTCTTTAGAAAGTTTTGGATGG AGCCTTACGATCCACAGTGGGACGGAGTCTACGCTTATAAGTACTAATAAATTATCGG ATCCAGAACAAACGGCAAGAACTATTTTACACTCCACTTCAATTATAAACGATGATTT CATCGTTTCATGAAAACAAATTTTAGCATAAAACAATAAACATTTTCGACTACTAAAA TTACAGTCAACATAAAAATTTTAAAGTGTGTGATAAATTTTTCTGAATGTCTCCTAACT TCGATAATAATCTTCAAACTTTTAGTCAATATATGGAAATAAAAATATTTTGGTTTGAT GAGATGATAAAACTTTTGTTTTAAATTTTAGTTGGAGTAATTCATTGAATATGAAATG GACTTCGGACAATTACCCTGGCCTTCTGTATATTTAAAGCATGCTTTCCGTCAATAATT TGTTGTATCTATGTATTTATTTGTACATTAATTTAACCATATAGAATTATCTGTATAAT CCCTGTTATATTTATACACTGCATTACAAAA-AAAAAAAAAAAAAAAAAAAAAAAAAA
Daraus ergibt sich eine Aminosäuresequenz von (SEQ ID NO: 2):
MTERLNEQNNESYRYLRSVGNQWQFNVEDLHPKMLSRLYKRFDTFDLDSDGKMEMDEV LYWPDP RQLVNATDEQVEK VLRDAVRVFFLHKGVEPVNGLLREDWVEANRVFAEAER
ERERRGEPSLIALLSNSYYDVLDDDGDGTVDVDELKTMMKAFDVPQEAAYTFFEKADTD KSGKLERTELVΉLFRKFWMEPYDPQWDGVYAYKY
Diese Sequenzen finden sich im Sequenzlisting wieder. Kurze Beschreibung der Figuren
Figur 1 : Die Figur 1 zeigt die Plasmidkarte des Vektors pTriplEX2-Berövin.
Figur 2: Die Figur 2 zeigt die Plasmidkarte des Vektors pcDNA3 -Berovin
Figur 3: Die Fig. 3 zeigt die Biolumineszenzaktivität von Berovin nach bakterieller Expression. (Y = RLU : relative light units; X = Verdünnung; schwarze Balken = Berovin; graue Balken = Kontrolllysat)
Figur 4: Die Fig. 4 zeigt die Biolumineszenzaktivität von Berovin nach Expression in CHO Zellen. (Y = RLU : relative light units; X = ATP (logarithmische Darstellung in mol/1))
Figur 5: Die Fig. 5 zeigt die kinetische Analyse der Biolumineszenz von Berovin. (Y = RLU : relative light units; X = Zeit [Sekunden]).
Figur 6: Die Fig. 6 zeigt die kinetische Analyse der Biolumineszenz von Obelin. (Y = RLU : relative light units; X = Zeit [Sekunden])
Figur 7 : Die Figur 7 zeigt das Alignment von Berovin und Obelin (Obelia longissima) auf Aminosäureebene
Beispiele
Beispiel 1
Als Vektor zur Herstellung des im folgenden dargestellten Konstruktes wurde das Plasmid pTriplEx2 der Firma Clontech verwendet. Das Derivat des Vektors wurde als pTriplEx2 -Berovin bezeichnet. Der Vektor pTriplEx2-Berovin wurde zur Expression von Berovin in bakteriellen Systemen verwendet.
Die Figur 1 zeigt die Plasmidkarte des Vektors pTriplEX2-Berovin .
Beispiel 2
Als Vektor zur Herstellung des im folgenden dargestellten Konstruktes wurde das Plasmid pcDNA3.1(+) der Firma Clontech verwendet. Das Derivat des Vektors wurde als pcDNA3- Berovin bezeichnet. Der Vektor pcDNA3 -Berovin wurde zur Expression von Berovin in eukaryotischen Systemen verwendet.
Die Figur 2 zeigt die Plasmidkarte des Vektors pcDNA3-Berovin .
Beispiel 3
Bakterielle Expression
Die bakterielle Expression erfolgte im E. coli Stamm BL21(DE3) durch Transformation der Bakterien mit den Expressionsplasmiden pTriplEX2 -Berovin und pTriplEX2. Die transformierten Bakterien wurden in LB-Medium bei 37°C für 3 Stunden inkubiert und die Expression für 4 Stunden durch Zugabe von EPTG bis zu einer Endkonzentration von 1 mM induziert. Die induzierten Bakterien wurden durch Zentrifugation geerntet, in 50 mM Tris HCl (pH 9,0) + 5 mM EDTA resuspendiert und durch Ultraschall aufgeschlossen. Das Lysat wurde anschliessend für 15 Minuten bei 13000 Umdrehungen pro Minute (16000 rcf) zentrifugiert und der Überstand abgenommen. Der Überstand (Verdünnungen 1:5; 1:10; 1:20 und 1:50 mit Tris/HCl pH 9,0)) wurde 3 Stunden mit Coelenterazin (10E-07 M Coelenterazin in Tris/HCl pH 9,0) im dunkeln inkubiert. Direkt nach der Zugabe von 5 mM Calziumchlorid wurde die Biolumineszenz im Luminometer gemessen. Die Integrationszeit der Messung betrug 40 Sekunden.
Die Figur 3 zeigt die Ergebnisse der Biolumineszenzmessung von Berovin in Bakterien. Beispiel 4
Eukaryotische Expression
Die konstitutive eukaryotische Expression erfolgte in CHO-Zellen durch Transfektion der Zellen mit den Expressionsplasmiden pcDNA3-Berovin und pcDNA3.1(+) in transienten Experimenten. Hierzu wurden 10000 Zellen pro Loch in DMEM-F12 Medium auf 96 Loch Mikrotiterplatten plattiert und über Nacht bei 37°C inkubiert. Die Transfektion erfolgte mit Hilfe des Fugene 6 Kits (Röche) nach Herstellerangaben. Die transfizierten Zellen wurden über Nacht bei 37°C in DMEM- F12 Medium inkubiert. Anschhessend wurde das Medium entfernt und durch 50 μl Coelenterazin (10E-07 M Coelenterazin in PBS) ersetzt. Die Zellen wurden für 3 Stunden bei 37 °C inkubiert und anschhessend ATP (Adenosintriphosphat) bis zu einer Finalkonzentration von 1 μM zugegeben. Die Messung wurde direkt nach der Zugabe im Luminometer gestartet. Die Integrationszeit betrug 1 Sekunde, bei einer Gesamtmessdauer von 60 Sekunden.
Die Figur 4 zeigt die Ergebnisse der Biolumineszenzmessung von Berovin in CHO Zellen.
Beispiel 5
Ergebnis einer BLAST- Analyse von Berovin auf der Aminosäureebene:
>pdb|UF2|A Chain A, Crystal Structure Of W92f Obelin Mutant FromObelia Longissima At 1.72 Angstrom Resolution, Length = 195, Score = 82.4 bits (202), Expect = 4e-15, Identities = 52/177 (29%), Positives = 88/177 (49%) , Gaps = 4/177 (2%)
>emb| CAD87675.1 | unnamed protein product [synthetic construct] , Length = 195, Score = 82.0 bits (201), Expect = 6e-15, Identities = 52/177 (29%) , Positives = 88/177 (49%) , Gaps = 4/177 (2%)
>emb| CAD87673.1 | unnamed protein product [synthetic construct], Length = 195, Score = 82.0 bits (201), Expect = 6e-15, Identities = 52/177 (29%) , Positives = 88/177 (49%) , Gaps = 4/177 (2%)
>emb| CAD87672.1 | unnamed protein product [synthetic construct], Length = 195, Score = 82.0 bits (201), Expect = 6e-15, Identities = 52/177 (29%) , Positives = 88/177 (49%) , Gaps = 4/177 (2%)
>emb | CAD87671.11 unnamed protein product [Obelia longissima], Length = 195, Score = 82.0 bits (201), Expect = 6e-15, Identities = 52/177 (29%) , Positives = 88/177 (49%) , Gaps = 4/177 (2%) Beispiel 6
Ergebnis einer BLAST-Analyse von Berovin auf Nukleinsäureebene :
>emb|AL162584.9| Human DNA sequence from clone RP11-12A16 on chromosome 9, complete sequence, Length = 160178, Score = 50.7 bits (26), Expect = 7e-04, Identities = 28/29 (96%)
>gb|BC044324.l| Xenopus laevis, clone MGC: 52816 IMAGE : 724996, mRNA, complete cds , Length = 2718, Score = 44.9 bits (23), Expect = 0.040, Identities = 25/26 (96%)
>emb|AJ298151.1 |XLA298151 Xenopus laevis mRNA for beta-a yloid precursor protein B (app gene) , Length = 2740, Score = 44.9 bits (23) , Expect = 0.040
Identities = 25/26 (96%)
>emb|AL139825.14 | Human DNA sequence from clone RP11-467D7 on chromosome 20. Contains a novel gene, ESTs, STSs and GSSs, complete sequence, Length = 37526, Score = 44.9 bits (23), Expect = 0.040, Identities = 27/29 (93%)
>gb|U50135.l| Caenorhabditis elegans cosmid C52E12, complete sequence, Length = 40420, Score = 44.9 bits (23), Expect = 0.040, Identities = 25/26 (96%)
>gb|AC126802.4 | Mus musculus chromosome 5 clone RP24-543J12, complete sequence, Length = 321487615, Score = 43.0 bits (22), Expect = 0.15, Identities = 30/34 (88%)
Beispiel 7
Die Figur 7 zeigt das Alignment von Berovin mit Obelin (Obelia longissima) auf Aminosäureebene.
Beispiel 8
Kinetische Analyse von Berovin
Zur kinetischen Analyse der Biolumineszenz von Berovin, wurden CHO Zellen mit pcDNA3- Berovin bzw. pcDNA-Obelin oder pcDNA3 (ohne integrierte cDNA) transient transifiziert. Die Transfektion und Messung erfolgte wie unter Beispiel 4 beschrieben. Die Messdaten wurden für einen Zeitraum von 60 Sekunden mit einer Integrationszeit von 1 Sekunde erhoben. Die Figuren 5 und 6 zeigen die Ergebnisse der kinetischen Analyse von Berovin und Obelin.
Literatur / Patente
US 6,495,355 US 5,541,309 US 5,093,240 US-0908909 US 6,152,358 JP-0176125 GB-0024357 WO03006497 WO200168824
Alam J, Cook XL. Reporter genes: application to the study of mammalian gene transcription. Anal Biochem. 1990 Aug l;188(2):245-54
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David X Lipman (1997); Gapped BLAST and PSI-BLAST: a new generation of protein database search programs; Nucleic Acids Res. 25:3389-3402
Chiesa A, Rapizzi E, Tosello V, Pinton P, de Virgilio M, Fogarty KE, Rizzuto R. Recombinant aequorin and green fluorescent protein as valuable tools in the study of cell signalling. Biochem J. 0O7 Apr l;355(Pt l):l-12.
Claros, M.G., Vincens, P. (1996); Computational method to predict mitochondrially imported proteins and their targeting seqeunces. Eur. J. Biochem 241, 779-786.
Cullen Bryan R., Malim Michael H., Secreted placental alkaline phosphatase as a eukaryotic reporter gene. Methods in Enzymology. 216:362ff
Fagan TF, Ohmiya Y, Blinks JR, Inouye S, Tsuji FI. Cloning, expression and sequence analysis of cDNA for the Ca(2+)-binding photoprotein, mitrocomin. FEBSLett. 1993 Nov l;333(3):301-5
Hastings, J.W. and Morin, XG. (1969) Comparative biochemistry of calcium-activated photoproteins from the ctenophore, Mnemiopsis and the coelenterates Aequorea, Obelia, and Pelagia. Biol. Bull. 137, 402. Haddock SH, Rivers TJ, Robison BH. Can coelenterates make coelenterazine? Dietary requirement for luciferin in cnidarian bioluminescence. Proc Natl Acad Sei U S A 2001 Sep 25;98(20): 11148-51
Inouye S, Tsuji FI. (1994) Aequorea green fluorescent protein. Expression of the gene and fluorescence characteristics of the recombinant protein. FEBSLett 1994 Mar 21;341(2-3):277-80
Inouye S, Tsuji FI. Cloning and sequence analysis of cDNA for the Cä(2+)-activated photoprotein, clytin. FEBSLett. 1993 Jan l l;315(3):343-6.
Illarionov BÄ, Bondar VS, Illarionova VA, Vysotski ES. Sequence of the cDNA encoding the Ca(2+)-activated photoprotein obelin from the hydroid polyp Obelia longissima. Gene. 1995 Feb 14;153(2):273-4.
Jones K, Hibbert F, Keenan M. Glowing jellyfish, luminescence and a molecule called coelenterazine. Trends Biotechnol 1999 Dec;17(12):477-81
Johnson, F.H., Shimomura, O., Saiga, Y., Gershman, L.C., Reynolds, G.T., and Waters, J.R. (1962) Quantum efficiency of Cypridina luminescence, with a note on that of Aequorea. J. Cell. Comp. Physiol. 60, 85-103.
Morin, J.G. and Hastings, J.W. (1971) Biochemistry of the bioluminescence of colonial hydroids and other coelenterates. /. Cell. Physiol. 77, 305-311.
Phillips GN. Structure and dynamics of green fluorescent protein. Curr Opin Struct Biol. 1997 Dec;7(6):821-7
Sambrook, J., Fritsch, E. Maniatis, T. 1989, Molecular cloning. A laboratory manual Vol 1-3, Cold Spring Harbor, New York : Cold Spring Harbor Laboratory Press
Shimomura O, Johnson FH. Properties of the biolurninescent protein aequorin. Biochemistry. 1969 Oct;8(10):3991-7
Shimomura O., Bioluminescence in the sea: photoprotein Systems. Symp Soc Exp Biol.
1985;39:351-72 Shimomura O. Isolation and properties of various molecular forms of aequorin. Biochem J. 1986 Mar l;234(2):271-7. Snowdowne KW, Borle AB. Measurement of cytosolic free calcium in mammalian cells with aequorin. Am J Physiol. 1984 Nov;247(5 Pt l):C396-408.
Ward WW, Seliger HH. (1974) Properties of mnemiopsin and berovin, calcium-activated photoproteins from the ctenophores Mnemiopsis sp. and Beroe ovata. Biochemistry. 1974 Mar ' 26;13(7):1500-10.
Ward WW, Cormier MJ. (1975) Extraction of Renilla-type luciferin from the calcium-activated photoproteins aequorin, mnemiopsin, and berovin. Proc Natl Acad Sei U S A. 1975 Jul;72(7):2530-4
Yang Te-Tuan, Sinai Parisa, Kitts Paul A. Kain Seven R., Quantification of gene expresssion with a secreted alkaline phosphatase reporter System. Biotechnique. 1997 23(6) 11 lOff

Claims

Patentansprflche
1. Nukleinsäuremolekül, ausgewählt aus der Gruppe bestehend aus a) Nukleinsäuremolekülen, die ein Polypeptid kodieren, welches die Aminosäuresequenz offenbart durch SEQ JJD NO: 2 umfasst; b) Nukleinsäuremolekülen, welche die in SEQ JD NO: 1 dargestellte Sequenz umfassen; c) Nukleinsäuremolekülen, deren komplementärer Strang mit einem Nukleinsäuremolekül aus a) oder b) unter stringenten Bedingungen hybridisiert und welche die biologische Funktion eines Photoproteins aufweisen; d) Nukleinsäuremolekülen, welche sich auf Grund der Degenerierung des genetischen Kodes von den unter c) genannten unterscheiden; e) Nukleinsäuremolekülen, welche eine Sequenzhomologie von mindestens 95 % zu SEQ ID NO: 1 zeigen, und welche die biologische Funktion eines Photoproteins aufweisen; und f) Nukleinsäuremolekülen, welche eine Sequenzhomologie von mindestens 65% zu SEQ ID NO: 1 zeigen, und welche die biologische Funktion eines Photoproteins aufweisen.
2. Nukleinsäure nach Anspruch 1, welche einen funktionalen Promotor 5" zur das Photoprotein kodierenden Sequenz enthält.
3. Rekombinante DNA oder RNA Vektoren, welche Nukleinsäuren nach Anspruch 2 enthalten.
4. Organismen, die einen Vektor gemäß Anspruch 3 enthalten.
5. Oligonukleotide mit mehr als 10 aufeinanderfolgenden Nukleotiden, die identisch oder komplementär zu einer Teilsequenz eines Nukleinsäuremoleküls gemäß Anspruch 1 sind.
6. Polypeptid, das durch eine Nukleinsäuresequenz nach Anspruch 1 kodiert ist.
7. Verfahren zur Expression der Photoprotein Polypeptide gemäß Anspruch 6 in Bakterien, eukaryotischen Zellen oder in in vitro Expressionssystemen.
8. Verfahren zur Aufreinigung/Isolierung eines Photoprotein Polypeptides gemäß Anspruch 6.
9. Peptide mit mehr als 5 aufeinanderfolgenden Aminosäuren, die immunologisch durch Antikörper gegen das Photoprotein Berovin erkannt werden.
10. Verwendung einer für ein Photoprotein kodierende Nukleinsäure gemäß den Ansprüchen 1 bis 3 als Marker- oder Reportergen.
11. Verwendung eines Photoproteins gemäß Anspruch 6 als Marker oder Reporter.
EP04764112A 2003-08-26 2004-08-13 Isoliertes photoprotein berovin, sowie dessen verwendung Withdrawn EP1660527A1 (de)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
DE10339567A DE10339567A1 (de) 2003-08-26 2003-08-26 Isoliertes Photoprotein Berovin, sowie dessen Verwendung
PCT/EP2004/009118 WO2005021591A1 (de) 2003-08-26 2004-08-13 Isoliertes photoprotein berovin, sowie dessen verwendung

Publications (1)

Publication Number Publication Date
EP1660527A1 true EP1660527A1 (de) 2006-05-31

Family

ID=34202123

Family Applications (1)

Application Number Title Priority Date Filing Date
EP04764112A Withdrawn EP1660527A1 (de) 2003-08-26 2004-08-13 Isoliertes photoprotein berovin, sowie dessen verwendung

Country Status (4)

Country Link
US (1) US20070042375A1 (de)
EP (1) EP1660527A1 (de)
DE (1) DE10339567A1 (de)
WO (1) WO2005021591A1 (de)

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
DE102005016980A1 (de) * 2005-04-13 2006-11-02 Bayer Healthcare Ag Isoliertes Photoprotein gr-Bolinopsin, sowie dessen Verwendung
US8431698B2 (en) * 2007-08-29 2013-04-30 Biolume Inc. Bioluminescent endoscopy methods and compounds

Family Cites Families (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AU3342689A (en) * 1988-03-24 1989-10-16 Igen Incorporated Luminescent chimeric proteins
US6495355B1 (en) * 1999-06-22 2002-12-17 The Board Of Trustees Of The Leland Stanford Junior University Red-shifted luciferase

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
See references of WO2005021591A1 *

Also Published As

Publication number Publication date
US20070042375A1 (en) 2007-02-22
DE10339567A1 (de) 2005-03-24
WO2005021591A1 (de) 2005-03-10

Similar Documents

Publication Publication Date Title
EP1664102B1 (de) Isoliertes photoprotein mtclytin, sowie dessen verwendung
EP1572732B1 (de) Isoliertes fluoreszierendes protein aus clytia gregaria cgfp, sowie dessen verwendung
EP1660527A1 (de) Isoliertes photoprotein berovin, sowie dessen verwendung
DE102007011241A1 (de) Isoliertes Photoprotein mtClytinDecay, sowie dessen Verwendung
EP1638998A1 (de) Isoliertes photoprotein bolinopsin, sowie dessen verwendung
EP1881992A2 (de) Isoliertes photoprotein aqdecay sowie dessen verwendung
WO2006108518A1 (de) Isoliertes photoprotein gr-bolinopsin, sowie dessen verwendung
DE102004035687A1 (de) Isoliertes Photoprotein Aequorin Y89F, sowie dessen Verwendung
DE102005005438A1 (de) Mutanten des fluoreszierenden Proteins CGFPs, sowie deren Verwendung
WO2007140983A1 (de) FLUORESZIERENDE PROTEINE wfCGFP, SOWIE DEREN VERWENDUNG
HK1123056A (en) Isolated aqdecay photoprotein and use thereof
HK1088016B (en) Isolated fluorescent protein from clytia gregaria cgfp and use thereof

Legal Events

Date Code Title Description
PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

17P Request for examination filed

Effective date: 20060327

AK Designated contracting states

Kind code of ref document: A1

Designated state(s): AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IT LI LU MC NL PL PT RO SE SI SK TR

DAX Request for extension of the european patent (deleted)
17Q First examination report despatched

Effective date: 20070626

GRAP Despatch of communication of intention to grant a patent

Free format text: ORIGINAL CODE: EPIDOSNIGR1

RAP1 Party data changed (applicant data changed or rights of an application transferred)

Owner name: BAYER SCHERING PHARMA AG

RAP1 Party data changed (applicant data changed or rights of an application transferred)

Owner name: BAYER SCHERING PHARMA AKTIENGESELLSCHAFT

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN

18D Application deemed to be withdrawn

Effective date: 20090926