EP1556484A2 - Cytoplasmic dynein heavy chain 1 genes, expression products, non-human animal model: uses in human neurological diseases - Google Patents

Cytoplasmic dynein heavy chain 1 genes, expression products, non-human animal model: uses in human neurological diseases

Info

Publication number
EP1556484A2
EP1556484A2 EP03807821A EP03807821A EP1556484A2 EP 1556484 A2 EP1556484 A2 EP 1556484A2 EP 03807821 A EP03807821 A EP 03807821A EP 03807821 A EP03807821 A EP 03807821A EP 1556484 A2 EP1556484 A2 EP 1556484A2
Authority
EP
European Patent Office
Prior art keywords
cytoplasmic dynein
amino acid
seq
dynein heavy
heavy chainl
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Withdrawn
Application number
EP03807821A
Other languages
German (de)
French (fr)
Inventor
Rainer Klocke
Andreas Marquardt
Gisela Peraus
Gabriele Stumm
Philipp Wabnitz
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Ingenium Pharmaceuticals GmbH
Original Assignee
Ingenium Pharmaceuticals GmbH
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Ingenium Pharmaceuticals GmbH filed Critical Ingenium Pharmaceuticals GmbH
Publication of EP1556484A2 publication Critical patent/EP1556484A2/en
Withdrawn legal-status Critical Current

Links

Classifications

    • A—HUMAN NECESSITIES
    • A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K67/00—Rearing or breeding animals, not otherwise provided for; New or modified breeds of animals
    • A01K67/027—New or modified breeds of vertebrates
    • A—HUMAN NECESSITIES
    • A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K67/00—Rearing or breeding animals, not otherwise provided for; New or modified breeds of animals
    • A01K67/027—New or modified breeds of vertebrates
    • A01K67/0275—Genetically modified vertebrates, e.g. transgenic
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
    • C07K14/4716—Muscle proteins, e.g. myosin, actin
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C12N15/8509—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells for producing genetically modified animals, e.g. transgenic
    • A—HUMAN NECESSITIES
    • A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2207/00—Modified animals
    • A01K2207/15—Humanized animals
    • A—HUMAN NECESSITIES
    • A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2217/00—Genetically modified animals
    • A—HUMAN NECESSITIES
    • A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2217/00—Genetically modified animals
    • A01K2217/05—Animals comprising random inserted nucleic acids (transgenic)
    • A—HUMAN NECESSITIES
    • A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2217/00—Genetically modified animals
    • A01K2217/07—Animals genetically altered by homologous recombination
    • A01K2217/072—Animals genetically altered by homologous recombination maintaining or altering function, i.e. knock in
    • A—HUMAN NECESSITIES
    • A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2217/00—Genetically modified animals
    • A01K2217/07—Animals genetically altered by homologous recombination
    • A01K2217/075—Animals genetically altered by homologous recombination inducing loss of function, i.e. knock out
    • A—HUMAN NECESSITIES
    • A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2227/00—Animals characterised by species
    • A01K2227/10—Mammal
    • A01K2227/105—Murine
    • A—HUMAN NECESSITIES
    • A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2267/00—Animals characterised by purpose
    • A01K2267/03—Animal model, e.g. for test or diseases
    • A—HUMAN NECESSITIES
    • A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2267/00—Animals characterised by purpose
    • A01K2267/03—Animal model, e.g. for test or diseases
    • A01K2267/0306—Animal model for genetic diseases
    • A01K2267/0318—Animal model for neurodegenerative disease, e.g. non- Alzheimer's
    • A—HUMAN NECESSITIES
    • A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2267/00—Animals characterised by purpose
    • A01K2267/03—Animal model, e.g. for test or diseases
    • A01K2267/035—Animal model for multifactorial diseases
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2799/00—Uses of viruses
    • C12N2799/02—Uses of viruses as vector
    • C12N2799/021—Uses of viruses as vector for the expression of a heterologous nucleic acid
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2800/00—Nucleic acids vectors
    • C12N2800/30—Vector systems comprising sequences for excision in presence of a recombinase, e.g. loxP or FRT

Definitions

  • Cytoplasmic dynein heavy chainl genes, expression products, non-human animal model uses in human neurological diseases
  • the present invention ter alia relates to a non-human animal model for movement hyperactivity, hyperexcitability disorders (e.g. myoclonic cramping, epilepsy), excitoxicity disorders, and neurodegeneration.
  • This animal model bears a mutation in the cytoplasmic dynein heavy chainl gene.
  • the invention also relates to modified peptides and the conesponding nucleic acid sequences of the modified mouse and human cytoplasmic cytoplasmic dynein heavy chainl.
  • the invention relates to the use of these peptides and nucleic acids for manufacturing therapeutics suitable for the treatment of diseases, such as Alzheimer's disease, Huntington's disease, Parkinson's disease and amyotropic lateral sclerosis (ALS), as well as other diseases associated with overexpression, over-activity, or undesirable activity of cytoplasmic dynein heavy chainl .
  • diseases such as Alzheimer's disease, Huntington's disease, Parkinson's disease and amyotropic lateral sclerosis (ALS), as well as other diseases associated with overexpression, over-activity, or undesirable activity of cytoplasmic dynein heavy chainl .
  • Eukaryotic cells are characterized by biochemical and physiological processes which under normal conditions are extremely highly balanced to achieve the preservation and propagation of the cells. hen such cells are components of multicellular organisms such as vertebrates, or more particularly organisms such as mammals, the regulation of the biochemical and physiological processes involves intricate signaling pathways. Frequently, such signaling pathways consist of extracellular signaling proteins, cellular receptors that bind the signaling proteins and signal transducing components located within the cells.
  • Signaling prqcesses may elicit a variety of effects on cells and tissues, including by way of nonlimiting example induction of cell or tissue proliferation, suppression of growth or proliferation and induction or suppression of differentiation or maturation of a cell or tissue.
  • Many pathological conditions involve dysregulation of expression of important effector proteins. In certain classes of pathologies the dysregulation is manifested as a diminished or suppressed level of synthesis and secretion of protein effectors.
  • a subject may be suspected of suffering from a condition brought on by diminished or suppressed levels of a protein effector of interest. Therefore, there is a need to assay for the level of the protein effector of interest in a biological sample from such a subject and to compare the level with that characteristic of a nonpathological condition.
  • Degenerative disorders of motor neurons include a range of progressive diseases such as amyotrophic lateral sclerosis (ALS) and spinal muscular atrophy (SMA), the most common genetic cause of death of children (Nicole, S. et al.,J. Muscle Nerve 26, 4-13, 2002).
  • ALS amyotrophic lateral sclerosis
  • SMA spinal muscular atrophy
  • ALS In ALS, commonly known as Lou Gehrig's Disease in the US, the motor neurons (nerve cells in the brain, brain stem, and spinal cord that control movement of the skeletal muscles) gradually degenerate, resulting in progressive weakness and functional loss of involved muscles. Diseases that cause selective progressive death of motor neurons are surprisingly common « ALS is the third most frequent neurodegenerative cause of adult death, after Alzheimer disease and Parkinson disease, and is significantly more common than multiple sclerosis (Motor Neurone Disease Association Information Sheet Number 9, Motor Neurone Disease Association, 1998). Targeted at adults in their prime years of life, the average age of onset is the mid-fifties, although adults of all ages can be affected. Men get the disease slightly more often than women.
  • ALS familial
  • SOD1 encodes the ubiquitously expressed enzyme superoxide dismutase 1 which takes on an unknown dominant gain of function in ALS that results in the selective death of motor neurons. Mutations have also been found in alsin, probably a GTPase regulatory protein, in rare juvenile recessive forms of motor neuron disease (Hadano, S. et al. Nat. Genet. 29, 166-173, 2001; Yang, Y. et al.. Nat. Genet. 29, 160-165, 2001).
  • NFH neuroofilament heavy chain
  • diagnosing ALS is a combination of medical history and physical and neurological examinations performed by a clinical neurologist (Brooks, Benjamin R., El Escorial J Neurol Sci 124 (Suppl.), pages 96-107, 1994; Karitzky J, Ludolph AC. J Neurol Sci, Oct 15;191(l-2):35-41, 2001; Ludolph AC, and Knirsch U, J Neurol Sci, Jun;165 Suppl l:S14-20, 1999).
  • An electromyogram is a diagnostic test which is done to determine abnormal nerve and muscle activity. The clinical examination and tests also rule out other conditions that might mimic motor neuron disease.
  • the certainty ofthe diagnosis is determined by the clinical evidence of upper and lower motor neuron signs, according to the criteria established by the World Federation of Neurology. Therefore, a definitive diagnosis of ALS is performed when clearly detectable classical clinical signs such as muscular fibrillation of distal muscle groups or tongue, difficulty to swallow, and predominantly distal muscular atrophy with the typical histological picture of grouped angular shaped atrophic muscle fibres indicative of muscle denervation are present which means that the disease course is already proceeded.
  • PBP Progressive bulbar palsy
  • PMA Progressive muscular atrophy
  • PLS Primary lateral sclerosis
  • SMA spinal muscular atrophy
  • SBMA spinobulbar muscular atrophy
  • Glutamate also may lead to the production of detrimental calcium, which can churn out its own supply of DNA-harming free radicals.
  • the free radicals also may injure neurofilaments, proteins that serve as the skeleton ofthe cell.
  • the immune system Hofmann, Y. and Wirth, B. Hum. Mol. Genet. 11, 2037-2049, 2002
  • Abnormalities can lead to an accumulation of the toxic calcium.
  • Glutamate-induced excitotoxicity is a potential contributor to ALS pathogenesis.
  • Depolarization of the neuronal membrane after activation of neuronal glutamate receptors activates voltage-dependent Ca 2+ channels, allowing Ca 2+ entry into the cell.
  • excess activation of neuronal glutamate receptors can cause cell death via alterations in cytosolic free Ca 2+ homeostasis.
  • spinal motor neurons rapid recovery of synaptic glutamate is accomplished by the glutamate transporter EAAT2 present in astrocytes. Loss of EAAT2 transporter could lead to increased extracellular concentrations of glutamate and excitotoxic degeneration of motor neurons (Julien, Review; Cell. 2001 Feb 23;104(4):581-91).
  • mice have recently enabled mouse ALS models to make an excess of glutamate transport proteins in both brains and spinal cords. Preliminary studies of these mice show huge increases in their survival time, which led to the development of an "EAAT2 replacement therapy" for ALS patients at the John Hopkins University (The Robert Packard Center for ALS Research at John Hopkins, www.alscenter.org, 2002).
  • Riluzole retards nerve cells' release of glutamate. Although the effects of Riluzole are clearly modest, it has been the only drug that reliably shows clinical efficacy compared to the dozens of drugs studied by clinicans around the world in thousands of ALS patiens (Nervous Breakdown, A detailed analysis of the neurology market, UBS
  • defects in axonal transport may be an underlying common pathway that leads to the degeneration of motor neurons in ALS patients and in relevant spontaneous and transgenic mouse models such as wobbler, nmd or SOD1
  • Motor neurons of the brain and spinal cord are characterized by the length of their axons, which can reach a meter in length in an adult human.
  • the significant length of these neuronal projections makes active axonal transport essential for normal cellular function.
  • the axonal transport is microtubule dependant and includes both, an anterograde transport of organelles to the axonal synapse and the retrograde transport of multivesicular bodies and trophic factors back to the neuron cell body.
  • the retrograde transport is mediated by the dynein-dynactin complex.
  • Dyneins are cytoskeletal motor proteins. These can be defined as molecules that convert chemical energy, originating from nucleotide hydrolysis, into the mechanical force necessary for them to move along cytoskeletal polymers (c/Nallee and Howard (1990) Annu. Rev. Biochem 59: 909-932). Dyneins and kinesins constitute the superfamily of microtubule-dependent motor proteins, (Hirokawa (1998) Science 279, 519-526).
  • dyneins Although the superfamily of dyneins is probably less diverse than that of kinesins, the family, which contributes to the structure and function of flagellar and cilliary axonems (axonemal dyneins), comprises more than a dozen dynein heavy chain isoforms (Milisav (1998) Cell Motil Cytoskeleton 39, 261- 272). Only four dynein heavy chain isoforms, contributing to different forms of the protein complex, called cytoplasmic dynein, are known in mammals.
  • cytoplasmic dynein heavy chainl The most abundant form of cytoplasmic dynein, whose identity is defined by the cytoplasmic dynein heavy chainl, is involved in a wide range of cellular functions. In mouse and human, the homologous proteins are refened to as cytoplasmic dynein heavy chainl. These proteins conespond, respectively, to the translation product of the transcript ofthe mouse gene Dnchcl (Genbank Accession No. AY004877) and the translation product of the full-length cDNA of the human gene DNCH1. The full- length human cytoplasmic dynein heavy chainl cDNA is disclosed herein (SEQ ID NO: 17).
  • Cytoplasmic dynein was initially identified in nervous tissue (Paschal et al. (1987) J Cell Biol 105, 1273-1282) although it is expressed in several tissues (Mikami et al. (1993) Neuron 10, 787-796).
  • cDHC-l- preimplantation embryos were microscopically indistinguishable from cDHC+/- and cDHC+/+ littermates, by 8.5 days p.c, no cDHC-l- embryo were found.
  • the cytoplasmic dynein complex consists of at least four classes of subunits: heavy, intermediate, light intermediate and light dynein chains.
  • the dynein intermediate chain, dynein light intermediate chain, and dynein light chain specify the
  • the architecture ofthe complex is dominated by two heavy chains of 530 kDA each, which form a stem by the interaction of a large portion (amino acids 300 - 1140) of their N-termini.
  • This stem also binds the dynein chains of lower molecular weight, e.g. two 74 kDa intermediate chains (between amino acids 446 and 701 of the heavy chains) and four 53-59 kDa light intermediate chains (between amino acids 649 and 800 of the heavy chains) (Tynan et al. (2000) J Biol Chem. 275, 32769-32774).
  • Several 8-22 kDa light chains bind to the complex via interaction with the intermediate or light intermediate chains (c * Makoka et al.
  • the binding of dynactin to dynein is essential for dynein-dependent intracellular movements (Gill et al. (1991) J Cell Biol 115, 1639-1650; Schroer and Sheetz (1991) J Cell Biol 115, 1309-1318) including those required for neuronal function. It has been shown that antibodies which specifically disrupt the binding of dynactin to dynein block vesicle motility along micrombules in extruded squid axoplasm (Waterman-Storer et al. (1997) Proc Natl Acad Sci USA 94, 12180-12185).
  • Dynein-mediated intracellular movements are directed along micrombules towards their proximal (-) ends. This process is accomplished by ATP hydrolysis, which is predominantly catalysed by the first of four (counted from the one nearest to the N-terminus) P-loop motifs of each of two C-terminal globular heads which are formed by approximately 3000 amino acids of each of the two dynein heavy chains. Both globular heads also contain a microtubule binding domain, which is thought to be located at the tip of a stalk (Asai and Koonce (2001) Trends Cell Biol 11, 196- 202).
  • the present invention provides an animal model for conelating mutations or defects in the cytoplasmic dynein heavy chainl gene with human disorders, including movement hyperactivity, hyperexcitability disorders (e.g. myoclonic cramping, epilepsy), excitotoxicity disorders, and neurodegeneration, such as Alzheimer's disease, Parkinson's disease, and Huntington's disease, and specifically motor neuron degeneration, such as ALS (Amyotrophic Lateral Sclerosis), SMA (Spinal Muscular Atrophy), SBMA (Bulbo-Spinal Muscular Atrophy), PBP (progressive Bulbar Palpsy), PMA (Progressive Muscular Atrophy), and PLS (Primary Lateral Sclerosis), resulting in whole or in part from these mutations or defects in the cytoplasmic dynein heavy chainl gene or the protein it encodes.
  • ALS Amyotrophic Lateral Sclerosis
  • SMA Spinal Muscular Atrophy
  • SBMA Bulbo-Spinal Muscular Atrophy
  • PBP progress
  • the Cral (cramping 1) mutation in cytoplasmic dynein itself results in progressive motor neuron degeneration in heterozygous mice.
  • this invention provides an animal model that demonstrates the role of cytoplasmic dynein heavy chainl in movement hyperactivity, hyperexcitability disorders (e.g. myoclonic cramping, epilepsy), excitotoxicity disorders and neurodegeneration, specifically ⁇ -motor neuron degeneration, resulting from a mutation or defect in cytoplasmic dynein heavy chainl.
  • the Cral animal model described herein demonstrates a germline missense mutation that causes subtle changes in the cytoplasmic dynein heavy chain 1, and is sufficient to specifically induce age dependent motor neuron degeneration without grossly affecting the housekeeping function of the dynein-dynactin complex in other cell types.
  • the Cral mutation in cytoplasmic dynein heavy chain 1 allows normal development and normal function ofthe organism in early adulthood.
  • the animal model provided herein meets the cunently unfulfilled need for a validated model to study the causes and precise physiological effects of such diseases associated with abenant cytoplasmic dynein heavy chainl function.
  • this invention provides a means for identifying antagonists and inhibitors for cytoplasmic dynein heavy chainl in such disorders.
  • the present invention also provides significant data useful in neurobiology and clinical research, as it describes in an animal model a new pathway involved in neurodegeneration, and also suggests a possible genetic cause for ALS/Lou Gehrig's disease.
  • the present invention provides diagnostic tests for latent or progressive diseases, or a propensity to develope a disease or passing on a contributing or causatory recessive genetic mutation to progeny, wherein the disease is selected from, but not limited to, the group of human disorders, including movement hyperactivity, hyperexcitability disorders (e.g. myoclonic cramping, epilepsy), excitotoxicity disorders, and neurodegeneration, in particular Alzheimer's disease, Parkinson's disease, Huntington's disease, amyotropic lateral sclerosis, spinal muscular atrophy, and fiber type grouping in Musculus tibialis anterior.
  • the disease is selected from, but not limited to, the group of human disorders, including movement hyperactivity, hyperexcitability disorders (e.g. myoclonic cramping, epilepsy), excitotoxicity disorders, and neurodegeneration, in particular Alzheimer's disease, Parkinson's disease, Huntington's disease, amyotropic lateral sclerosis, spinal muscular atrophy, and fiber type grouping in Musculus tibi
  • the present invention provides diagnostic tests for latent or progressive diseases, or a propensity to develope a disease or passing on a contributing or causatory recessive genetic mutation to progeny, wherein the disease is selected from, but not limited to, the group of human motor neuron degeneration disorders, including ALS (Amyotrophic Lateral Sclerosis), SMA (Spinal Muscular Atrophy), SBMA (Bulbo-Spinal Muscular Atrophy), PBP (progressive Bulbar Palpsy), PMA (Progressive Muscular Atrophy), and PLS (Primary Lateral Sclerosis).
  • ALS Amyotrophic Lateral Sclerosis
  • SMA Spinal Muscular Atrophy
  • SBMA Bulbo-Spinal Muscular Atrophy
  • PBP progressive Bulbar Palpsy
  • PMA Progressive Muscular Atrophy
  • PLS Primary Lateral Sclerosis
  • This invention provides inter alia a non-human animal useful as a model of dynein heavy chain disorders in humans, particularly cytoplasmic dynein heavy chainl disorders.
  • the invention provides an animal model which carries a mutated cytoplasmic dynein heavy chainl gene encoding a cytoplasmic dynein heavy chainl protein with a modified amino acid sequence compared to the wild type sequence.
  • the invention also provides cell lines derived from the animal model ofthe present invention.
  • the present invention also relates to the use of the animal model of the invention for the study of disorders associated with deficiencies or malfunctions in cytoplasmic dynein heavy chainl.
  • the invention provides methods of diagnosis for deficiencies or malfunction in cytoplasmic dynein heavy chainl or the gene encoding it.
  • the invention provides a method for screening of preventive or therapeutic agents of disorders and symptoms associated with movement hyperactivity, hyperexcitability disorders (e.g.
  • the present invention provides mutated cytoplasmic dynein heavy chainl nucleic acids and amino acids having modified sequences compared to the wild type sequence, as well as vectors and cell lines for expressing the muteins recombinantly. These mutated nucleic acids and amino acids may also be used in the diagnostic and therapeutic methods contemplated herein.
  • the cytoplasmic dynein heaVy chainl mutein has an amino acid substitution at a position that conesponds to a conserved amino acid of mouse or human cytoplasmic dynein heavy chain 1 as described in an individualized manner in connection with the prefened muteins of the invention below.
  • the cytoplasmic dynein heavy chainl mutein has an amino acid substitution, e.g., at position 1055 resulting from a point mutation at nucleotide +3169 of the coding sequence, conesponding to position 3328 of SEQ ID NO:l (Genbank Ace. No. AY004877; murine Dnchcl mRNA). Also provided are recombinantly generated cytoplasmic dynein heavy chainl muteins of the invention (both the murine and human othologs), as well as antibodies binding to these muteins, and chimeric protein derivatives of these cytoplasmic dynein heavy chainl muteins.
  • compositions comprising the cytoplasmic dynein heavy chainl muteins of this invention with or without a pharmaceutically acceptable carrier are also contemplated.
  • the invention includes the use ofthe cytoplasmic dynein heavy chainl muteins of the present invention, the polynucleotides encoding them, and vectors bearing said polynucleotides, for the prevention, treatment or amelioration of a medical condition in a mammalian subject, particularly a human subject.
  • the invention provides the use of these muteins for the manufacture of a medicament for prevention, treatment or amelioration of any medical conditions characterized by movement hyperactivity, hyperexcitability disorders (e.g. myoclonic cramping, epilepsy), excitotoxicity disorders and neurodegeneration.
  • hyperexcitability disorders e.g. myoclonic cramping, epilepsy
  • excitotoxicity disorders e.g. neurodegeneration.
  • the invention also includes a method of gene delivery and expression in a target cell of a mammal, comprising the step of introducing a viral vector into the target cell, wherein the viral vector is derived from a virus that has a low replicative efficiency in the target cell and has at least one insertion site containing a wild type or mutant cytoplasmic dynein heavy chainl nucleic acid, wherein the nucleic acid is operably linked to a promoter capable of expression in the host.
  • the viral vector is a non-lytic viral vector.
  • the invention also provides a method of gene delivery and expression in a target cell of a mammal comprising the steps of: (a) providing an isolated nucleic acid fragment of wild type or mutant cytoplasmic dynein heavy chainl ofthe invention; (b) selecting a viral vector derived from a virus that has a low replicative efficiency in the target cell, wherein the vector has at least one insertion site for insertion of said isolated nucleic acid fragment operably linked to a promoter capable of expression in the target cells; (c) inserting the isolated nucleic acid fragment into the insertion site, and (d) introducing the vector into said target cell wherein said gene is expressed at detectable levels.
  • the virus is selected from the group consisting of retrovirus, adeno virus, and pox virus.
  • the virus is a strain that has been genetically modified or selected to be non-virulent in a host.
  • the pox virus is vaccinia.
  • the virus is selected from the group consisting of retrovirus, adenovirus, iridoviruses, coronaviruses, togaviruses, caliciviruses and picornaviruses.
  • ALS Amyotrophic Lateral Sclerosis
  • SMA Spinal Muscular Atrophy
  • SBMA Bobo-Spinal Muscular Atrophy
  • PBP progressive Bulbar Palpsy
  • PMA Progressive Muscular Atrophy
  • PLS Primary Lateral Sclerosis
  • Neurodegenerative diseases are likewise disease targets contemplated e.g. in connection with the methods of screening for a predisposition for a neurodegenerative disease according to the present invention.
  • the present invention provides in a further embodiment a method of identifying a protein or nucleic acid marker indicative of an increased risk of a mammalian subject, particularly a human subject, or a mouse, a rat, a rabbit, a cow or a hamster, preferably a mouse or a rat, of developing a neurodegenerative disease, said method comprising the step of analyzing a test sample derived from said subject for the presence of a difference compared to a similar test sample if derived from a subject of the same species unaffected by or known not to be at risk of developing said disease, wherein said difference is indicative of the presence of a mutation in an allele of a gene coding for a protein, which is a subunit of the dynactin/dynein complex.
  • the present invention provides a method of identifying a protein or nucleic acid marker indicative of an association of a neurodegenerative disease in a mammalian subject, particularly a human subject, or a mouse, a rat, a rabbit, a cow or a hamster, preferably a mouse or a rat, with a mutation in an allele of a gene coding for a protein, which is a subunit ofthe dynactin/dynein complex.
  • a method for identifying a predisposition of a mammalian subject, particularly a human subject, or a mouse, a rat, a rabbit, a cow or a hamster, preferably a mouse or a rat, for developing a neurodegenerative disease, said method comprising the step of determining whether a test sample derived from said subject indicates the presence of a mutation in an allele of a gene coding for a protein, which is a subunit of the dynactin/dynein complex, indicative of an increased risk of said subject of developing said neurodegenerative disease.
  • oligonucleotides suitable for identifying the above-mentioned mutations are provided.
  • kits containing such oligonucleotides, and solid supports, such as DNA chips, to which said oligonucleotides are bound are provided.
  • Figure 1 presents a heterozygous Cral animal (right) compared to a wildtype mouse (left) demonstrating cramping ofthe hindlimbs and forelimbs ofthe mutant animal.
  • Figure 2 is a chart diagram, indicating movement as ambulatory activity expressed as beam breaks (average counts per hour) detected by a Cage Rack Photobeam Activity Cage System (San Diego Instruments, Inc., San Diego, CA, USA) of heterozygous Cral (Cral/+) animals and wildtype individuals during four 6-hour periods of an artificial 24 hour diurnal cycle, in which darkness lasted from 6pm to 6am, and the period from 6 am to 6 pm was light.
  • Cage Rack Photobeam Activity Cage System San Diego Instruments, Inc., San Diego, CA, USA
  • Figure 3 is a listing ofthe latency to fall values (seconds) of heterozygous Cral mice (Cral/+) and control individuals (+/+) in a semi-quantitative hanging wire assay. Muscle endurance of adult heterozygous Cral individuals (Cral/+) was measured in comparison to wildtype individuals by measuring the mouse's latency to fall from an inverted wire grid, as described in Example 3.
  • Figure 4 depicts photomicrographs of hematophilin and eosin (H&E) stained histological sections of a Cral/+ and a wildtype mouse hippocampus. Neurons characterized by reversible excitatory neuronal damage can be identified by the dark staining ("dark neurons"; indicated by anows). (See Example 5)
  • Figure 5 depicts photomicrographs of cross sections of the lumbar area of spinal cords from a wild type (left panel) and a homozygous Cral /Cral individual (right panel).
  • the top row photomicrographs depicts a drastic reduction of the number of neurons in the anterior horn area of the Cral/Cral individual (right), as compared to the wildtype (left).
  • TUNEL stains of anterior horn are shown (see anow), demonstrating significantly enhanced levels of apoptosis in the anterior horns of the Cral/Cral individuals (right).
  • a reduction is seen in the number of spinal ganglia neurons of Cral/Cral individuals
  • Figure 5.2 shows that progressive impairment of muscle function and motor coordination is associated with decreasing numbers of ⁇ -motor neurons and altered composition of muscle fibre types.
  • Loss of spinal ⁇ -motor neurons in 16 months old Cral/+ (h) mice is accompanied by altered composition of muscle fibre types, with a predominance of large type 1 fibres in Periodic acid-Schiff (PAS) staining, compared to +/+ littermates
  • PAS Periodic acid-Schiff
  • Figure 6 represents a list of selected genes expressed in fetal brain of individual
  • Cral/Cral mice shown to be transcriptionally deregulated by comparison of transcript levels to those detected in wildtype individuals. The direction of deregulation (up or down) and the biological significance of those genes is indicated.
  • Figure 7 schematically depicts an exon structure comparison of the human cytoplasmic dynein heavy chainl (HsDNCHl) and the mouse cytoplasmic dynein heavy chainl (MmDnchcl) genes.
  • Exonic sequences were aligned with sequencher software (version 4.0.5, GeneCodes Corp., Ann Arbor Mi, USA). Assembly of the human exons and the mouse exons, respectively, results in a full-length cDNA of human DNCHl and a full-length cDNA of mouse Dnchcl (representing the protein coding sequence within the mRNA, defined under GenBank Accession No. AY004877) as indicated by the anows at the top of the figure. Equivalent exons are paired, with the human exon positioned above the conesponding mouse exon.
  • Figure 8 is a comparative listing of all exons of the mouse (MmDnchcl) and human (Hs DNCHl) dynein heavy chainl genes. The size of each exon is indicated by its length in basepairs (bp).
  • the human gene consists of 78 exons, and the mouse gene consists of 77 exons. The difference in exon number between these two species is caused by an additional RNA splice event in human, separating exon 67 (61 bp) and exon 68 (124 bp); mouse exon 67 having 185 bp.
  • Figure 9 depicts the amino acid sequence alignment between the human (Hs DNCHl) and the mouse (Mm Dnchcl) cytoplasmic dynein heavy chainl proteins. Black boxes indicate amino acid identity, and grey boxes indicate conserved amino acid substitutions. The degree of identity is 97%.
  • Figure 10 depicts the amino acid sequence alignment between the human (Hs DNCHl), the mouse (Mm Dnchcl), and the rat cytoplasmic dynein heavy chainl proteins, indicating highly conserved amino acid residues between species. Black boxes indicate amino acid identity, and grey boxes indicate conserved amino acid substitutions. The degree of identity is 96%.
  • Figure 11 depicts the amino acid sequence alignment between the human and the mouse cytoplasmic dynein intermediate chain 1 proteins. Black boxes indicate amino acid identity, and grey boxes indicate conserved amino acid substitutions. The degree ofidentity is 88%.
  • Figure 12 depicts the amino acid sequence alignment between the human, the mouse, and the rat cytoplasmic dynein intermediate chain 1 proteins, indicating highly conserved amino acid residues between species. Black boxes indicate amino acid identity, and grey boxes indicate conserved amino acid substitutions. The degree of identity is 87%.
  • Figure 13 depicts the amino acid sequence alignment between the human and the mouse cytoplasmic dynein intermediate chain 2 proteins. Black boxes indicate amino acid identity, and grey boxes indicate conserved amino acid substitutions. The degree ofidentity is 94%.
  • Figure 14 depicts the amino acid sequence alignment between the human, the mouse, and the rat cytoplasmic dynein intermediate chain 2 proteins, indicating highly conserved amino acid residues between species. Black boxes indicate amino acid identity, and grey boxes indicate conserved amino acid substitutions. The degree of identity is 93.5%.
  • Figure 15 depicts the amino acid sequence alignment between the human and the mouse DCTN1 proteins. Black boxes indicate amino acid identity, and grey boxes indicate conserved amino acid substitutions. The degree of identity is 97%.
  • Figure 16 depicts the amino acid sequence alignment between the human, the mouse, and the rat DCTN 1 proteins, indicating highly conserved amino acid residues between species. Black boxes indicate amino acid identity, and grey boxes indicate conserved amino acid substitutions. The degree of identity is 95%.
  • This invention provides a non-human animal useful as a model of dynein heavy chain disorders in humans, particularly cytoplasmic dynein heavy chainl disorders.
  • the Cral mutation, disclosed herein was generated in offspring of male C3HeB/FeJ mice (Cral, Institute of Mammalian Genetics at the GSF - National Research Center for Environment and Health) mutagenized with N-ethyl-N- nitrosourea (E ⁇ U). The mutation was detected by Cral mice displaying an unusual twisting of the body and clenching of the hindlimbs when suspended by the tail.
  • Dyneins are implicated in a number of different diseases and disorders.
  • the mouse mutant of the present invention is suitable to investigate the role of cytoplasmic dynein heavy chainl not only in transport processes in neurons but in all cell types expressing cytoplasmic dynein heavy chainl. Additionally, the mouse mutant of the present invention enables the analysis of cytoplasmic dynein malfunction during development whereas the transgenic mouse described by LaMonte et al. ((2002) Neuron 34, 715- 727) does not express the transgene before birth and, therefore, it is characterized by a late onset of symptoms.
  • dynein can associate with its cargo also through interactions with proteins other than dynactin (for review: Karcher et al. (2002) Trends in Cell Biology 12, 21-27). Since the mutation found in the cytoplasmic dynein heavy chain 1 gene of the mouse mutant of the present invention is located outside the binding site for the dynein intermediate chains which impart the binding of dynactin, the mouse mutant of the present invention will prove useful for studying dynactin-independant dynein functions.
  • HAPl a neuronal cytoplasmic protein
  • huntingtin the protein which carries a polyglutamine repeat that is expanded in Huntington's disease (>36 units). It has been shown that the affinity of HAPl for huntingtin is increased if the latter bears an expanded polyglutamine repeat (cf Li et al. (2002) J Biol Chem, in press). HAPl has been found on synaptic vesicles (Gutebuch et al. (1998) J Neurosci 18, 7674-7686) and it binds to P150 (Li et al.
  • APP amyloid precursor protein
  • the mouse mutant of the present invention provides a means to analyze whether three proteins (huntingtin, HAPl and APP) involved in the pathogenesis of the neurodegenerative diseases, Huntington's disease and Alzheimer's dementia are linked by the same intracellular transport pathways. This connection will help reveal the pathogenetic mechanisms of both diseases.
  • Lissencephaly syndromes are a familiy of diseases which involve incomplete development of the human brain (Dobyns et al. (1993) JAMA 270, 2838-2842) characterized by extensive disorganization of cortical neurons. This defect is thought to be due to a failure ofthe capability of neuronal cell body migration during the early stage of brain development. As a consequence of this, the convolutions characteristic of the normal brain surface are reduced in extent and number leading to a smooth appearence of wide portions ofthe brain.
  • lissencephaly include Norman-Roberts Syndrome, Fukuyama Syndrome, Walker- Warberg Syndrome and Miller-Dieker Syndrome. Some cases of isolated lissencephaly have been shown to arise from mutations in the LIS-1 gene (e.g. Lo Nigro et al. (1997) Hum Mol Genet 6, 157-164).
  • mice for the Lisl gene die early in embryogenesis whereas mice bearing mutations which cause different degrees of reduction of the function of Lisl exhibit conesponding degrees of brain disorganization as well as cerebellar defects (Hirotsune et al. (1998) Nature Genetics 19, 333-339).
  • the mouse mutant of the present invention provides a mean to comparatively analyze the overlap and the differences of cytoplasmic dynein and Lis 1 function in a mammalian model organism.
  • the homozygous knockout of the gene encoding cytoplasmic dynein heavy chainl in the mouse results in embryonic lethality before 8.5 days post coitus. Heterozygous individuals have no obvious phenotype (Harada et al. (1998) J Cell Biol 141, 51-59).
  • the transgenic dynamitin-overexpressing mouse described by LaMonte et al. ((2002) Neuron 34, 715-727) is characterized by a motomeuron specific inhibition ofthe functions of cytoplasmic dynein, which is mediated by the accessory protein complex dynactin. Due to the developmental regulation of the transgene by the Thy2 promotor of the transgene construct, inhibition is restricted to postnatal stages.
  • the characterization of such an animal model i.e. one that reflects the consequences of malfunction of cytoplasmic dynein heavy chainl in vivo in all types of cells and during embryonic and fetal development
  • the present invention provides a non-human animal model which expresses a modified cytoplasmic dynein heavy chainl protein compared to the amino acid sequence of the wild type protein.
  • the expressed cytoplasmic dynein heavy chainl may have similarity in sequence and secondary structure to a vertebrate cytoplasmic dynein heavy chainl.
  • the vertebrate is preferably from a genus selected from the group consisting of Homo sapiens, Mus musculus (e.g. mice), Rattus (e.g. rats), Oryctologus (e.g. rabbits) and Mesocricetus (e.g. hamsters).
  • a genus selected from the group consisting of Homo sapiens, Mus musculus (e.g. mice), Rattus (e.g. rats), Oryctologus (e.g. rabbits) and Mesocricetus (e.g. hamsters).
  • Animals carrying a mutated cytoplasmic dynein heavy chainl allele expressing the modified cytoplasmic dynein heavy chainl exhibit a variety of phenotypical features including: myoclonic cramps (which are especially pronounced in the hindlimbs), movement hyperactivity, reduced muscle endurance, excitatory neuronal damage ("dark neurons") in the hippocampus (gyrus dentatus, CA4, CA3) as well as in the upper layer ofthe cortex and in the Purkinje cell layer ofthe cerebellum. These animals also exhibit decreasing numbers of ⁇ -motor neurons and altered composition of musculus vastus fibre types.
  • homozygous individuals Compared with heterozygous animals, homozygous individuals exhibit an elevated incidence of perinatal lethality (100% in homozygous animals, versus approximately 20% amongst heterozygous animals), accelerated neurondegeneration in the anterior horns of the spinal cord, and accelerated neurodegeneration in the dorsal root ganglia. Neurodegeneration in heterozygous animals is apparent at a much later stage, i.e. late adulthood.
  • the observed neurological phenotype of myoclonic cramping and epilepsy in combination with the morphological conelate of reversible excitatory neuronal cell stress within the hippocampal layers CA4 and CA3 are indications for a hyperexcitability status in Cral animals. This in turn is consistent with an ambulatory locomotor hyperactivity of Cral animals. Hyperexcitation, if occuring repeatedly or continuously over longer periods of time, could result in excitotoxicity by mechanisms such as enhanced generation of reactive oxygen species (ROS) (see Haberny et al. (2002) Toxicol Sci, 68, 9-17; Bondy and LeBel, (1993) Free Radic Biol Med 14, 633-642; Tapia et al.
  • ROS reactive oxygen species
  • ROS ROS are suggested to be involved in the development of several neurodegenerative disorders, e.g. ALS, Parkinson's disease and Alzheimer's disease as well as aging. Therefore there is a possible link between the hyperexcitation status in Cral animals and the development of neurodegeneration at a later age.
  • modified refers to an alteration compared to the wild type.
  • phenotype refers to a collection of morphological, physiological, behavioral and biochemical traits possessed by a cell or organism that results from the interaction of the genotype and the environment.
  • the animal model of the present invention displays readily observable abnormalities. In a prefened embodiment the animal of the invention shows at least 2, preferably at least 4, more preferably 6 and most preferably all ofthe above listed phenotypical features.
  • the present invention provides nucleic acid sequences encoding wild type and mutated murine and human cytoplasmic dynein heavy chainl proteins, i.e., muteins as described in an individualized manner in connection with the prefened muteins ofthe invention below.
  • this invention provides mutated nucleic acid sequences for wild type murine cytoplasmic dynein heavy chainl mRNA (GenBank Accession Number AY004877.1, SEQ ID NO:l).
  • SEQ ID NO:l wild type murine cytoplasmic dynein heavy chainl mRNA
  • SEQ ID NO:l a mutated version of SEQ ID NO:l, containing a point mutation at position 3328 (which is position +3164 of the polypeptide coding sequence) is shown in SEQ ID NO:3.
  • this invention provides a mutated coding nucleic acid sequence for human cytoplasmic dynein heavy chainl containing the open reading frame for the human ortholog nucleic acid sequence, with a point mutation at the conesponding position (position +3170) in the sequence, as shown in SEQ ID NO:5.
  • this invention provides the wild type coding nucleic acid sequence for human cytoplasmic dynein heavy chainl, as shown in SEQ ID NO: 17.
  • nucleic acid sequences that are contemplated as within the scope of this invention include sequences that hybridize to the nucleic acid sequences encoding cytoplasmic dynein heavy chainl shown in SEQ ID NOS:l, 3, 5, and 17, other than those known in the prior art (as described above), with at least 75%, preferably at least 80%, more preferably at least 90%, even more preferably 95% and most preferably at least 99% sequence homology to the sequence of SEQ ID NOS: 1, 3, 5, or 17. Additionally, nucleic acid sequences that are degenerate with respect to the foregoing sequences are contemplated.
  • nucleic acid sequences encoding cytoplasmic dynein heavy chainl or mutant cytoplasmic dynein heavy chainl of the invention may exist alone or in combination with other nucleic acids as, for example, vector molecules, such as plasmids, including expression or cloning vectors.
  • nucleic acid sequence refers to any contiguous sequence series of nucleotide bases, e.g., a polynucleotide, and may be ribonucleic acid (RNA) or deoxy-ribonucleic acid (DNA).
  • RNA ribonucleic acid
  • DNA deoxy-ribonucleic acid
  • nucleic acid sequence is cDNA.
  • isolated nucleic acid molecule refers to a nucleic acid molecule that is separated from other nucleic acid molecules ordinarily present in the natural source of the nucleic acid.
  • an "isolated" nucleic acid is free of sequences which naturally flank the nucleic acid (e.g., sequences located at the 5'- and 3'-termini of the nucleic acid) in the genomic DNA of the organism that is the natural (wild type) source of the DNA.
  • Cytoplasmic dynein heavy chainl molecules can be isolated using standard hybridization and cloning techniques, as described, for instance, in Sambrook et al.
  • a nucleic acid of the invention can be amplified using cDNA, mRNA or, 5 alternatively, genomic DNA, as a template and appropriate oligonucleotide primers according to standard PCR amplification techniques.
  • the nucleic acid so amplified can be cloned into an appropriate vector and characterized by DNA sequence analysis.
  • oligonucleotides conesponding to cytoplasmic dynein heavy chainl nucleotide sequences can be prepared by standard synthetic techniques, e.g., using an 10 automated DNA synthesizer.
  • oligonucleotide refers to a series of linked nucleotide residues, which oligonucleotide has a sufficient number of nucleotide bases to be used in a PCR reaction.
  • a short oligonucleotide sequence may be based on, or
  • oligonucleotide is used to refer to a series of continguous nucleotides (a polynucleotide) of about 100 nucleotdies (nt) or less, e.g., portions of a nucleic acid sequence of about 100 nt, 50 nt, or 20 nt in length,
  • nucleotide sequences of about 15 nt to 30 nt in length.
  • the term “complementary” refers to Watson-Crick or Hoogsteen base pairing between nucleotide units of a nucleic acid molecule
  • binding means the physical or chemical interaction between two polypeptides or compounds or associated polypeptides or compounds or combinations thereof.
  • homologous nucleic acid sequence or “homologous amino acid sequence,” or variations thereof, refer to sequences characterized by a homology at the nucleotide level or amino acid level, respectively.
  • homologous nucleotide sequences encode those sequences coding for isoforms of cytoplasmic dynein heavy chainl
  • Isoforms can be expressed in different tissues ofthe same organism as a result of, for example, alternative splicing of RNA. Alternatively, isoforms can be encoded by different genes.
  • stringent hybridization conditions refers to conditions under which a probe, primer or oligonucleotide will hybridize to its target sequence, but to no other sequences. Stringent conditions are sequence-dependent and will be different in different circumstances. Longer sequences hybridize specifically at higher temperatures than shorter sequences. Generally, stringent conditions are selected to be about 5°C lower than the thermal melting point (Tm) for the specific sequence at a defined ionic strength and pH.
  • the Tm is the temperature (under defined ionic strength, pH and nucleic acid concentration) at which 50% ofthe probes complementary to the target sequence hybridize to the target sequence at equilibrium. Since the target sequences are generally present at excess, at Tm, 50% of the probes are occupied at equilibrium.
  • stringent conditions will be those in which the salt concentration is less than about 1.0 M sodium ion, typically about 0.01 to 1.0 M sodium ion (or other salts) at pH 7.0 to 8.3, and the temperature is at least about 30°C for short probes, primers or oligonucleotides (e.g., 10 nt to 50 nt) and at least about 60°C for longer probes, primers and oligonucleotides.
  • Stringent conditions may also be achieved with the addition of destabilizing agents, such as formamide.
  • Stringent conditions are known to those skilled in the art and can be found in Ausubel et al. (eds.), Current Protocols in Molecular Biology (John Wiley & Sons, New York, NY, USA, 1989) at 6.3.1-6.3.6.
  • the conditions are such that sequences at least about 65%, 70%, 75%, 85%, 90%, 95%, 98%, or 99% homologous to each other typically remain hybridized to each other.
  • a non-limiting example of stringent hybridization conditions are hybridization in a high salt buffer comprising 6X SSC, 50 mM Tris-HCl (pH 7.5), 1 mM EDTA, 0.02% PVP, 0.02% Ficoll, 0.02% BSA, and 500 mg/ml denatured salmon sperm DNA at 65°C, followed by one or more washes in 0.2X SSC, 0.01% BSA at 50°C.
  • ortholog denotes a polypeptide or protein obtained from one species that is the functional counterpart of a polypeptide or protein from a different species. Sequence differences among orthologs are the result of speciation.
  • the present invention also provides murine and human cytoplasmic dynein heavy chainl amino acid sequences (wild type polypeptides and muteins).
  • mutein applies to a protein arising as a result of a mutation.
  • the wild type murine cytoplasmic dynein heavy chainl amino acid sequence is shown in SEQ ID NO:2.
  • a mutated version wherein Tyr at position 1055 has been mutated to a Cys is shown in SEQ ID NO:4.
  • a prefened embodiment is of a human mutein with the same amino acid change at the conesponding position (native Tyr residue to mutant Cys residue at position 1057) in the sequence is shown in SEQ ID NO:6.
  • Another prefened embodiment is the wild type human dynein heavy chein 1 amino acid sequence, as shown in SEQ ID NO: 18.
  • the wild type residue of the modified human cytoplasmic dynein heavy chainl protein is replaced by an amino acid with different size and/or polarity, e.g., a non-conservative amino acid substitution.
  • residue 1055 of murine cytoplasmic dynein heavy chainl and residue 1057 of human cytoplasmic dynein heavy chainl according to the present invention is replaced by an amino acid other than Trp or Phe and preferably is replaced by an amino acid selected from Ala, Ser, Thr, Pro, Gly, Met, Leu, He, Nal, or Cys, more preferably by Met, Leu, He, Nal, or Cys, and most preferably by Cys.
  • the murine cytoplasmic dynein heavy chainl mutein of the present invention has the amino acid sequence shown in SEQ ID ⁇ O:4.
  • the human cytoplasmic dynein heavy chainl mutein ofthe present invention has the amino acid sequence shown in SEQ ID NO:6.
  • the present invention is not limited to muteins with a mutation of the residue at, e.g., position 1055 of the amino acid sequence shown in SEQ ID NO: 4, and it is not limited to the mutation of the residue at, e.g., position 1057 of the amino acid sequence shown in SEQ ID NO: 6 or at a conesponding position in other dynein heavy chain proteins (especially cytoplasmic dynein heavy chainl proteins from different species). Rather it encompasses additional muteins with modifications in the amino acid sequence of the mouse or human cytoplasmic dynein heavy chainl proteins as long as they impart a phenotype as described herein in connection with the animals. Such muteins, may comprise mutations, such as single or multiple further amino acid substitutions, deletions and insertions.
  • One embodiment of the invention relates to muteins wherein the amino acid residue affected by the mutation, e.g., a substimtion, deletion, or insertion, conesponds to a residue selected from the group of conserved amino acid residues between Leu302 (302L) and Phe 1140 (1140F) of the cytoplasmic dynein heavy chainl amino acid sequence, e.g., SEQ ID NO:2 (Mus musculus) specified in Table 19.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 302L.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 303K.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 305G.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 306K.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 307R.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 308F.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 309H.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 310A.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 31 IT.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 312N.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 314F.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 315D.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 317D.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 319G.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 320L.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 321K.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 322Q.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 324L.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 327N.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 329D.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 330 Y.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 33 IN.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 333L.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 334M.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 335K.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 337F.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 338P.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 342L.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 344S.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 345 A.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 346T.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 35 OK.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 354 A.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 3581.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 359F.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 361H.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 362L.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 363R.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 364K.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 366R.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 368T.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 369K.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 370Y.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 371P.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 373Q.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 374R.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 376L.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 378L.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 380E.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 381 A.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 3821.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 383S.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 384R.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 385D.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 386L.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 389Q.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 390L.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 39 IL.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 392K.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 393N.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 394L.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 399L.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 400M.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 406E.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 407F.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 41 IM.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 414C.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 418F.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 421W.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 422D.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 423D.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 424E.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 425Y.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 427K.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 43 IL.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 432L.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 433R.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 434D.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 4351.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 437K.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 439K.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 440R.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 445K.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 448W.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 454H.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 457L.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 460R.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 467F.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 468R.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 470Q.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 471H.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 472E.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 473 Q.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 475R.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 477N.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 4781.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 480R.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 48 IN.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 482L.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 483R.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 484P.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 519E.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 52 IN.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 524A.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 525 Y.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 526E.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 529K.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 531V.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 532D.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 534L.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 535D.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 543A.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 544W.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 545E.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 547A.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 549K.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 55 OR.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 551Y.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 5551.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 558N.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 559E.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 560T.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 5621.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 563T.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 566L.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 569Q.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 570L.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 575N.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 577N.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 578E.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 579M.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 580F.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 5821.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 583F.
  • a prefened mutein of the invention is one wherein the conserved amino acid . affected by said mutation is the amino acid 584S.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 585R.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 587N.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 588 A.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 589L.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 590F.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 592R.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 593P.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 5951.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 596R.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 597G.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 598 A.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 5991.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 60 IE.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 602Y.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 603 Q.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 604T.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 606L.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 6071.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 609R.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 6 ION.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 61 IK.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by saidm ⁇ tatioh ⁇ s the amino acid 613D.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 6141.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 617L.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 62 IF.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 639L.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 640P.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 641P.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 646W.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 655Q.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 656L.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 659Y.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 66 IK.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 662R.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 663N.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 664E.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 665D.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 666N.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 667L.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 668G.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 669K.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 671W.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 672E.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 674H.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 677G.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 680L.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 68 IK.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 683D.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 684G.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 685D.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 687F.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 690F.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 69 IL.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 697F.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 700W.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 704N.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 705 ⁇ .
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 7151.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 717T.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 73 IL.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 733L.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 736N.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 744L.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 746K.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 747E.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 748N.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 752K.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 755 G.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 756F.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 757R.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 758N.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 759P.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 760L.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 7621.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 763N.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 764 ⁇ .
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 766A.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 767H.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 768Q.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 769A.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 770N.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 771Q.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 774P.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 776A.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 778S.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 779L.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 7801.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 78 IE.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 784R.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 785T.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 802L.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 804 A.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 808K.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 816E.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 817G.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 820L.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 822 W.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 824S.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 825 Y.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 826K.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 828D.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 830Y.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 834L.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 836E.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 838N.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 842Q.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 843E.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 848L.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 849L.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 862L.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 865C.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 867Y.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 87 IT.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 876L.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 880Q.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 883N.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 884D.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 886L.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 888L.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 891 Y.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 892S.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 893 ⁇ .
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 894L.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 897W.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 898N.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 899N.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 90 IL.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 902D.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 906E.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 909L.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 912R.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 920W.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 92 IT.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 95 IP.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 955N.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 957V.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 963T.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 965Q.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 968Y.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 971P.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 975E.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 977R.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 987W.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1001R.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1003Q.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1017Y.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1019N.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1021L.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1025P.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1027G
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1031L.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1032E.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1035Y.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1048Y.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1052W.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1053L.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1055Y.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1056Q.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1058L.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1059W.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1062Q.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1063 A.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1070L.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1071 G.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1077W.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1081L.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 10841.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1088R.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1091F.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1092D.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1096T.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1102P.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1107Y.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1109K.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1111Q.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1113K.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1117K.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1118Y.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1119D.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1121 W.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1122H.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1123K.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1124E.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1126L.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1128K.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1129F
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1130G.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1134G.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1137W.
  • a prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1140F.
  • human muteins of the cytoplasmic dynein heavy chainl having mutations as described herein, e.g., canying a substitution, deletion, or insertion at a position within the human amino acid sequence conesponding to any of the above individualized conserved amino acids of the mouse amino acid sequence are likewise within the scope of the invention.
  • the conesponding human amino acids will, as they are conserved between, e.g. mouse and human, be identical while their relative position within the amino acid sequence may vary.
  • the skilled person will be readily able to identify the conesponding human amino acids, e.g., within SEQ ID NO: 18, or from Figures 9 or 10.
  • mutant proteins described by SEQ ID NO:4, and SEQ ID NO: 6 the skilled artisan will further appreciate that changes can be introduced by mutation into the nucleotide sequence encoding a dynein heavy chain polypeptide (e.g., the sequences of SEQ ID NO:3 and SEQ ID NO:5), thereby leading to changes in the amino acid sequence of the encoded dynein heavy chain proteins without altering properties of the mutant dynein heavy chain proteins.
  • nucleotide substitutions leading to amino acid substitutions at "non-essential" amino acid residues can be made in the sequence of SEQ ID NO: 3 and SEQ ID NO:5.
  • non-essential amino acid residue is a residue that can be altered from the wild-type sequence of a dynein heavy chain polypeptide without altering the biological activity, whereas an "essential" amino acid residue is required for biological activity.
  • amino acid residues that are conserved among the cytoplasmic dynein heavy chainl polypeptide or polypeptide fragments of the present invention are predicted to be particularly unamenable to alteration.
  • such alterations replace an amino acid with one of similar size and polarity (e.g., conservative substitution).
  • the polypeptide has at least 75 %, preferably at least 80 %, more preferably at least 90 %, even more preferably 95% and most preferably at least 99 % sequence identity with the wild type cytoplasmic dynein heavy chainl sequence.
  • the polypeptide is identical with the wild type sequence except for a replacement of the Tyr residue at position 1055 ofthe amino acid sequence, as shown in SEQ ID NO: 4.
  • the polypeptide is identical to the wild type sequence except for a replacement ofthe Tyr residue at position 1057 ofthe amino acid sequence, as shown in SEQ ID NO: 6 or at the conesponding position in other cytoplasmic dynein heavy chainl sequences.
  • Prefened modifications of the amino acid sequence in addition to the replacement at, e.g., position 1055 of the amino acid sequence shown in SEQ ID NO: 4, and at, e.g., position 1057 ofthe amino acid sequence shown in SEQ ID NO: 6, or at a conesponding position in other dynein heavy chains are at any of the positions which are conserved among the vertebrate dynein heavy chains as described in individualized manner in connection with the prefened muteins above.
  • Prefened modifications of the amino acid sequence in addition to the replacement at position 1055 of the amino acid sequence shown in SEQ ID NO: 4, and at position 1057 of the amino acid sequence shown in SEQ ID NO: 6, or at a conesponding position in other dynein heavy chains are at positions which are not conserved among the vertebrate dynein heavy chains.
  • Amino acids in the cytoplasmic dynein heavy chain 1 proteins of the present invention that are essential for function can be identified by methods known in the art, such as site-directed mutagenesis or alanine-scanning mutagenesis (Cunningham and Wells, Science 244:1081-1085, 1989). The latter procedure introduces single alanine mutations at every residue in the molecule. The resulting mutant molecules are then tested for biological activity such as receptor binding or in vitro proliferat ⁇ ve activity. Sites that are critical for ligand-receptor binding can also be determined by structural analysis such as crystallization, nuclear magnetic resonance or photoaffinity labeling (Smith et al., J. Mol. Biol. 224:899-904, 1992; de Nos et al., Science 255:306-312, 1992).
  • an “isolated” or “purified” polypeptide or protein or biologically-active portion thereof is substantially free of cellular material or other contaminating proteins from the cell or tissue source from which the polypeptide or protein is derived, or substantially free from chemical precursors or other chemicals when chemically synthesized.
  • the language “substantially free of cellular material” includes preparations of dynein heavy chain protein in which the protein is separated from cellular components of the cells from which it the protein is isolated or in which it is recombinantly produced.
  • a "mature" form of a polypeptide or protein may arise from a step of post-translational modification other than a proteolytic cleavage event.
  • additional processes include, by way of non-limiting example, glycosylation, myristoylation or phosphorylation.
  • a mature polypeptide or protein may result from the operation of only one of these processes, or a combination of any of them.
  • the sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in the sequence of a first amino acid or nucleic acid sequence for optimal alignment with a second comparison amino acid or nucleic acid sequence).
  • the amino acid residues or nucleotides at conesponding amino acid positions or nucleotide positions are then compared.
  • a position in the first sequence is occupied by the same amino acid residue or nucleotide as the conesponding position in the second sequence, then the molecules are homologous at that position (e.g., as used herein amino acid or nucleic acid "homology” is equivalent to amino acid or nucleic acid "identity").
  • the nucleic acid sequence homology may be determined as the degree of identity between two sequences.
  • the homology may be determined using computer programs known in the art, such as GAP software provided in the GCG program package. See, Needleman and Wunsch (1970) J Mol Biol 48, 443-453.
  • GAP software with the following settings for nucleic acid sequence comparison: GAP creation penalty of 5.0 and GAP extension penalty of 0.3
  • the coding region of the analogous nucleic acid sequences refened to above exhibits a degree of identity preferably of at least 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 99%, with the CDS (encoding) part ofthe DNA sequence shown in SEQ ID NOS:l, 3, 5, and 17.
  • sequence identity refers to the degree to which two polynucleotide or polypeptide sequences are identical on a residue-by-residue basis over a particular region of comparison.
  • percentage of sequence identity is calculated by comparing two optimally aligned sequences over that region of comparison, determining the number of positions at which the identical nucleic acid base (e.g., A, T, C, G, U, or I, in the case of nucleic acids) occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the region of comparison (e.g., the window size), and multiplying the result by 100 to yield the percentage of sequence identity.
  • substantially identical denotes a characteristic of a polynucleotide sequence, wherein the polynucleotide comprises a sequence that has at least 80 percent sequence identity, preferably at least 85 percent identity and often 90 to 95 percent sequence identity, more usually at least 99 percent sequence identity as compared to a reference sequence over a comparison region.
  • Percent identity refers to the percentage of sequence similarity found in a comparison of two or more amino acid or nucleic acid sequences. Percent identity can be determined electronically, e.g., by using the MEGALIGN program (DNASTAR, Inc., Madison WI, USA).
  • the MEGALIGN program can create alignments between two or more sequences according to different methods, e.g., the clustal method (see, for example, Higgins and Sharp (1988) Gene 73:237-244.
  • the clustal algorithm groups sequences into clusters by examining the distances between all pairs. The clusters are aligned pairwise and then in groups.
  • the percentage similarity between two amino acid sequences is calculated by dividing the length of sequence A, minus the number of gap residues in sequence A, minus the number of gap residues in sequence B, into the sum of the residue matches between sequence A and sequence B, times one hundred. Gaps of low homology or of no homology between the two amino acid sequences are not included in determining percentage similarity. Percent identity between nucleic acid sequences can also be counted or calculated by other methods known in the art, e.g., the method described in Hein (1990) Methods Enzymol 183, 626-645. Identity between sequences can also be determined by other methods known in the art, e.g., by varying hybridization conditions.
  • the comparison of two or more amino acid or nucleic acid sequences to determine sequence identity can be performed between ortholog sequences, preferably between mouse and human, more preferably between mouse, rat, and human sequences.
  • ortholog sequences preferably between mouse and human, more preferably between mouse, rat, and human sequences.
  • this amino acid or nucleotide is "evolutionary conserved" for the purpose of this invention.
  • the term "evolutionary conserved" also comprises amino acid substitutions, where an amino acid is replaced by another (i.e., different) amino acid that represents a conservative substitution as defined below.
  • Non-conservative substitutions are defined as exchanges of an amino acid by another amino acid listed in a different group of the five standard amino acid groups shown below:
  • Conservative substitutions are defined as exchanges of an amino acid by another amino acid listed within the same group of the five standard amino acid groups shown above. Three residues are parenthesized because of their special role in protein architecture. Gly is the only residue without a sidechain and therefore imparts flexibility to the chain. Pro has an unusual geometry which tightly constrains the chain. Cys can participate in disulfide bonds.
  • the cytoplasmic dynein heavy chainl expressed in the animal model of the present invention canies a mutation, which affects the conserved amino acids of the muteins described in individualized manner in connection with the prefened muteins ofthe invention above.
  • the cytoplasmic dynein heavy chainl expressed in the animal model of the present invention has the amino acid sequence shown in SEQ ID ⁇ O:4.
  • the cytoplasmic dynein heavy chainl expressed in the animal model of the present invention has an amino acid sequence selected from the sequences shown in SEQ ID NO:6 and SEQ ID NO: 18.
  • the invention also provides novel chimeric or fusion proteins as used herein, a novel "chimeric protein" or "fusion protein” comprises a novel cytoplasmic dynein heavy chainl polypeptide linked to a non-cytoplasmic dynein heavy chainl polypeptide (e.g., a polypeptide that does not comprise cytoplasmic dynein heavy chainl or a fragment therof).
  • the fusion protein is a GST-cytoplasmic dynein heavy chainl fusion protein in which the cytoplasmic dynein heavy chainl sequences are fused to the C-terminus ofthe GST (glutathione S-transferase) sequences.
  • GST glutthione S-transferase
  • Such fusion proteins can facilitate the purification of recombinant cytoplasmic dynein heavy chainl polypeptides.
  • the fusion protein is a cytoplasmic dynein heavy chainl -immunoglobulin fusion protein in which the cytoplasmic dynein heavy chainl sequences are fused to sequences derived from a member of the immunoglobulin protein family, especially Fc region polypeptides. Also contemplated are fusions of cytoplasmic dynein heavy chainl sequences (mutant or wild type or functional fragments) fused to amino acid sequences that are commonly used to facilitate purification or labeling, e.g. polyhistidine tails (especially hexahistidine segments), FLAG tags, streptavidin.
  • amino acid sequences of the present invention may be made by using peptide synthesis techniques well known in the art, such as solid phase peptide synthesis (see, for example, Fields et al. "Principles and Practice of Solid Phase Synthesis” in Synthetic Peptides, A Users Guide, Grant GA (ed.), (W.H. Freeman Co. New York NY, USA, 1992) at Chapter 3, pp. 77-183; Barlos K and Gatos D "Convergent Peptide Synthesis” in FMOC Solid Phase Peptide Synthesis, Chan WC and White PD (eds.), (Oxford University Press, New York NY, USA, 2000) at Chapter 9, pp. 215-228) or by recombinant DNA manipulations and recombinant expression.
  • solid phase peptide synthesis see, for example, Fields et al. "Principles and Practice of Solid Phase Synthesis” in Synthetic Peptides, A Users Guide, Grant GA (ed.), (W.H. Freeman Co. New York
  • Antibodies Also included in the invention are antibodies to fragments of cytoplasmic dynein heavy chainl polypeptides and muteins as described in individualized manner in connection with the prefened muteins of the invention above (including amino terminal fragments), as well as antibodies to fusion proteins containing cytoplasmic dynein heavy chainl polypeptides or fragments of cytoplasmic dynein heavy chainl polypeptides or muteins as described in individualized manner in connection with the prefened muteins of the invention above.
  • antibody refers to immunoglobulin molecules and immunologically active portions of immunoglobulin (Ig) molecules, e.g., molecules that contain an antigen binding site that specifically binds (immunoreacts with) an antigen.
  • Ig immunoglobulin
  • Such antibodies include, e.g., polyclonal, monoclonal, chimeric, single chain, F ab , F ab - and F( a b ' ) 2 fragments, and an F a expression library.
  • an antibody molecule obtained from humans relates to any of the classes IgG, IgM, IgA, IgE and IgD, which differ from one another by the nature ofthe heavy chain present in the molecule.
  • the light chain may be a kappa chain or a lambda chain.
  • Reference herein to antibodies includes a reference to all such classes, subclasses and types of human antibody species.
  • a cytoplasmic dynein heavy chainl polypeptide 1 of the invention may be intended to serve as an antigen, or a portion or fragment thereof, and additionally can be used as an immunogen to generate antibodies that immunospecifically bind the antigen, using standard techniques for polyclonal and monoclonal antibody preparation.
  • Antigenic peptide fragments of the antigen for use as immunogens includes, e.g., at least 7 amino acid residues ofthe amino acid sequence ofthe mutated region such as an amino acid sequence shown in SEQ ID NO:4 or SEQ ID NO:6, and encompasses an epitope thereof such that an antibody raised against the peptide forms a specific immune complex with the full length protein or with any fragment that contains the epitope.
  • the antigenic peptide comprises at least 10 amino acid residues, or at least 15 afhino acid residues, or at least 20 amino acid residues, or at least 30 amino acid residues.
  • Prefened epitopes encompassed by the antigenic peptide are regions of the protein that are located on its surface; commonly these are hydrophilic regions.
  • At least one epitope encompassed by the antigenic peptide is a region of cytoplasmic dynein heavy chainl polypeptide that is located on the surface of the protein, e.g., a hydrophilic region.
  • a hydrophobicity analysis of a cytoplasmic dynein heavy chainl polypeptide will indicate which regions of a cytoplasmic dynein heavy chainl protein are particularly hydrophilic and, therefore, are likely to encode surface residues useful for targeting antibody production.
  • hydropathy plots showing regions of hydrophilicity and hydrophobicity may be generated by any method well known in the art, including, for example, the Kyte Doolittle or the Hopp Woods methods, either with or without Fourier transformation. (See, for example, Hopp and Woods (1981) Proc Nat Acad Sci USA 78, 3824-3828; Kyte and Doolittle (1982) J Mol Biol 157, 105-142.)
  • Antibodies that are specific for one or more domains within an antigenic protein, or derivatives, fragments, analogs or homologs thereof, are also provided herein.
  • a protein of the invention may be utilized as an immunogen in the generation of antibodies that immunospecifically bind these protein components.
  • polyclonal antibodies For the production of polyclonal antibodies, various suitable host animals (e.g., rabbit, goat, mouse or other mammal) may be immunized by one or more injections with the protein of the invention, a synthetic variant thereof, or a derivative of the foregoing.
  • An appropriate immunogenic preparation can contain, for example, the naturally occuning immunogenic protein, a chemically synthesized polypeptide representing the immunogenic protein, or a recombinantly expressed immunogenic protein.
  • the protein may be conjugated to a second protein known to be immunogenic in the mammal being immunized. Examples of such immunogenic proteins include but are not limited to keyhole limpet hemocyanin, serum albumin, bovine thyroglobulin and soybean trypsin inhibitor.
  • the preparation can further include an adjuvant.
  • adjuvants used to increase the immunological response include, but are not limited to, Freund's (complete and incomplete), mineral gels (e.g., aluminum hydroxide), surface active substances (e.g., lysolecithin, pluronic polyols, polyanions, peptides, oil emulsions, dinitrophenol, etc.), adjuvants usable in humans such as Bacille Calmette-Guerin and Corynebacterium parvum, or similar immunostimulatory agents.
  • Additional examples of adjuvants which can be employed include MPL-TDM adjuvant (monophosphoryl Lipid A, synthetic trehalose dicorynomycolate).
  • the polyclonal antibody molecules directed against the immunogenic protein can be isolated from the mammal (e.g., from the blood) and further purified by well known techniques, such as affinity chromatography using protein A or protein G, which provide primarily the IgG fraction of immune serum. Subsequently, or alternatively, the specific antigen which is the target ofthe immunoglobulin sought, or an epitope thereof, may be immobilized on a column to purify the immune specific antibody by immunoaffinity chromatography. Purification of immunoglobulins is discussed, for example, by Wilkinson (Wilkinson (2000) The Scientist, 14, 25-28).
  • MAb monoclonal antibody
  • CDRs complementarity determining regions
  • MAbs thus contain an antigen binding site capable of immunoreacting with a particular epitope of the antigen, the antigen binding site being characterized by its unique binding affinity for this epitope.
  • the epitope may be characterized by its binding affinity for antigen binding sites of one or more particular MAbs having binding sites directed towards that epitope.
  • Monoclonal antibodies can be prepared using hybridoma methods, such as those described by Kohler and Milstein (1975) Nature 256, 495.
  • a hybridoma method a mouse, hamster, or other appropriate host animal, is typically immunized with an immunizing agent to elicit lymphocytes that produce or are capable of producing antibodies that will specifically bind to the immunizing agent.
  • the lymphocytes can be immunized in vitro.
  • the immunizing agent will typically include the protein antigen, a fragment thereof or a fusion protein thereof.
  • peripheral blood lymphocytes are used if cells of human origin are desired, or spleen cells or lymph node cells are used if non-human mammalian sources are desired.
  • the lymphocytes are then fused with an immortalized cell line using a suitable fusing agent, such as polyethylene glycol, to form a hybridoma cell (Goding, Monoclonal Antibodies: Principles and Practice (Academic Press / Elsevier Science Sidcup, Kent, UK, 1986) at pp. 59-103).
  • Immortalized cell lines are usually transformed mammalian cells, particularly myeloma cells of rodent, bovine and human origin.
  • rat or mouse myeloma cell lines are employed.
  • the hybridoma cells can be cultured in a suitable culture medium that preferably contains one or more substances that inhibit the growth or survival ofthe unfused, immortalized cells.
  • a suitable culture medium that preferably contains one or more substances that inhibit the growth or survival ofthe unfused, immortalized cells.
  • the culture medium for the hybridomas typically will include hypoxanthine, aminopterin, and thymidine (“HAT medium”), which substances prevent the growth of HGPRT- deficient cells.
  • Prefened immortalized cell lines are those that fuse efficiently, support stable high level expression of antibody by the selected antibody-producing cells, and are sensitive to a medium such as HAT medium. More prefened immortalized cell lines are murine myeloma lines, which can be obtained, for instance, from the Salk Institute Cell Distribution Center, San Diego, California and the American Type Culture Collection, Manassas, Virginia. Human myeloma and mouse-human heteromyeloma cell lines also have been described for the production of human monoclonal antibodies (Kozbor (1984) J Immunol, 133, 3001; Brön et al., Monoclonal Antibody Production Techniques and Applications (Marcel Dekker, Inc., New York NY, USA, 1987) at pp. 51-63).
  • the culture medium in which the hybridoma cells are cultured can then be assayed for the presence of monoclonal antibodies directed against the antigen.
  • the binding specificity of monoclonal antibodies produced by the hybridoma cells is determined by immunoprecipitation or by an in vitro binding assay, such as radioimmunoassay (RIA) or enzyme-linked immunoabsorbent assay (ELISA). Such techniques and assays are known in the art.
  • the binding affinity of the monoclonal antibody can, for example, be determined by the Scatchard analysis of Munson and Pollard (1980) Anal. Biochem., 107:220.
  • antibodies having a high degree of specificity and a high binding affinity for the target antigen are isolated.
  • the clones can be subcloned by limiting dilution procedures and grown by standard methods. Suitable culture media for this purpose include, for example, Dulbecco's Modified Eagle's Medium and RPMI- 1640 medium. Alternatively, the hybridoma cells can be grown in vivo as ascites in a mammal.
  • the monoclonal antibodies secreted by the subclones can be isolated or purified from the culture medium or ascites fluid by conventional immunoglobulin purification procedures such as, for example, protein A-Sepharose, hydroxylapatite chromatography, gel electrophoresis, dialysis, or affinity chromatography.
  • the monoclonal antibodies can also be made by recombinant DNA methods, such as those described in U.S. Patent No. 4,816,567.
  • DNA encoding the monoclonal antibodies of the invention can be readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of murine antibodies).
  • the hybridoma cells of the invention serve as a prefened source of such DNA.
  • the DNA can be placed into expression vectors, which are then transfected into host cells such as simian COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not otherwise produce immunoglobulin protein, to obtain the synthesis of monoclonal antibodies in the recombinant host cells.
  • host cells such as simian COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not otherwise produce immunoglobulin protein, to obtain the synthesis of monoclonal antibodies in the recombinant host cells.
  • the DNA also can be modified, for example, by substituting the coding sequence for human heavy and light chain constant domains in place of the homologous murine sequences (U.S. Patent No. 4,816,567; Morrison (1994) Nature 368, 812-13) or by covalently joining to the immunoglobulin coding sequence all or part of the coding sequence for a non- immunoglobulin polypeptide.
  • non-immunoglobulin polypeptide can be substituted for the constant domains of an antibody of the invention, or can be substituted for the variable domains of one antigen-combining site of an antibody of the invention to create a chimeric bivalent antibody.
  • the antibodies directed against the protein antigens of the mvention can further comprise humanized antibodies or human antibodies. These antibodies are suitable for administration to humans without engendering an immune response by the human against the administered immunoglobulin.
  • Humanized forms of antibodies are chimeric immunoglobulins, immunoglobulin chains or fragments thereof (such as Fv, Fab, Fab', F(ab') or other antigen-binding subsequences of antibodies) that are principally comprised of the sequence of a human immunoglobulin and contain minimal sequence derived from a non-human immunoglobulin. Humanization can be performed following the method of Winter and co-workers (Jones et al. (1986) Nature 321, 522-525; Riechmann et al.
  • the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDR regions conespond to those of a non-human immunoglobulin and all or substantially all of the framework regions are those of a human immunoglobulin consensus sequence.
  • the humanized antibody optimally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin (Jones et al. (1986) Nature 321, 522-525; Riechmann et al. (1988) Nature 332, 323-327; and Presta (1992) Cun Op Struct Biol 2, 593-596).
  • Fully human antibodies relate to antibody molecules in which essentially the entire sequences of both the light chain and the heavy chain, including the CDRs, arise from human genes. Such antibodies are termed "human antibodies", or “fully human antibodies” herein.
  • Human monoclonal antibodies can be prepared by the trioma technique; the human B-cell hybridoma technique (see Kozbor et al. (1983) Immunol Today 4, 72) and the EBV hybridoma technique to produce human monoclonal antibodies (see Cole et al. in: Monoclonal Antibodies and Cancer Therapy (Alan R. Liss, Inc., New York NY, USA, 1985) at pp. 77-96).
  • Human monoclonal antibodies may be utilized in the practice of the present invention and may be produced by using human hybridomas (see Cote et al. (1983) Proc Natl Acad Sci USA 80, 2026-2030) or by transforming human B-cells with Epstein Ban Virus in vitro (see Cole et ⁇ /.in: Monoclonal Antibodies and Cancer Therapy (Alan R. Liss, Inc., New York NY, USA, 1985) at pp. 77-96).
  • human antibodies can also be produced using additional techniques, including phage display libraries (Hoogenboom and Winter (1992) J Mol Biol 227, 381-388; Marks et al. (1991) J Mol Biol 222, 581-597).
  • human antibodies can be made by introducing human immunoglobulin loci into transgenic animals, e.g., mice in which the endogenous immunoglobulin genes have been partially or completely inactivated. Upon challenge, human antibody production is observed, which closely resembles that seen in humans in all respects, including gene reanangement, assembly, and antibody repertoire. This approach is described, for example, in U.S. Patents No.
  • Human antibodies may additionally be produced using transgenic nonhuman animals which are modified so as to produce fully human antibodies rather than the animal's endogenous antibodies in response to challenge by an antigen (see PCT publication WO94/02602).
  • the endogenous genes encoding the heavy and light immunoglobulin chains in the nonhuman host have been incapacitated, and active loci encoding human heavy and light chain immunoglobulins are inserted into the host's genome.
  • the human genes are incorporated, for example, using yeast artificial chromosomes containing the requisite human DNA segments. An animal which provides all the desired modifications is then obtained as progeny by crossbreeding intermediate transgenic animals containing fewer than the full complement of the modifications.
  • the prefened embodiment of such a nonhuman animal is a mouse, and is termed the XenomouseTM as disclosed in PCT publications WO-A-96/33735 and WO-A-96/34096.
  • This animal produces B cells which secrete fully human immunoglobulins.
  • the antibodies can be obtained directly from the animal after immunization with an immunogen of interest, as, for example, a preparation of a polyclonal antibody, or alternatively from immortalized B cells derived from the animal, such as hybridomas producing monoclonal antibodies.
  • the genes encoding the immunoglobulins with human variable regions can be recovered and expressed to obtain the antibodies directly, or can be further modified to obtain analogs of antibodies such as, for example, single chain Fv molecules.
  • a method of producing a nonhuman host exemplified as a mouse, lacking expression of an endogenous immunoglobulin heavy chain is disclosed in U.S. Patent No. 5,939,598.
  • Such a host can be obtained by a method including deleting the J segment genes from at least one endogenous heavy chain locus in an embryonic stem cell to prevent reanangement of the locus and to prevent formation of a transcript of a reananged immunoglobulin heavy chain locus, the deletion being effected by a targeting vector containing a gene encoding a selectable marker; and producing from the embryonic stem cell a transgenic mouse whose somatic and germ cells contain the gene encoding the selectable marker.
  • a method for producing an antibody of interest is disclosed in U.S. Patent No. 5,916,771.
  • the method includes introducing an expression vector that contains a nucleotide sequence encoding a heavy chain into one mammalian host cell in culture, introducing an expression vector containing a nucleotide sequence encoding a light chain into another mammalian host cell, and fusing the two cells to form a hybrid cell.
  • the hybrid cell expresses an antibody containing the heavy chain and the light chain.
  • Fgh Fragments and Single Chain Antibodies can be adapted for the production of single-chain antibodies specific to an antigenic protein of the invention (see for example U.S. Patent No. 4,946,778).
  • methods can be adapted for the construction of F ab expression libraries (see for example Huse et al. (1989) Science 246, 1275-1281) to allow rapid and effective identification of monoclonal F ab fragments with the desired specificity for a protein or derivatives, fragments, analogs or homologs thereof.
  • Antibody fragments that contain the idiotypes to a protein antigen may be produced by techniques known in the art including, but not limited to: (i) an F( ab')2 fragment produced by pepsin digestion of an antibody molecule; (ii) an F ab fragment generated by reducing the disulfide bridges of an F( ab')2 fragment;
  • Bispecific antibodies are monoclonal, preferably human or humanized, antibodies that have binding specificities for at least two different antigens.
  • one of the binding specificities is for an antigenic protein of the invention.
  • the second binding target is any other antigen, and advantageously is a cell-surface protein or receptor or receptor subunit.
  • bispecific antibodies are known in the art. Traditionally, the recombinant production of bispecific antibodies is based on the co-expression of two immunoglobulin heavy-chain/light-chain pairs, where the two heavy chains have different specificities (Milstein and Cuello (1983) Nature 305, 537-539). Because of the random assortment of immunoglobulin heavy and light chains, these hybridomas (quadromas) produce a potential mixture often different antibody molecules, of which only one has the conect bispecific structure. The purification of the conect molecule is usually accomplished by affinity chromatography steps. Similar procedures are disclosed in WO-A-93/08829 and in Traunecker et al. (1991) EMBO J 10, 3655- 3659.
  • Antibody variable domains with the desired binding specificities can be fused to immunoglobulin constant domain sequences.
  • the fusion preferably is with an immunoglobulin heavy-chain constant domain, comprising at least part of the hinge, CH2, and CH3 regions. It is prefened to have the first heavy chain constant region (CHI) containing the site necessary for light- chain binding present in at least one of the fusions.
  • CHI first heavy chain constant region
  • the interface between a pair of antibody molecules can be engineered to maximize the percentage of heterodimers which are recovered from recombinant cell culture.
  • the prefened interface comprises at least a part ofthe CH3 region of an antibody constant domain.
  • one or more small amino acid side chains from the interface of the first antibody molecule are replaced with larger side chains (e.g. tyrosine or tryptophan).
  • Compensatory "cavities" of identical or similar size to the large side chain(s) are created on the interface of the second antibody molecule by replacing large amino acid side chains with smaller ones (e.g. alanine or threonine). This provides a mechanism for increasing the yield ofthe heterodimer over other unwanted end-products such as homodimers.
  • Bispecific antibodies can be prepared as full length antibodies or antibody fragments (e.g. F(ab') 2 bispecific antibodies). Techniques for generating bispecific antibodies from antibody fragments have been described in the literature. For example, bispecific antibodies can be prepared using chemical linkage. Brennan et al. ((1985) Science 229, 81) describe a procedure wherein intact antibodies are proteolytically cleaved to generate F(ab') 2 fragments. These fragments are reduced in the presence of the dithiol complexing agent sodium arsenite to stabilize vicinal dithiols and prevent intermolecular disulfide formation. The Fab' fragments generated are then converted to thionitrobenzoate (TNB) derivatives.
  • TAB thionitrobenzoate
  • One of the Fab'-TNB derivatives is then reconverted to the Fab'-thiol by reduction with mercaptoethylamine and is mixed with an equimolar amount of the other Fab'-TNB derivative to form the bispecific antibody.
  • the bispecific antibodies produced can be used as agents for the selective immobilization of enzymes.
  • Fab' fragments can be recovered directly from E. coli and chemically coupled to form bispecific antibodies.
  • Shalaby et al. ((1992) J Exp Med 175, 217-225) describe the production of a fully humanized bispecific antibody F(ab') 2 molecule.
  • Each Fab' fragment was secreted separately from E. coli and subjected to directed chemical coupling in vitro to form the bispecific antibody.
  • the bispecific antibody thus formed was able to bind to cells overexpressing the ErbB2 receptor and normal human T cells, as well as trigger the lytic activity of human cytotoxic lymphocytes against human breast tumor targets.
  • bispecific antibodies have been produced using leucine zippers.
  • the leucine zipper peptides from the Fos and Jun proteins were linked to the Fab' portions of two different antibodies by gene fusion.
  • the antibody homodimers were reduced at the hinge region to form monomers and then re-oxidized to form the antibody heterodimers. This method can also be utilized for the production of antibody homodimers.
  • the fragments comprise a heavy-chain variable domain (VH) connected to a light-chain variable domain (V ) by a linker which is too short to allow pairing between the two domains on the same chain. Accordingly, the VH and V L domains of one fragment are forced to pair with the complementary V and VH domains of another fragment, thereby forming two antigen-binding sites.
  • VH heavy-chain variable domain
  • V L domains of one fragment are forced to pair with the complementary V and VH domains of another fragment, thereby forming two antigen-binding sites.
  • sFv single-chain Fv
  • Antibodies with more than two valencies are contemplated.
  • trispecific antibodies can be prepared (Tutt et al. (1991) J Immunol 147, 60-69).
  • bispecific antibodies can bind to two different epitopes, at least one of which originates in the protein antigen of the invention.
  • an anti-antigenic arm of an immunoglobulin molecule can be combined with an arm which binds to a triggering molecule on a leukocyte such as a T-cell receptor molecule (e.g. CDl, CD3, CD28, or B7), or Fc receptors for IgG (Fc R), such as Fc RI (CD64), Fc RII (CD32) and Fc RIII (CD 16) so as to focus cellular defense mechanisms to the cell expressing the particular antigen.
  • Bispecific antibodies can also be used to direct cytotoxic agents to cells which express a particular antigen.
  • antibodies possess an antigen-binding arm and an arm which binds a cytotoxic agent or a radionuclide chelator, such as EOTUBE, DPTA, DOTA, or TETA.
  • a cytotoxic agent or a radionuclide chelator such as EOTUBE, DPTA, DOTA, or TETA.
  • Another bispecific antibody of interest binds the protein antigen described herein and further binds tissue factor (TF).
  • Heteroconjugate antibodies are also within the scope of the present invention.
  • Heteroconjugate antibodies are composed of two covalently joined antibodies. Such antibodies have, for example, been proposed to target immune system cells to unwanted cells (U.S. Patent No. 4,676,980), and for treatment of HIV infection (WO- A-91/00360; WO-A-92/20373; EP-A3-0308936).
  • the antibodies can be prepared in vitro using known methods in synthetic protein chemistry, including those involving crosslinking agents.
  • immunotoxins can be constructed using a disulfide exchange reaction or by forming a thioether bond. Examples of suitable reagents for this purpose include iminothiolate and methyl-4- mercaptobutyrimidate and those disclosed, for example, in U.S. Patent No. 4,676,980.
  • the antibody of the invention can be desirable to modify the antibody of the invention with respect to effector function, so as to enhance, e.g., the effectiveness of the antibody.
  • cysteine residue(s) can be introduced into the Fc region, thereby allowing interchain disulfide bond formation in this region.
  • the homodimeric antibody thus generated can have improved internalization capability and/or increased complement- mediated cell killing and antibody-dependent cellular cytotoxicity (ADCC) (see Caron et al. (1992) J Exp Med 176; 1191-1195 and Shopes (1992) J Immunol 148, 2918- 2922).
  • ADCC antibody-dependent cellular cytotoxicity
  • Homodimeric antibodies with enhanced anti-tumor activity can also be prepared using heterobifunctional cross-linkers as described in Wolff et al.
  • an antibody can be engineered that has dual Fc regions and can thereby have enhanced complement lysis and ADCC capabilities (see Stevenson et al. (1989) Anti-Cancer Drug Design 3, 219-230).
  • the invention also pertains to immunoconjugates comprising an antibody conjugated to a cytotoxic agent such as a chemotherapeutic agent, toxin (e.g., an enzymatically active toxin of bacterial, fungal, plant, or animal origin, or fragments thereof), or a radioactive isotope (e.g., a radioconjugate).
  • a cytotoxic agent such as a chemotherapeutic agent, toxin (e.g., an enzymatically active toxin of bacterial, fungal, plant, or animal origin, or fragments thereof), or a radioactive isotope (e.g., a radioconjugate).
  • Enzymatically active toxins and fragments thereof that can be used include diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain (from Pseudomonas aeruginosa), ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins, dianthin proteins, Phytolaca americana proteins (PAPI, PAPII, and PAP-S), momordica charantia inhibitor, curcin, crotin, sapaonaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, enomycin, and the tricothecenes.
  • diphtheria A chain nonbinding active fragments of diphtheria toxin
  • exotoxin A chain from Pseudomonas aeruginosa
  • ricin A chain abrin A chain
  • modeccin A chain alpha-
  • radionuclides are available for the production of radioconjugated antibodies. Examples include 212 Bi, 131 1, 131 In, 90 Y, and 186 Re. Conjugates of the antibody and cytotoxic agent are made using a variety of bifunctional protein-coupling agents such as N-succinimidyl-3-(2-pyridyldithiol) propionate (SPDP), iminothiolane (IT), bifunctional derivatives of imidoesters (such as dimethyl adipimidate HCL), active esters (such as disuccinimidyl suberate), aldehydes (such as glutareldehyde), bis-azido compounds (such as bis (p- azidobenzoyl) hexanediamine), bis-diazonium derivatives (such as bis-(p- diazoniumbenzoyl)-ethylenediamine), diisocyanates (such as tolyene 2,6- diisocyanate), and bis-active fluor
  • a ricin immunotoxin can be prepared as described in Vitetta et al. (1987) Science 238, 1098-1104.
  • Carbon- 14-labeled 1- isothiocyanatobenzyl-3-methyldiethylene triaminepentaacetic acid (MX-DTPA) is an exemplary chelating agent for conjugation of radionucleotide to the antibody (see WO-A-94/11026).
  • the antibody in another embodiment, can be conjugated to a "receptor" (such streptavidin) for utilization in tumor pretargeting wherein die antibody-receptor conjugate is administered to the patient, followed by removal of unbound conjugate from the circulation using a clearing agent and then administration of a "ligand” (e.g., avidin) that is in turn conjugated to a cytotoxic agent.
  • a "receptor” such streptavidin
  • a "ligand” e.g., avidin
  • vectors preferably expression vectors, containing a nucleic acid encoding a cytoplasmic dynein heavy chainl protein or a mutein as described in individualized manner in connection with the prefened muteins of the invention above, or derivatives, fragments, analogs or homologs thereof.
  • vector refers to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked.
  • plasmid which refers to a circular double stranded circular DNA molecule into which additional DNA segments can be ligated.
  • viral vector Another type of vector, wherein additional DNA segments can be ligated into the viral genome.
  • vectors are capable of autonomous replication in a host cell into which they are introduced (e.g. bacterial vectors having a bacterial origin of replication and episomal mammalian vectors).
  • Other vectors e.g., non-episomal mammalian vectors
  • certain vectors are capable of directing the expression of genes to which they are operatively-linked. Such vectors are refened to herein as "expression vectors”.
  • a host cell of the invention such as a prokaryotic or eukaryotic host cell in culture, can be used to produce (e.g., express) cytoplasmic dynein heavy chainl protein or mutein as described in individualized manner in connection with the prefened muteins ofthe invention above. Accordingly, the invention further provides methods for producing cytoplasmic dynein heavy chainl protein or mutein using the host cells of the invention.
  • the method comprises culturing the host cell of invention (into which a recombinant expression vector encoding cytoplasmic dynein heavy chainl protein has been introduced) in a suitable medium such that cytoplasmic dynein heavy chainl protein or mutein is produced.
  • the method further comprises isolating cytoplasmic dynein heavy chainl protein or mutein from the medium or the host cell.
  • a host cell of the invention can also be used to produce non-human transgenic animals.
  • a host cell ofthe invention is a fertilized oocyte or an embryonic stem cell into which cytoplasmic dynein heavy chainl protein- or cytoplasmic dynein heavy chainl mutein-coding sequences have been introduced.
  • Such host cells can then be used to create non-human transgenic animals in which exogenous cytoplasmic dynein heavy chainl sequences have been introduced into their genome or homologous recombinant animals in which endogenous cytoplasmic dynein . heavy chainl sequences have been altered.
  • a "transgenic animal” is a non-human animal, preferably a mammal, more preferably a rodent such as a rat or mouse, which contains one or more cells bearing genetic information (a transgene), received, directly or indirectly, by deliberate genetic manipulation at the subcellular level, such as by microinjection or transfection with recombinant DNA, or infection with a recombinant virus.
  • transgenic animals include non-human primates; ungulates such as cows, horses, goats, sheep; dogs, cats, and also chickens, amphibians, etc. Standard methods are known in the art that may be used in conjunction with the polynucleotides and of the invention and methods described herein to produce a transgenic animal expressing a modified cytoplasmic dynein e heavy chainl ofthe invention.
  • transgene is a foreign gene that has been artificially introduced into the genome of of an non human organism.
  • a transgene present in germ cells is inherited by offspring. If such offspring in fact possesses the transgene, they too are transgenic animal.s A transgene present only in somatic cells is nor passed on to the gametes.
  • transgenic describes an organism whose genome incorporates and expresses genes from another species.
  • the present invention provides a non-human animal model which expresses a cytoplasmic dynein heavy chainl protein modified as described herein, e.g. for the muteins described in individualized manner in connection with the prefened muteins above, as compared to the amino acid sequence of the wild type protein.
  • the cytoplasmic dynein heavy chainl expressed may have similarity in sequence and secondary structure to a vertebrate dynein heavy chain, including, but not limited to mammalian dynein heavy chain proteins, preferably of bovine, rat, and preferably mouse origin.
  • the animal is preferably from a genus selected from the group consisting of Mus (e.g., mice), Rattus (e.g., rats), Oryctologus (e.g., rabbits) and Mesocricetus (e.g., hamsters).
  • Mus e.g., mice
  • Rattus e.g., rats
  • Oryctologus e.g., rabbits
  • Mesocricetus e.g., hamsters
  • the animal is a mouse.
  • Animals canying a mutated cytoplasmic dynein heavy chainl allele expressing the modified cytoplasmic dynein heavy chainl proteins ofthe invention exhibit a variety of phenotypical features including: myoclonic cramps (which are especially pronounced in the hindlimbs), movement hyperactivity, reduced muscle endurance, excitatory neuronal damage ("dark neurons") in the hippocampus (gyrus dentatus, CA4, CA3) as well as in the upper layer ofthe cortex and in the Purkinje cell layer ofthe cerebellum.
  • homozygous individuals Compared with heterozygous animals, homozygous individuals exhibit an elevated incidence of perinatal lethality (100% in homozygous animals, versus approximately 20% amongst heterozygous animals), accelerated neurondegeneration in the anterior horns of the spinal cord, and accelerated neurodegeneration in the dorsal root ganglia. Neurodegeneration in heterozygous animals is apparent at a much later stage, i.e. late adulthood.
  • phenotype refers to a collection of morphological, physiological, behavioral and biochemical traits possessed by a cell or organism that results from the interaction ofthe genotype and the environment.
  • the animal model of the present invention displays readily observable abnormalities.
  • the animal of the invention shows at least 2, preferably at least 4, more preferably 6 and most preferably all of the above listed phenotypical features.
  • mice were generated carrying a point mutation in the thirteenth exon (exon 13) ofthe mouse cytoplasmic dynein heavy chainl gene, which is illustrated in SEQ ID NO:l, thereby replacing the tyrosine residue at position 1055 in the N-terminal domain of the protein.
  • This modification results in the above mentioned phenotypical features.
  • Amino acid position 1055 according to the present invention refers to the non-mature cytoplasmic dynein heavy chainl protein, as numbered in SEQ ID NO:4.
  • the mature protein is encompassed by the present invention and may be expressed in the animal model of the present invention.
  • a mature protein may result from a cleavage of several amino acids, and therefore may alter the numbering of the amino acids in the mature protein relative to the numbering of an unprocessed protein.
  • the tyrosine residue conesponding to the Tyr located at position 1055 in the amino acid sequence of SEQ ID NO:2 is conserved among the cytoplasmic dynein heavy chain proteins of different species as can be seen in the alignment in Table 9.
  • the non-human animal model of the present invention canies, e.g., a nucleic acid sequence encoding cytoplasmic dynein heavy chainl, whereby the codon for the amino acid at position 1055 of the amino acid sequence shown in SEQ ID NO:2 or the codon conesponding to said position in other dynein heavy chain proteins (especially cytoplasmic dynein heavy chainl proteins), like position 1057 of the amino acid sequence shown in SEQ ID NO: 18, which encodes a Tyr in the wild type, is mutated to encode a different amino acid.
  • the animal model of the present invention expresses the amino acid sequence shown in SEQ ID NO:4.
  • the animal model of the invention canies a modified cytoplasmic dynein heavy chainl nucleic acid sequence derived from a vertebrate, preferably from a mammal, in particular from mouse, for example, a cytoplasmic dynein heavy chainl nucleic acid sequence encoding a cytoplasmic dynein heavy chainl mutein as described in individualized manner in connection with the prefened muteins of the invention above.
  • the nucleic acid sequence is derived from the nucleic acid sequence of SEQ ID NO:l, 3, 5, or 17.
  • the animal model of the invention preferably expresses a modified cytoplasmic dynein heavy chainl protein of the invention (e.g. as shown in SEQ ID NO:4, or SEQ ID NO:6 or a mutein as described in individualized manner in connection with the prefened muteins above) in all of its cells, and particularly in the brain and spinal cord.
  • a modified cytoplasmic dynein heavy chainl protein of the invention e.g. as shown in SEQ ID NO:4, or SEQ ID NO:6 or a mutein as described in individualized manner in connection with the prefened muteins above
  • animals which express the modified cytoplasmic dynein heavy chainl protein in some, but not all cells which are termed cellular mosaic animals, are also contemplated.
  • the present invention further provides for inbred successive lines of animals carrying the mutant cytoplasmic dynein heavy chainl nucleic acid of the present invention that offer the advantage of providing a virtually homogenous genetic background.
  • a genetically homogenous line of animals provides a functionally reproducible model system for disorders or symptoms associated with movement hyperactivity, hyperexcitability disorders (e.g. myoclonic cramping, epilepsy), excitotoxicity disorders and neurodegeneration; over-activity or undesirable activity of endogenous cytoplasmic dynein heavy chainl ; over-expression, over-production or undesirable production of endogenous cytoplasmic dynein heavy chainl; excessive or undesirable condition shown to be modulated by endogenous cytoplasmic dynein heavy chainl .
  • the animal model of the present invention may use any of the cytoplasmic dynein heavy chainl muteins described herein, e.g., those described in an individualized manner in connection with the prefened muteins of the invention above, and is not limited to the modification of the residue at position 1055 of the amino acid sequence shown in SEQ ID NO:4 or at a conesponding position in other dynein heavy chain orthologs (e.g. position 1057 ofthe amino acid sequence shown in SEQ ID NO:6) so long as the mutein used imparts the desired mutant dynein phenotype to the animal ofthe present invention.
  • Suitable muteins include those with modifications in the amino acid sequence of the mouse or human cytoplasmic dynein heavy chainl proteins so long as they impart a phenotype as described herein in connection with the animals ofthe invention.
  • Such muteins may comprise mutations, such as single or multiple further amino acid substitutions, deletions and insertions, particularly mutations that affect the conserved amino acids of mouse or human cytoplasmic dynein heavy chainl, as described, e.g., in an individualized manner in connection with the prefened muteins ofthe invention above.
  • Amino acid insertional derivatives ofthe present invention include amino and or carboxyl terminal fusions as well as intra-sequence insertions of single or multiple amino acids.
  • Insertional amino acid sequence variants are those in which one or more amino acid residues are introduced into a predetermined site in the protein although random insertion is also possible with suitable screening of the resulting product.
  • Deletional variants are characterized by the removal of one or more amino acids from the sequence.
  • Substitutional amino acid variants are those in which at least one residue in the sequence has been removed and a different residue inserted in its place.
  • the cytoplasmic dynein heavy chainl expressed in the animal model of the invention has a degree of identity preferably of at least 70%, 75%, 80%, 85%, 90%, 95%, 98%, or most preferably 99%, with the wild type cytoplasmic dynein heavy chainl sequence from vertebrate, preferably from mammals, most preferably from bovine, and from rat and even most preferably from mouse (SEQ ID NO:2), excluding the wild type mouse cytoplasmic dynein heavy chainl sequence itself.
  • the cytoplasmic dynein heavy chainl expressed in the animal model of the invention is human cytoplasmic dynein heavy chainl (SEQ ID NO: 18) or has a degree of identity preferably of at least 70%, 75%, 80%, 85%, 90%, 95%, 98%, or most preferably 99%, with the human cytoplasmic dynein heavy chainl sequence in SEQ ID NO: 18 (e.g. SEQ ID NO:6).
  • the human wild type cytoplasmic dynein heavy chainl sequence is a further embodiment ofthe invention.
  • the animal model expresses a polypeptide as shown in SEQ ID NO:4.
  • Further prefened embodiments include the animal model ofthe invention, that expresses a polypeptide selected from those shown in SEQ ID NO:6 and SEQ ID NO: 18.
  • Prefened modifications of the cytoplasmic dynein heavy chainl amino acid sequence in the animal models of the present invention in addition to the modification at, e.g, position 1055 of the amino acid sequence shown in SEQ ID NO:4, (or in addition to the modification in the equivalent position 1057 of the amino acid sequence shown in SEQ ID NO:6) are at positions which are conserved among the vertebrate dynein heavy chain proteins (especially those conserved among vertebrate cytoplasmic dynein heavy chainl proteins), as described in individualized manner in connection with the prefened muteins above.
  • Another prefened modification ofthe cytoplasmic dynein heavy chainl amino acid sequence in the animal models of the present invention in addition to the modification at position 1055 ofthe amino acid sequence shown in SEQ ID NO:4, (or in addition to the modification in the equivalent position 1057 of the amino acid sequence shown in SEQ ID NO: 6) are at positions which are not conserved among the vertebrate dynein heavy chain proteins (especially those not conserved among vertebrate cytoplasmic dynein heavy chainl proteins), as described above.
  • the animal model of the invention may carry a mutated cytoplasmic dynein heavy chainl nucleic acid according to the present invention derived from the same species or from a different species.
  • the mutated cytoplasmic dynein heavy chainl nucleic acid of the present invention is homozygous in the animals of the present invention.
  • transcription of the mutated cytoplasmic dynein heavy chainl gene of the present invention is under the control of the promoter sequence controlling transcription of the endogenous wild type cytoplasmic dynein heavy chainl sequence of the animal, although a different promoter may be used.
  • the animals of the invention can be produced by using any technique known to the person skilled in the art; including but not limited to micro-injection, electroporation, cell gun, cell fusion, micro-injection into embryos of teratocarcinoma stem cells or functionally equivalent embryonic stem cells.
  • the animals ofthe present invention may be produced by the application of procedures which result in an animal with a genome that incorporates and/or integrates exogenous genetic material in such a manner as to modify or disrupt the function ofthe normal cytoplasmic dynein heavy chainl gene or protein. The prefened procedure for generating animal models of this invention as described in Example 1.
  • the procedure may involve obtaining genetic material, or a portion thereof, which encodes a cytoplasmic dynein heavy chainl.
  • the isolated native sequence is then genetically manipulated by the insertion of a mutation appropriate to replace the residue at position 1055 of the amino acid sequence shown in SEQ ID NO:2.
  • the manipulated construct may then be inserted into embryonic stem cells, e.g. by electroporation.
  • the cells subjected to said procedure are screened to find positive cells, e.g. cells which have integrated into their genome the desired construct encoding an altered cytoplasmic dynein heavy chainl .
  • the positive cells may be isolated, cloned (or expanded) and injected into blastocysts obtained from a host animal ofthe same species or a different species. For example, positive cells are injected into blastocysts from mice, the blastocysts are then transfened into a female host animal and allowed to grow to term, following which the offspring of the female are tested to determine which animals are transgenic, e.g. which animals have an inserted exogenous mutated DNA sequence.
  • One method involves the introduction of the recombinant gene at the fertilized oocyte stage ensuring that the gene sequence will be present in all ofthe germ cells and somatic cells ofthe "founder" animal.
  • the term "founder animal” as used herein means the animal into which the recombinant gene was introduced at the one cell embryo stage.
  • the animals ofthe invention can also be used as a source of primary cells from a variety of tissues, for cell culture experiment, including but not restricted to, the production of immortalized cell lines by any methods known in the art, such as retroviral transformation.
  • Cells from the animals may advantageously exhibit desirable properties of both normal and transformed cultured cells, e.g. they will be normal or nearly normal morphologically and physiologically, but can be cultured for long, and perhaps indefinite periods of time.
  • the present invention provides such primary cells and cell lines derived therefrom, obtained from the animals of the present invention. These primary cells or cell lines derived thereof may be used for the construction of an animal model ofthe present invention.
  • cell lines may be prepared by the insertion of a nucleic acid construct comprising the nucleic acid sequence of the invention or a fragment thereof comprising the codon imparting the above-described phenotype to the animal model of the invention (vide infra).
  • Suitable cells for the insertion include primary cells harvested from an animal as well as cells which are members of an immortalized cell line.
  • Recombinant nucleic acid constructs ofthe invention, described below, may be introduced into the cells by any method known in the art, including but not limited to, transfection, retroviral infection, micro-injection, electroporation, transduction or DEAE-dextran.
  • Cells which express the recombinant construct may be identified by, for example, using a second recombinant nucleic acid construct comprising a reporter gene which is used to produce selective expression.
  • Cells that express the nucleic acid sequence of the invention or a fragment thereof may be identified indirectly by the detection of reporter gene expression.
  • compositions containing mutein nucleic acids or proteins of the invention e.g. those muteins as described in individualized manner in connection with the prefened muteins of the invention above, as well as pharmaceutical compositions containing antibodies to them.
  • the compositions are preferably suitable for internal use and include an effective amount of a pharmacologically active compound of the invention, alone or in combination, with one or more pharmaceutically acceptable earners.
  • the compounds are especially useful in that they have very low, if any toxicity.
  • mutated nucleic acid sequences and muteins of this invention, and antibodies thereto may be used in pharmaceutical compositions, when combined with a pharmaceutically acceptable canier.
  • pharmaceutically acceptable canier is intended to include any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like, compatible with pharmaceutical administration. Suitable earners are described in the most recent edition of Remington's Pharmaceutical Sciences (e.g. currently the 18th edition), Alfonso R. Gennaro, ed. (Mack Publishing Co., Easton PA, USA, 1990), a standard reference text in the field, which is incorporated herein by reference.
  • Prefened examples of such carriers or diluents include, but are not limited to, water, saline, finger's solutions, dextrose solution, and 5% human serum albumin. Liposomes and non-aqueous vehicles such as fixed oils may also be used.
  • the use of such media and agents for pharmaceutically active substances is well known in the art. Except insofar as any conventional media or agent is incompatible with the active compound, use thereof in the compositions is contemplated. Supplementary active compounds can also be incorporated into the compositions.
  • a pharmaceutical composition ofthe invention is formulated to be compatible with its intended route of administration.
  • routes of administration include parenteral, e.g. intravenous, intradermal, subcutaneous, oral (e.g. inhalation), transdermal (e.g. topical), transmucosal, and rectal administration.
  • Solutions or suspensions used for parenteral, intradermal, or subcutaneous application can include the following components: a sterile diluent such as water for injection, saline solution, fixed oils, polyethylene glycols, glycerine, propylene glycol or other synthetic solvents; antibacterial agents such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as ethylenediaminetetraacetic acid (EDTA); buffers such as acetates, citrates or phosphates, and agents for the adjustment of tonicity such as sodium chloride or dextrose.
  • the pH can be adjusted with acids or bases, such as hydrochloric acid or sodium hydroxide.
  • the parenteral preparation can be enclosed in ampoules, disposable syringes or multiple dose vials made of glass or plastic.
  • compositions suitable for injectable use include sterile aqueous solutions (where water soluble) or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion.
  • suitable carriers include physiological saline, bacteriostatic water, Cremophor EL TM (BASF, Parsippany, NJ, U.S.A.) or phosphate buffered saline (PBS).
  • the composition must be sterile and should be fluid to the extent that easy syringeability exists. It must be stable under the conditions of manufacture and storage and must be preserved against the contaminating action of microorganisms such as bacteria and fungi.
  • the carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), and suitable mixtures thereof.
  • the proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance ofthe required particle size in the case of dispersion and by the use of surfactants.
  • Prevention of the action of microorganisms can be achieved by various antibacterial and antifiingal agents, for example, parabens, chlorobutanol, phenol, ascorbic acid, thimerosal, and the like.
  • isotonic agents for example, sugars, polyalcohols such as manitol, sorbitol, sodium chloride in the composition.
  • Prolonged absorption of the injectable compositions can be brought about by including in the composition an agent which delays absorption, for example, aluminum monostearate and gelatin.
  • the active drug component can be combined with an oral, non-toxic pharmaceutically acceptable inert carrier such as ethanol, glycerol, water and the like.
  • suitable binders, lubricants, disintegrating agents and coloring agents can also be incorporated into the mixture.
  • Suitable binders include starch, magnesium aluminum silicate, starch paste, gelatin, methylcellulose, sodium carboxymethylceUulose and/or polyvinylpynolidone, natural sugars such as glucose or beta-lactose, corn sweeteners, natural and synthetic gums such as acacia, tragacanth or sodium alginate, polyethylene glycol, waxes and the like.
  • Lubricants used in these dosage forms include sodium oleate, sodium stearate, magnesium stearate, sodium benzoate, sodium acetate, sodium chloride, silica, talcum, stearic acid, its magnesium or calcium salt and/or polyethyleneglycol and the like.
  • Disintegrators include, without limitation, starch, methyl cellulose, agar, bentonite, xanthan gum starches, agar, alginic acid or its sodium salt, or effervescent mixtures, and the like.
  • diluents include, without limitation, lactose, dextrose, sucrose, mannitol, sorbitol, cellulose and/or glycine.
  • compositions are preferably aqueous isotonic solutions or suspensions, and suppositories are advantageously prepared from fatty emulsions or suspensions.
  • the compositions may be sterilized and/or contain adjuvants, such as preserving, stabilizing, wetting or emulsifying agents, solution promoters, salts for regulating the osmotic pressure and/or buffers. In addition, they may also contain other therapeutically valuable substances.
  • the compositions are prepared according to conventional mixing, granulating or coating methods, respectively, and contain about 0.1 to 75%, preferably about 1 to 50%, ofthe active ingredient.
  • the compounds ofthe invention can also be administered in such oral dosage forms as timed release and sustained release tablets or capsules, pills, powders, granules, elixers, tinctures, suspensions, syrups and emulsions.
  • Liquid, particularly injectable compositions can, for example, be prepared by dissolving, dispersing, etc.
  • the active compound is dissolved in or mixed with a pharmaceutically pure solvent such as, for example, water, saline, aqueous dextrose, glycerol, ethanol, and the like, to thereby form the injectable solution or suspension.
  • a pharmaceutically pure solvent such as, for example, water, saline, aqueous dextrose, glycerol, ethanol, and the like
  • solid forms suitable for dissolving in liquid prior to injection can be formulated.
  • Injectable compositions are preferably aqueous isotonic solutions or suspensions.
  • the compositions may be sterilized and or contain adjuvants, such as preserving, stabilizing, wetting or emulsifying agents, solution promoters, salts for regulating the osmotic pressure and/or buffers. In addition, they may also contain other therapeutically valuable substances.
  • the compounds of the present invention can be administered in intravenous
  • Injectables can be prepared in conventional forms, either * as liquid solutions or suspensions.
  • Parental injectable administration is generally used for subcutaneous, intramuscular or intravenous injections and infusions. Additionally, one approach for parenteral administration employs the implantation of a slow-release or sustained- released systems, which assures that a constant level of dosage is maintained, according to U.S. Pat. No. 3,710,795, incorporated herein by reference.
  • prefened compounds for the present invention can be administered in intranasal form via topical use of suitable intranasal vehicles, or via transdermal routes, using those forms of transdermal skin patches well known to those of ordinary skill in that art.
  • the dosage administration will, of course, be continuous rather than intermittent throughout the dosage regimen.
  • Other prefened topical preparations include creams, ointments, lotions, aerosol sprays and gels, wherein the concentration of active ingredient would range from 0.1 % to 15 %, w/w or w/v.
  • excipients include pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharin, talcum, cellulose, glucose, sucrose, magnesium carbonate, and the like may be used.
  • the active compound defined above may be also formulated as suppositories using for example, polyalkylene glycols, for example, propylene glycol, as the canier.
  • suppositories are advantageously prepared from fatty emulsions or suspensions.
  • the compounds of the present invention can also be administered in the form of liposome delivery systems, such as small unilamellar vesicles, large unilamellar vesicles and multilamellar vesicles.
  • Liposomes can be formed from a variety of phospholipids, containing cholesterol, stearylamine or phosphatidylcholines.
  • a film of lipid components is hydrated with an aqueous solution of drug to a form lipid layer encapsulating the drug, as described in U.S. Pat. No. 5,262,564.
  • Compounds of the present invention may also be delivered by the use of monoclonal antibodies as individual earners to which the compound molecules are coupled.
  • the compounds of the present invention may also be coupled with soluble polymers as targetable drug earners.
  • Such polymers can include polyvinylpynolidone, pyran copolymer, polyhydroxypropyl-methacrylamide-phenol, polyhydroxyethylaspanamidephenol, or polyethyleneoxidepolylysine substituted with palmitoyl residues.
  • the compounds of the present invention may be coupled to a class of biodegradable polymers useful in achieving controlled release of a drug, for example, polylactic acid, polyepsilon caprolactone, polyhydroxy butyric acid, polyorthoesters, polyacetals, polydihydropyrans, polycyanoacrylates and cross- linked or amphipathic block copolymers of hydrogels.
  • a drug for example, polylactic acid, polyepsilon caprolactone, polyhydroxy butyric acid, polyorthoesters, polyacetals, polydihydropyrans, polycyanoacrylates and cross- linked or amphipathic block copolymers of hydrogels.
  • the pharmaceutical composition to be administered may also contain minor amounts of non-toxic auxiliary substances such as wetting or emulsifying agents, pH buffering agents, and other substances such as for example, sodium acetate, triethanolamine oleate, etc.
  • non-toxic auxiliary substances such as wetting or emulsifying agents, pH buffering agents, and other substances such as for example, sodium acetate, triethanolamine oleate, etc.
  • the dosage regimen utilizing the compounds is selected in accordance with a variety of factors including type, species, age, weight, sex and medical condition of the patient; the severity ofthe condition to be treated; the route of administration; the renal and hepatic function of the patient; and the particular compound or salt thereof employed.
  • An ordinarily skilled physician or veterinarian can readily determine and prescribe the effective amount of the drug required to prevent, counter or anest the progress ofthe condition.
  • Oral dosages of the present invention when used for the indicated effects, will range between about 0.05 to 1000 mg/day orally.
  • the compositions are preferably provided in the fonn of scored tablets containing 0.5, 1.0, 2.5, 5.0, 10.0, 15.0, 25.0, 50.0, 100.0, 250.0, 500.0 and 1000.0 mg of active ingredient. Effective plasma levels of the compounds of the present invention range from 0.002 mg to 50 mg per kg of body weight per day.
  • Compounds of the present invention may be administered in a single daily dose, or the total daily dosage may be administered in divided doses of two, three or four times daily.
  • compositions may contain 0.1-99%, preferably 1-70% ofthe cytoplasmic dynein heavy chainl polypeptide.
  • the pharmaceutical compositions can be provided with an adjuvant.
  • adjuvants are discussed above.
  • adjuvants can be used to increase the immunological response, depending on the host species, include Freund's (complete and incomplete), mineral gels such as aluminum hydroxide, surface active substances such as lysolecithin, pluronic polyols, polyanions, peptides, oil emulsions, keyhole limpet hemocyanin, dinitrophenol, and potentially useful human adjuvants such as BCG (bacille Calmette-Guerin) and Corynebacterium parvum.
  • animals are injected with antigen using several injections in a series, preferably including at least three booster injections.
  • the animals ofthe present invention present a phenotype whose characteristics are representative of many symptoms associated with disorders associated with dynein heavy chain deficiency (especially cytoplasmic dynein heavy chainl deficiency), therefore making the animal model of the present invention a particularly suitable model for the study of these diseases including movement hyperactivity, hyperexcitability disorders (e.g. myoclonic cramping, epilepsy), excitotoxicity disorders and neurodegeneration; over-activity or undesirable activity of endogenous cytoplasmic dynein heavy chainl; over-expression, over-production or undesirable production of endogenous cytoplasmic dynein heavy chainl; excessive or undesirable condition shown to be modulated by endogenous cytoplasmic dynein heavy chainl .
  • diseases including movement hyperactivity, hyperexcitability disorders (e.g. myoclonic cramping, epilepsy), excitotoxicity disorders and neurodegeneration; over-activity or undesirable activity of endogenous cytoplasmic dynein heavy chainl; over
  • the animal model of the invention presents a phenotype characterized by cramping,movement hyperactivity; excitatory neuronal damage in the CA3 and CA4 sector of the hippocampus, as well as in the upper layer of the cortex and in the Purkinje cell layer ofthe cerebellum and neurondegeneration.
  • these are all phenotypical characteristics of human diseases related to hyperexcitability and neurodegeneration, such as epilepsy, Alzheimer's disease, Huntington's disease, and Parkinson's disease. Therefore, the animals of the invention can be used to study diseases or symptoms associated with movement hyperactivity and impairment, hyperexcitability disorders (e.g. myoclonic cramping, epilepsy), excitotoxicity disorders, cognitive disorders and neurodegeneration in general.
  • the animals of the present invention can also be used to identify early diagnostic markers for diseases associated with cytoplasmic dynein heavy chainl deficiency.
  • Sunogate markers including but not limited to ribonucleic acids or proteins, can be identified by performing procedures of proteomics or gene expression analysis known in the art.
  • procedures of proteomics analysis include, but are not restricted to, ELISA, 2D-gel, protein microanays or mass spectrophotometric analysis of any organ or tissue samples, such as blood samples, or derivatives thereof, preferably plasma, at different age or stage of cytoplasmic dynein heavy chainl activity deficiency associated disease development, or symptom thereof.
  • gene expression analysis procedures include, but are not restricted to, differential display, cD A microanays, analysis of quality and quantity of ribonucleic acids species from any organ or tissue samples, such as blood samples, or derivatives thereof, at different age or stage of development of cytoplasmic dynein heavy chainl. activity deficiency associated disease, or symptom thereof.
  • the animal model of the present invention can be used to monitor the activity of agents useful in the prevention or treatment of the above-mentioned diseases and disorders.
  • the agent to be tested can be administered to an animal of the present invention and various phenotypic parameters can be measured or monitored.
  • the animals of the invention may be used to test therapeutics against any disorders or symptoms that have been shown to be associated with cytoplasmic dynein heavy chainl deficiency or overexpression.
  • the animals ofthe present invention can also be used as test model systems for materials, including but not restricted to chemicals and peptides, particularly medical drugs, suspected of promoting or aggravating the above-described diseases associated with cytoplasmic dynein heavy chainl deficiency.
  • the material can be tested by exposing the animal of the present invention to different time, doses and/or combinations of such materials and by monitoring the effects on the phenotype of the animal of the present invention, including but not restricted to movement activity; latency to fall in a hanging wire assay, motor coordination test assays, such as rotarod, stationary beam and coat hanger motor performance, excitatory neuronal damage in the hippocampus (CA3, CA4 and gyrus dentatus) and in the pyramidal area of the cortex, histopathological and biochemical parameters of motor neuron degeneration and spinal muscular atrophy, as well as tracer experiments to determine the functionality ofthe retrograd axonal transport.
  • motor coordination test assays such as rotarod, stationary beam and coat hanger motor performance
  • excitatory neuronal damage in the hippocampus (CA3, CA4 and gyrus dentatus) and in the pyramidal area of the cortex histopathological and biochemical parameters of motor neuron degeneration and spinal muscular atrophy, as well as tracer
  • the animals of the present invention may be used for the dissection of the molecular mechanisms of the cytoplasmic dynein heavy chainl pathway, that is for the identification of downstream genes or proteins thereof regulated by cytoplasmic dynein heavy chainl activity and deregulated in cytoplasmic dynein heavy chainl activity deficiency associated disorders.
  • this can be done by performing differential proteomics analysis, using techniques including but not restricted to 2D gel analysis, protein chip microanays or mass spectrophotometry, on tissues of the animal of the present invention which express cytoplasmic dynein heavy chainl and which respond to cytoplasmic dynein heavy chainl stimuli.
  • the animal model of the present invention can be used to identify and clone so-called modifier genes which are able to modify, aggravate, reduce or inhibit the phenotype associated with a cytoplasmic dynein heavy chainl activity deficiency.
  • the animal model ofthe present invention can be mated to mice of different strains canying a different genetic background, which gives the possibility to map the genes modifying the phenotype.
  • the animal model of the present invention when produced in an C3HeB/FeJ inbred strain background can be bred to C57Bl/6Jico inbred mice.
  • the hybrid animals of this progeny are then further bred, either in back-cross strategy with C57Bl/6Jico inbred mice again, or in an intercross strategy between each other.
  • the modifier gene can be then mapped and cloned by using microsattelites or a single nucleotide polymorphism (SNP) strategy on the mice resulting from the backcross or intercross breeding that have been grouped with respect to their phenotype intensity.
  • SNP single nucleotide polymorphism
  • An exemplary method for detecting the presence or absence of cytoplasmic dynein heavy chainl in a biological sample involves obtaining a biological sample from a test subject and contacting the biological sample with a compound or an agent capable of detecting cytoplasmic dynein heavy chainl protein, mutein, or nucleic acid (e.g. mRNA, genomic DNA) that encodes cytoplasmic dynein heavy chainl protein or mutein such that the presence of cytoplasmic dynein heavy chainl is detected in the biological sample.
  • An agent for detecting cytoplasmic dynein heavy chainl mRNA or genomic DNA is a labeled nucleic acid probe capable of hybridizing to cytoplasmic dynein heavy chainl mRNA or genomic DNA.
  • the diagnostic methods described herein can furthermore be utilized to identify subjects having or at risk of developing a disease or disorder associated with abenant cytoplasmic dynein heavy chainl expression or activity.
  • the assays described herein such as the preceding diagnostic assays or the following assays, can be utilized to identify a subject having or at risk of developing a disorder associated with cytoplasmic dynein heavy chainl protein, nucleic acid expression or activity.
  • the prognostic assays can be utilized to identify a subject having or at risk for developing a disease or disorder.
  • the invention provides a method for identifying a disease or disorder associated with abenant cytoplasmic dynein heavy chainl expression or activity in which a test sample is obtained from a subject and cytoplasmic dynein heavy chainl protein or nucleic acid (e.g. mRNA, genomic DNA) is detected, wherein the presence of cytoplasmic dynein heavy chainl protein or nucleic acid is diagnostic for a subject having or at risk of developing a disease or disorder associated with abenant cytoplasmic dynein heavy chainl expression or activity.
  • a test sample refers to a biological sample obtained from a subject of interest.
  • a test sample can be a biological fluid (e.g., blood, plasma, serum), cell sample, or tissue.
  • the prognostic assays described herein can be used to determine whether a subject can be administered an agent (e.g. an agonist, antagonist, peptidomimetic, protein, peptide, nucleic acid, small molecule, or other drug candidate) to treat a disease or disorder associated with abenant cytoplasmic dynein heavy chainl expression or activity.
  • an agent e.g. an agonist, antagonist, peptidomimetic, protein, peptide, nucleic acid, small molecule, or other drug candidate
  • agents e.g. an agonist, antagonist, peptidomimetic, protein, peptide, nucleic acid, small molecule, or other drug candidate
  • Agents, or modulators that have a stimulatory or inhibitory effect on cytoplasmic dynein heavy chainl activity can be administered to individuals to treat (prophylactically or therapeutically) cytoplasmic dynein heavy chainl -mediated disorders. Differences in metabolism of therapeutics can lead to severe toxicity or therapeutic failure by altering the relation between dose and blood concentration of the pharmacologically active drug.
  • the pharmacogenomics of the individual permits the selection of effective agents (e.g. drugs) for prophylactic or therapeutic treatments based on a consideration of the individual's genotype.
  • Such pharmacogenomics can further be used to determine appropriate dosages and therapeutic regimens. Accordingly, the activity of cytoplasmic dynein heavy chainl protein, expression of cytoplasmic dynein heavy chainl nucleic acid, or mutation content of cytoplasmic dynein heavy chainl genes in an individual can be determined to thereby select one or more appropriate agents for therapeutic or prophylactic treatment ofthe individual.
  • the present invention also provides a diagnostic method for cytoplasmic dynein heavy chainl activity deficiency.
  • Patients' peptide material particularly that in or from blood, serum or plasma, is subjected to analysis for one or more of the amino acid sequences ofthe present invention.
  • the peptide material may be analyzed directly or after extraction, isolation and/or purification by standard methods.
  • the diagnostic method comprises the identification of the modified cytoplasmic dynein heavy chainl, e.g., modified as described in individualized manner in connection with the prefened muteins of the invention above, whereby the modification is, e.g., associated with the replacement of an amino acid at a position conesponding to position 1055 in the amino acid sequence shown in SEQ ID NO:2.
  • the diagnostic method comprises the identification of the modified cytoplasmic dynein heavy chainl , e.g., the mutein as described in individualized manner in connection with the prefened muteins of the invention above, whereby the modification is, e.g., associated with the replacement of an amino acid at a position conesponding to position 1057 in the amino acid sequence shown in SEQ ID NO: 18.
  • the diagnostic method comprises the identification of the modified cytoplasmic dynein heavy chainl,.
  • diagnostic methods include those employing detection of the modified cytoplasmic dynein heavy chainl by its failure to activate a biological pathway.
  • the diagnostic methods of the invention also include those employing detection of the modified cytoplasmic dynein heavy chainl by its activity in competing with and blocking the action of native dynein heavy chain.
  • Methods of identifying the modified cytoplasmic dynein heavy chainl include any methods known in the art which are able to identify altered conformational properties of the amino acid sequence of the present invention compared to those of the wild type cytoplasmic dynein heavy chainl. These include, without limitation, the specific recognition of the modified protein by other proteins, particularly antibodies; individual or combined patterns of amino acid sequence digestion by known proteases or chemicals.
  • the method exploits the failure of another protein to recognize the modified protein, examples being antibodies directed to an epitope of wild type cytoplasmic dynein heavy chainl that incorporates residue 1055 of SEQ ID NO:2, or SEQ ID NO: 18, and cytoplasmic dynein heavy chainl receptors in which this portion ofthe molecular surface of wild type cytoplasmic dynein heavy chainl is recognized or involved in cytoplasmic dynein heavy chainl activation.
  • the principle of the diagnostic method is the detection of a nucleic acid sequence encoding the modified cytoplasmic dynein heavy chainl ofthe invention.
  • the present invention is not only concerned with the identification of neurodegenerative disease relevant mutations in the dynein heavy chain 1 gene, but is also based on the recognition that other components (hereinafter also refened to as "subunits") of the dynactin/dynein complex may likewise be subject to mutations that are involved in, or affect, the pathogenesis of such diseases.
  • these subunits include in particular the cytoplasmic dynein heavy chain 1, cytoplasmic dynein intermediate chain 1, cytoplasmic dynein intermediate chain 2, cytoplasmic dynein light intermediate chain 1, cytoplasmic dynein light intermediate chain 2; cytoplasmic dynein 10 kDa light chain, cytoplasmic dynein light chain Tctex 1, cytoplasmic dynein light chain 2B, DCTN 1, DCTN 2, DCTN 3, DCTN 4, DCTN 5, DCTN 6, ARP1, ARP11, HAPl, and CLIP-170, preferably encoded by the genomic nucleic acid sequences identified in Table 25, or defined by the amino acid sequences identified in Tables 26, 27, and 29-35.
  • NCBI contigs are derived from genomic sequence data assembled by NCBI staff
  • the invention ter alia relates to the identification of a protein or a nucleic acid marker indicative of an increased risk of a mammalian subject, particularly a human subject, of developing a neurodegenerative disease or of an association of a neurodegenerative disease in a mammalian subject, particularly a human subject, with a mutation which leads to a neurodegenerative disease.
  • a neurodegenerative disease Preferably the above-mentioned neurodegenerative diseases are Alzheimer's Disease, Parkinson's Disease, or Huntington's Disease.
  • the neurodegenerative disease is a motomeuron degenerative disease.
  • the motomeuron degenerative disease is Amyotrophic Lateral Sclerosis, Spinal Muscular Atrophy, Bulbo-Spinal Muscular Atrophy, Progressive Bulbar Palsy, Progressive Muscular Atrophy, and Primary Lateral Sclerosis.
  • the mutation selectively affects cell types associated with or suspected to be involved in neurodegenerative diseases. In a more prefened embodiment, these cell types are motomeurons. In an even more prefened embodiment, the motomeurons are ⁇ -motorneurons. In another prefened embodiment, the mutation affects cellular processes, e.g., neuronal axonal transport, cellular transport, proliferation, differentiation, or apoptosis. In another prefened embodiment, the mutation leads to a deficiency or malfunction, e.g. an alteration in the functional interaction or a disruption of the dynactin/dynein complex in neurons, preferably in motomeurons.
  • a deficiency or malfunction e.g. an alteration in the functional interaction or a disruption of the dynactin/dynein complex in neurons, preferably in motomeurons.
  • said mutation results in a deletion of an amino acid or an insertion of an additional amino acid not normally present in the amino acid sequence of the protein encoded by said allele or in a substimtion by another amino acid of an amino acid encoded by said allele.
  • said deletion, substitution, or insertion is encoded by both alleles ofthe gene coding for said protein and/or occurs in an evolutionary conserved region of said protein.
  • the substitution of an amino acid which is identical between the conesponding mouse and human, preferably between the conesponding mouse, rat, and human protein encoded by said allele, by another amino acid, preferably by a non- conservative amino acid and/or the substitution of the amino acid occurs by a naturally occuning amino acid.
  • the amino acid affected by the mutation is encoded by a codon within the open reading frame of a nucleic acid sequence, preferably by an exon, as set forth in the following tables.
  • Table 36 Mouse cytoplasmic dynein intermediate chainl (GenBank Ace. No.: NM_0100631(SEQ ID NO.: 70)
  • Exon3 (nucleotide) TGCAGCCGCTGCATTTTTTAACATGGGATACCTGTTATTTTCATTATTTAGTCCCAACCCCTATGTCTC CCTCCTCGAAATCAGTGAGCACTCCCAGTGAAGCTGGAAGCCAAGACTCAGGCGATCTGGGGCCATTAA
  • Exon2 (nucleotide) ATCCAAGTATTTGAAGATGGAGCAGATACTACTTCCCCAGAGACTCCTGATTCTTCTGCTTCAAAGGTC CTCAAGAGAG
  • Exonl2 (nucleotide) GATGTCAATCGGGAGCTGACAAACCAGCAGGAAGCGTCTGTAGAGAGGCAGCAGCAGCCGCCGCCAGAG ACTTTTGATTTCAAAATCAAGTTTGCTGAGACCAAGGCTCATGCCAAG
  • Exonl9 (nucleotide) GTATCCGACACACTCCTGGACTGCAGGAAGCACTTGACGTGGGTGGTAGCTGTTCTGCAGGAGGTGGCA GCTGCAGCCGCCCAGCTTATTGCCCCCTTGGCAGAGAACGAGGGGCTGCCTGTGGCTGCACTGGAGGAG ' CTGGCCTTCAAAGCAAGCGAGCAG
  • Exon4 (nucleotide) AGGGAACTGATACAACTGCAAAGACTAGCAAACTG
  • Exonl 6 (nucleotide) TGCCCTCTCTCAGTGCAGTGTGGATGTGTATAAGAAAGTGGGCAGCCTGTACCCTGAGATGAGTGCCCA TGAGCGCTCCTTGGATTTCCTCATTGAACTGCTGCACAAGGATCAGCTGGATGAGACTGTCAATGTGGA GCCTCTCACCAAGGCCATCAAGTACTATCAG
  • the amino acid affected by the mutation is located in a domain of said protein, which is capable of binding to another subunit of the dynactin/dynein complex.
  • said domain comprises amino acids 147-157, amino acids 243-314, amino acids 140-157, or amino acids 1-123 of SEQ ID NO.: 61, in case the protein is mouse cytoplasmic dynein intermediate chain 1, or, in case the protein is human cytoplasmic dynein intermediate chain 1 amino acids 1-140, amino acids 157-174, amin acids 164-174, or amino acids 260-331 of SEQ ID NO.: 62.
  • said domain comprises amino acids 1-123, amino acids 122-139, amino acids 129-130, or amino acids 226-297 of SEQ ID NO.: 64, or, in case the protein is human cytoplasmic dynein intermediate chain 2 amino acids 1-149, amino acids 148-165, amino acids 155-165, or amino acids 252-323 of SEQ ID NO.: 65.
  • said domain comprises amino acids 39-150, amino acids 1006-1021, or amino acids 133-899 of SEQ ID NO.: 67, or, in case the protein is human DCTN 1 amino acids 39-150, amino acids 133-899, or amino acids 1006-1021 of SEQ ID NO.: 68.
  • the amino acid affected by the mutation is any one as described in individualized manner in connection with the prefened muteins ofthe invention above, e.g., those specified in Tables 19, 20, 21, 22 or 24.
  • protein is human DCTN 1
  • another prefened embodiment is one wherein the amino acid affected by said mutation is amino acid 39G.
  • the amino acid affected by said mutation is amino acid 40H.
  • another prefened embodiment is one wherein the amino acid affected by said mutation is amino acid 41R.
  • the protein is human DCTN 1
  • another prefened embodiment is one wherein the amino acid affected by said mutation is amino acid 42G.
  • another prefened embodiment is one wherein the amino acid affected by said mutation is amino acid 43 T.
  • protein is human DCTN 1
  • another prefened embodiment is one wherein the amino acid affected by said mutation is amino acid 44V.
  • the protein is human DCTN 1
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 45 A.
  • protein is human DCTN 1
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 46Y.
  • the amino acid affected by said mutation is the amino acid 47V.
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 48G.
  • protein is human DCTN 1
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 49 A.
  • the protein is human DCTN 1
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 50T.
  • protein is human DCTN 1
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 51L.
  • the amino acid affected by said mutation is the amino acid 52F.
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 53A.
  • the protein is human DCTN 1
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 54T.
  • the protein is human DCTN 1
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 55G.
  • protein is human DCTN 1
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 56K.
  • the amino acid affected by said mutation is the amino acid 57W.
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 58V.
  • the amino acid affected by said mutation is the amino acid 59G.
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 60V
  • protein is human DCTN 1
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 611.
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 62L.
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 63D.
  • the amino acid affected by said mutation is the amino acid 64E.
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 65 A.
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 66K.
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 67G.
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 68K.
  • the amino acid affected by said mutation is the amino acid 69N.
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 70D.
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 71G.
  • protein is human DCTN 1
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 72T.
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 73V.
  • the amino acid affected by said mutation is the amino acid 74Q.
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 75 G.
  • the amino acid affected by said mutation is the amino acid 76R.
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 77K.
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 78Y.
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 79F.
  • protein is human DCTN 1
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 80T.
  • the amino acid affected by said mutation is the amino acid 81C.
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 82D.
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 83E.
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 84G.
  • protein is human DCTN 1
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 85H.
  • the amino acid affected by said mutation is the amino acid 86G.
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 871.
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 88F.
  • another prefened embodiment is one wherem the amino acid affected by said mutation is the amino acid 89V.
  • protein is human DCTN 1
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 90R.
  • the amino acid affected by said mutation is the amino acid 91Q.
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 92S.
  • the amino acid affected by said mutation is the amino acid 93 Q.
  • another prefened embodiment is one wherein the- amino acid affected by said mutation is the amino acid 941.
  • the protein is human DCTN 1
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 95Q.
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 96V.
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 97F.
  • the amino acid affected by said mutation is the amino acid 98E.
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 99D.
  • the protein is human DCTN 1
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 100G.
  • the protein is human DCTN 1
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 101 A.
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 102D.
  • the amino acid affected by said mutation is the amino acid 103T.
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 104T.
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 105S.
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 106P.
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 107E.
  • the amino acid affected by said mutation is the amino acid 108T.
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 109P.
  • the amino acid affected by said mutation is the amino acid 110D.
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 111 S.
  • protein is human DCTN 1
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 112S.
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 113 A.
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 114S.
  • the amino acid affected by said mutation is the amino acid 115K.
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 117L.
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 118K.
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 119R.
  • the protein is human DCTN 1
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 120E.
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 12 IG.
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 123D.
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 126 A.
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 127K.
  • protein is human DCTN 1
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 128T.
  • the amino acid affected by said mutation is the amino acid 129S.
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 13 OK.
  • the amino acid affected by said mutation is the amino acid 13 IL.
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 132R.
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 133G.
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 134L.
  • protein is human DCTN 1
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 135K.
  • the amino acid affected by said mutation is the amino acid 136P.
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 137K.
  • the protein is human DCTN 1
  • another prefened embodiment. is one wherein the amino acid affected by said mutation is the amino acid 138K.
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 139A.
  • the protein is human DCTN 1
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 140P.
  • the amino acid affected by said mutation is the amino acid 141T.
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 142 A.
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 143R.
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 144K.
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 145T.
  • the amino acid affected by said mutation is the amino acid 146T.
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 147T.
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 148R.
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 149R.
  • the protein is human DCTN 1
  • another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 150P.
  • test sample derived from a mammalian subject may be directly obtained from said subject. It may, however, also be a sample that has been obtained previously.
  • test samples according to the invention are, for example, cDNA preparations that have been prepared from mRNA obtained from a tissue sample from a human subject at an earlier stage. It may also be cloned or PCR-amplif ⁇ ed DNA that originates from DNA contained in such tissue sample obtained at an earlier stage.
  • the test sample will be analyzed for a difference to a similar test sample derived from a human subject unaffected by or known not to be at risk of developing a neurological disease.
  • the method may include actually deriving or directly obtaining a test sample from such a mammalian subject, particularly a human subject, for comparative purposes, the necessary information regarding the relevant structural features and properties of such similar test sample to be used for comparison will often already be available.
  • it will often be sufficient for the purposes of the above methods ofthe invention to perform an analysis for a difference to a similar test sample as it would be observed if said similar test sample were in fact obtained from a subject of the same species, which subject is unaffected by or known not to be at risk of developing the above medical condition.
  • the test sample may be a nucleic acid sample, e.g., mRNA (or cDNA derived therefrom), or genomic DNA.
  • the nucleic acid sample or the protein sample comprises one or more of the nucleic acids coding for proteins or the proteins itself, which are subunits of the dynactin/dynein complex, preferably the cytoplasmic dynein heavy chain 1, e.g. according to SEQ ID NOS.: 28 or 29, the cytoplasmic dynein intermediate chain 1, e.g. according to SEQ ID NOS.: 30 or 31, the cytoplasmic dynein intermediate chain 2, e.g. according to SEQ ID NOS.: 32 or 33, the cytoplasmic dynein light intermediate chain 1, e.g.
  • the cytoplasmic dynein light intermediate chain 2 e.g. according to SEQ ID NOS.: 36 or 37
  • the cytoplasmic dynein 10 kDa light chain e.g. according to SEQ ID NOS.: 38 or 39
  • the cytoplasmic dynein light chain Tctex 1 e.g. according to SEQ ID NOS.: 40 or 41
  • the cytoplasmic dynein light chain 2B e.g. according to SEQ ID NO.: 42
  • DCTN 1 e.g. according to SEQ ID NOS.: 43 or 44
  • DCTN 2 e.g. according to SEQ ID NO.: 45
  • DCTN 3 e.g.
  • DCTN 4 e.g. according to SEQ ID NOS.: 48 or 49
  • DCTN 5 e.g. according to SEQ ID NO.: 50
  • DCTN 6 e.g. according to SEQ ID NOS.: 51 or 52
  • ARPl e.g. according to SEQ ID NOS. 53 or 54
  • ARPl l e.g. according to SEQ ID NOS. 55 or 56
  • HAPl e.g. according to SEQ ID NO. 57 or 58
  • CLIP-170 e.g.
  • the difference analyzed- may furthermore be one relating to the expression level of said nucleic acid or protein. Alternatively, it may be analyzed whether there is a difference in terms ofthe nucleotide or the amino acid sequence level.
  • the step of analysis for differences between the test samples may comprises the partial or complete determination of the sequence of the nucleic acid, or a PCR- amplified portion of the nucleic acid, of the test sample, and optionally also of the nucleic acid or at PCR-amplified portion ofthe nucleic acid ofthe similar test sample
  • another embodiment of the invention relates to oligonucleotides suitable for identifying a mutation in an allele coding for a protein, which is a subunit ofthe dynactin/dynein complex.
  • the oligonucleotide is suitable for hybridizing to the nucleic acid of said allele or a portion of its nucleic acid under stringent conditions.
  • the oligonucleotide is suitable as primer for amplifying the nucleic acid of said allele or a portion of its nucleic acid.
  • Suitable methods for the determination of partial or complete nucleic acid sequences, and thus, detection of the above-mentioned differences, are well known to the skilled artisan. They include, for example, Southern blotting, TGGE (temperature gradient gel electrophoresis), DGGE (denaturing gradient gel electrophoresis), SCCP (single chain conformation polymorphism) detection, and the like. High throughput sequence analysis methods such as those described by Kristensen et al. (Kristensen et al., BioTechniques 30 (2001), 318-332), which is incorporated herein by reference in its entirety, are likewise suitable, and hence, contemplated in connection with the present invention.
  • One embodiment of the present invention relates to the determination whether the above-mentioned differences are present in one or both alleles ofthe gene coding for the protein, which is a subunit of the dynactin/dynein complex, i.e., whether the mammalian subject (or certain cell samples derived therefrom) is (are) homozygous or heterozygous with respect to said mutation.
  • the portion of the allele to be tested is PCR-amplified and digested with a suitable restriction enzyme and the resulting restriction pattern obtained from the amplified portion is compared to the restriction pattern obtained from the conesponding amplified portion of the similar sample or the similar samples (see Example (8).
  • the above-mentioned determination whether differences are present in one or both alleles ofthe gene coding for said protein is TGCE, as explained below.
  • PCR-amplified portions of the allele via electrophoresis through a gradient of increasing temperature via TGCE (see Example 20). Differences in the amplified portion of the allele compared to amplified portions of the alleles contained in the similar test sample(s) are indicated by a difference in migration during electrophoresis.
  • the invention ter alia relates to high throughput screening methods.
  • the oligonucleotides according to the invention, used in these high throughput methods are fixed on a solid support to form an anay.
  • the solid support can comprise microplates, standard blotting membranes, or glass chips.
  • the solid support is a glass chip with a modified surface capable of covalently binding to said oligonucleotides.
  • Nucleic acid samples, preferably genomic DNA are tagged, e.g. with a fluorescent marker, and allowed to interact with said oligoncleotides bound to the solid support.
  • Hybridization will occur at complementary sequences between nucleic acid sample and oligonucleotide, which is indicative for the presence of a mutation in said nucleic acid sample. Hybridization is then determined by scanning with a laser beam and analyzing the signal on a computer.
  • Suitable methods for the determination of partial or complete amino acid sequences are likewise well known, and include, for example, detection of particular epitopes within a protein sample via specific antibodies in dot blot, slot blot, or Western blot assays, or via ELISAs or RIAs, or partial amino acid sequence determination on a sequencer via Edman degradation. Also, high-throughput methods may again be employed.
  • a further aspect of the present invention is represented by a method for identifying a predisposition of a mammalian subject, particularly a human subject, for developing a neurodegenerative disease, said method comprising the step of determining whether a test sample derived from said subject indicates the presence of a mutation in an allele of the gene coding for a protein, which is a subunit of the dynactin/dynein complex, indicative of an increased risk of said human subject of developing said neurodegnereative disease.
  • Also contemplated in connection with the present invention is a method for determining whether a neurodegenerative disease in a mammalian subject, particularly a human subject, which is associated with a mutation in an allele of a gene coding for a protein, which is asubunit of the dynactin/dynein complex, said method comprising the step of determining whether a test sample derived from said subject indicates the presence of a mutation in an allele ofthe gene coding for said protein.
  • test sample may also be a sample that has been obtained previously.
  • suitable test samples according to the invention are, for example, cDNA preparations that have been prepared from mRNA obtained from a tissue sample from a mammalian subject, particularly a human subject, at an earlier stage. It may also again be cloned or PCR- amplified DNA that originates from DNA contained in such tissue sample obtained at an earlier stage.
  • test sample which may be a nucleic -acid or protein test sample as previously defined
  • the test sample is analyzed for the presence of a mutation in an allele of a gene of a protein, which is a subunit of the dynactin/dynein complex, which mutation is indicative of an increased risk of developing such a neurodegenerative disease.
  • said methods would comprise analyzing said sample for the presence of amutation, which would indicate an altered expression or function of said protein.
  • mutations are ter alia those refened to herein in connection with the proteins and nucleic acids according to the invention, and that mutations of this kind may be readily identified, for example, by in vitro assays.
  • in vitro assays to determine whether the mutation in an allele of a gene coding for said protein affects the function of the complex may comprise the quantitative and/or qualitative determination of the binding of the subunits to each other within the complex.
  • Qualitative methods may comprise SDS-PAGE and subsequent Western blotting of homogenates of, e.g. the spinal cord, using antibodies specific for the dynactin/dynein subunits.
  • Disruption of the dynactin/dynein complex by a mutation in said proteins can be determined by, e.g. a difference in migration of the subunits compared to proteins derived from homogenates of similar tissue comprising the conesponding proteins without mutation (LaMonte et al, see above.).
  • disruption, or at least functional alteration of the dynactin/dynein complex due to mutations in its subunits may be analyzed by affinity chromatography as described in Karki et al. (J Biol Chem 270, 28806-28811, 1995) or co-precipitation experiments as described in Paschal et al. (J Biol Chem 268, 15318-23, 1993).
  • Quantitative methods to determine quantitative binding of the subunits within the complex to each other are, e.g. those using surface plasmon resonance (SPR), such as, for example, the Biacore technology (Biacore AB, Uppsala, Sweden) (see also Example 18).
  • SPR surface plasmon resonance
  • Further suitable in vitro assays comprise the step of determining whether a mutation in one or more subunits of the dynactin/dynein complex affects dynein motility.
  • Such tests comprise, e.g. immunohistology with appropiate antibodies.
  • antibodies directed against tubulin or synaptotagmin may be suitable (Martin et al, 1999, Mol Biol Cell 10, 3717-3728).
  • dynein motility may be determined by analysis of single-lipid-droplet motility as described by Welte et al. (Cell 92: 547-557, 1998) or a microtubule gliding assay (see Example 16).
  • the in. vitro assays may comprise tests to determine whether the mutation in an allele of a gene coding for said protein affects the expression of the protein.
  • quantitative analysis of the mRNA expression levels may be applicable. These methods may comprise, for example, Northern blotting or quantitative Polymerase Chain Reaction, which are well known to those skilled in the art.
  • the above-metioned mutations may be readily identified, for example, by an animal model (see Example 1).
  • the above-mentioned mutations may also be identified by any of the aforementioned methods of screening for disease-relevant alleles of said proteins.
  • the invention further comprises a kit for identifying a predisposition of a mammalian subject, particularly a human subject, for developing a neurodegenerative disease, or for identifying an association of a neurodegenerative disease of said subject with a mutation in an allele coding for a protein, which is a subunit of the dynactin/dynein complex.
  • the kit according to the invention comprises one or more of the above-mentioned oligonucleotides suitable for identifying a mutation in an allele of a gene coding for a protein which is a subunit of the dynactin/dynein complex.
  • the kit comprises oligonucleotide(s), the nucleotide sequence of which conespond(s) to a nucleotide sequence within said allele, which contains a mutation.
  • the oligonucleotide(s) is(are) suitable for hybridizing to the nucleic acid of said allele or a portion of its nucleic acid under stringent conditions.
  • the oligonucleotide(s) is(are) suitable as primer(s) for amplifying the nucleic acid of said allele or a portion of its nucleic acid.
  • the kit further comprises instructions to use the oligonucleotide or the oligonucleotides for identifying said predisposition in said subject or said association of the neurodegenerative disease of said subject with said mutation.
  • the invention further comprises a solid support, wherein at least two oligonucleotides are individually fixed to separate areas of the solid support to form an anay.
  • the oligonucleotides fixed on the solid support are suitable for for identifying a mutation in an allele of a gene coding for a protein, which is a subunit ofthe dynactin/dynein complex.
  • the oligonucleotides fixed on the solid support have a nucleotide sequence, which conesponds to a nucleotide sequence within said allele, which contains a mutation and. are suitable for hybridizing to the nucleic acid of said allele or a portion of its nucleic acid under stringent conditions.
  • the solid support can be a microplate or standard blotting membranes, such' as nylon or nitrocellulose membranes.
  • the solid support is a glass chip, preferably a glass chip with a modified surface.
  • the surface of the glass chip is modified as to bind nucleic acids, preferably oligonucleotides, more preferably oligonucleotides with a nucleotide sequence, which conesponds to a nucleotide sequence within said allele, which contains a mutation.
  • a further embodiment of the present invention comprises the use of the previously mentioned oligonucleotides, or the previously mentioned kit, or the above- mentioned solid support, in a method for identifying a predisposition of a mammalian subject, particularly a human subject, for developing a neurodegenerative disease or in a method for determining whether a neurodegenerative disease in a mammalian subject, particularly a human subject, is associated with a mutation in an allele of a gene coding for a protein, which is a subunit of the dynactin/dynein complex as mentioned previously.
  • EXAMPLE 1 Production of Animals of the Invention and Breeding Strategies To produce mouse mutants, a C3HeB/FeJ male mouse (The Jackson
  • Affected FI individuals were mated to wild type C3HeB/FeJ mice and the resulting F2 progeny was screened for the identical pathological phenotype as identified in FI generation.
  • C3HeB/FeJ mice Affected F2 individuals were intercrossed to produce homozygous F3 individuals, which undergo perinatal lethality: therefore fetal tissues of these animals were analyzed. Heterozygous F3 individuals were used for the histochemical, neurological and physiological characterization ofthe Cral phenotype.
  • EXAMPLE 2 First Identification of Phenotype The Cral mouse mutant was identified by the observation of hind limb cramping during manual tail suspension in the heterozygous condition (Figure 1). Adult mice were manually suspended by their tails for one minute. During this period it was observed whether the mice display cramping of their hind limbs. In all tests, the observation of hind limb cramping was invariably conelated to the heterozygous Cral/+ genotype.

Landscapes

  • Life Sciences & Earth Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Chemical & Material Sciences (AREA)
  • Zoology (AREA)
  • Environmental Sciences (AREA)
  • Organic Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Biotechnology (AREA)
  • General Health & Medical Sciences (AREA)
  • Animal Husbandry (AREA)
  • Molecular Biology (AREA)
  • Veterinary Medicine (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biodiversity & Conservation Biology (AREA)
  • Wood Science & Technology (AREA)
  • Biophysics (AREA)
  • Biomedical Technology (AREA)
  • Biochemistry (AREA)
  • General Engineering & Computer Science (AREA)
  • Animal Behavior & Ethology (AREA)
  • Physics & Mathematics (AREA)
  • Microbiology (AREA)
  • Plant Pathology (AREA)
  • Toxicology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Medicinal Chemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Investigating Or Analysing Biological Materials (AREA)

Abstract

A non-human animal model is provided, particularly a mouse model for movement hyperactivity, excitoxicity disorders (e.g. myoclonic cramping) and neurodegeneration, in which modified cytoplasmic dynein heavy chain1 is expressed. Modified human and mouse cytoplasmic dynein heavy chain1 proteins and nucleic acids are also provided, including the corresponding recombinant proteins. The invention further provides uses for the non-human animal model and the modified cytoplasmic dynein heavy chain1 proteins and nucleic acids, in particular for the diagnosis and treatment of medical conditions associated with over-expression of cytoplasmic dynein heavy chain1.

Description

Cytoplasmic dynein heavy chainl genes, expression products, non-human animal model: uses in human neurological diseases
FIELD OF THE INVENTION
The present invention ter alia relates to a non-human animal model for movement hyperactivity, hyperexcitability disorders (e.g. myoclonic cramping, epilepsy), excitoxicity disorders, and neurodegeneration. This animal model bears a mutation in the cytoplasmic dynein heavy chainl gene. The invention also relates to modified peptides and the conesponding nucleic acid sequences of the modified mouse and human cytoplasmic cytoplasmic dynein heavy chainl. Furthermore, the invention relates to the use of these peptides and nucleic acids for manufacturing therapeutics suitable for the treatment of diseases, such as Alzheimer's disease, Huntington's disease, Parkinson's disease and amyotropic lateral sclerosis (ALS), as well as other diseases associated with overexpression, over-activity, or undesirable activity of cytoplasmic dynein heavy chainl .
BACKGROUND OF THE INVENTION
Eukaryotic cells are characterized by biochemical and physiological processes which under normal conditions are exquisitely balanced to achieve the preservation and propagation of the cells. hen such cells are components of multicellular organisms such as vertebrates, or more particularly organisms such as mammals, the regulation of the biochemical and physiological processes involves intricate signaling pathways. Frequently, such signaling pathways consist of extracellular signaling proteins, cellular receptors that bind the signaling proteins and signal transducing components located within the cells.
Signaling prqcesses may elicit a variety of effects on cells and tissues, including by way of nonlimiting example induction of cell or tissue proliferation, suppression of growth or proliferation and induction or suppression of differentiation or maturation of a cell or tissue. Many pathological conditions involve dysregulation of expression of important effector proteins. In certain classes of pathologies the dysregulation is manifested as a diminished or suppressed level of synthesis and secretion of protein effectors. In a clinical setting a subject may be suspected of suffering from a condition brought on by diminished or suppressed levels of a protein effector of interest. Therefore, there is a need to assay for the level of the protein effector of interest in a biological sample from such a subject and to compare the level with that characteristic of a nonpathological condition. There is a further need to provide the protein effector as a product of manufacture. Administration ofthe effector to a subject in need thereof is useful in treatment of the pathological condition. Accordingly, there is a need for a method of treatment of a pathological condition brought on by a diminished, suppressed, or in some cases elevated, level ofthe protein effector of interest.
Motor neuron degenerative diseases are severely debilitating and largely fatal in humans as well as other mammalian species. Several hypotheses have been proposed to explain the pathogenesis of the diseases, but none addressed the underlying cause for the specificity of disease in motor neurons, the late onset of the disease, and the cumulative progressive nature ofthe disease.
Degenerative disorders of motor neurons include a range of progressive diseases such as amyotrophic lateral sclerosis (ALS) and spinal muscular atrophy (SMA), the most common genetic cause of death of children (Nicole, S. et al.,J. Muscle Nerve 26, 4-13, 2002).
In ALS, commonly known as Lou Gehrig's Disease in the US, the motor neurons (nerve cells in the brain, brain stem, and spinal cord that control movement of the skeletal muscles) gradually degenerate, resulting in progressive weakness and functional loss of involved muscles. Diseases that cause selective progressive death of motor neurons are surprisingly common « ALS is the third most frequent neurodegenerative cause of adult death, after Alzheimer disease and Parkinson disease, and is significantly more common than multiple sclerosis (Motor Neurone Disease Association Information Sheet Number 9, Motor Neurone Disease Association, 1998). Targeted at adults in their prime years of life, the average age of onset is the mid-fifties, although adults of all ages can be affected. Men get the disease slightly more often than women. Worldwide, the incidences of ALS is 0.5 to 2.4 cases per 100,000, with a prevalence of 2.5 to 7 cases per 100,000 population (Cleveland, D.W. and Rothstein, J.D. Nat. Rev. Neurosci 2, 806-819, 2001). The prevalence of ALS in the United States will probably increase dramatically as the baby boomer generation ages. In ALS the majority of patients die within 2 - 5 years of clinical onset (Motor Neurone Disease Association Information Sheet Number 9, Motor Neurone Disease Association (1998). ALS and related motor neuron disorders are not contagious but in some cases known to be hereditarily transmitted. Up to 10% of ALS is familial (FALS) and causative mutations have been found in the SOD1 gene that account for up to 20% of these FALS cases (Julien, J.P., Cell 104, 581-591, 2001). SOD1 encodes the ubiquitously expressed enzyme superoxide dismutase 1 which takes on an unknown dominant gain of function in ALS that results in the selective death of motor neurons. Mutations have also been found in alsin, probably a GTPase regulatory protein, in rare juvenile recessive forms of motor neuron disease (Hadano, S. et al. Nat. Genet. 29, 166-173, 2001; Yang, Y. et al.. Nat. Genet. 29, 160-165, 2001). In a few sporadic ALS patients and one FALS case mutations have been identified in the NFH (neurofilament heavy chain) gene (Robberecht,W. J. Neurol 247, 2-6, 2000). Approximately, 90% of all ALS is without history and is refened to as sporadic ALS, although the clinical course and the neuropathological alterations are often indistinguishable from the proven cases of genetic disease. If a genetic cause would be responsible also for a subgroup of so called sporadic ALS, the mutation would likely be germline or very early embryonic, as mosaic type pathological alterations expected in later acquired mutations are not reported nor expectable in ALS.
Cunently, diagnosing ALS is a combination of medical history and physical and neurological examinations performed by a clinical neurologist (Brooks, Benjamin R., El Escorial J Neurol Sci 124 (Suppl.), pages 96-107, 1994; Karitzky J, Ludolph AC. J Neurol Sci, Oct 15;191(l-2):35-41, 2001; Ludolph AC, and Knirsch U, J Neurol Sci, Jun;165 Suppl l:S14-20, 1999). An electromyogram is a diagnostic test which is done to determine abnormal nerve and muscle activity. The clinical examination and tests also rule out other conditions that might mimic motor neuron disease. The certainty ofthe diagnosis is determined by the clinical evidence of upper and lower motor neuron signs, according to the criteria established by the World Federation of Neurology. Therefore, a definitive diagnosis of ALS is performed when clearly detectable classical clinical signs such as muscular fibrillation of distal muscle groups or tongue, difficulty to swallow, and predominantly distal muscular atrophy with the typical histological picture of grouped angular shaped atrophic muscle fibres indicative of muscle denervation are present which means that the disease course is already proceeded.
Some persons are diagnosed to have other clinical variant forms of motor neuron disease which may later evolve into classical ALS over time. These clinical subtypes of motor neuron disease include: Progressive bulbar palsy (PBP) which affects the brain stem (refened to as bulbar involvement), causes weakness of the speech and swallowing muscles. Progressive muscular atrophy (PMA) which affects the lower motor neurons causes skeletal muscle wasting. Primary lateral sclerosis (PLS) which affects the upper motor neurons causes muscle spasticity and may be slowly progressive over many years (Brooks, BR.: El Escorial J Neurol Sci 124 (Suppl.), 1994, pages 96-107).
The most common form of spinal muscular atrophy (SMA) affects up to 1 in 6,000 newborns and is the leading hereditary cause of infant mortality worldwide, causing death before the age of 2 years. Defects in the widely expressed SMNl (survival motor neuron 1) gene are responsible for most SMA (Hofmann, Y. and Wirth, B. Hum. Mol. Genet. 11, 2037-2049, 2002; Lefebvre, S. et al.. Cell 80, 155- 165, 1995).
Another inherited motor neuron degeneration of early adulthood is the spinobulbar muscular atrophy (SBMA), which in some families is linked to a X- chromosomal trait and CAG triplet repeat expansion within the androgen receptor (Sparfeld AD et al., Arch. Neurol. 59:1921-1926, 2002). SBMA x-linked is also termed Kennedy disease. However, there are also SBMA like syndromes following autosomal inheritance, the underlying mutations are not yet identified.
Cunent hypothesis to the pathogenesis of motor neuron degeneration address a variety of cellular insults that may intersect, leading individually or in concert to motor neuron degeneration, motor neuron death and finally ALS (Julien, J.P. Cell 104, 581-591, 2001). A faculty gene and excess glutamate may lead to damaging free radicals, which can harm the nerve cell's DNA (Munch, C et al., J Neurochem, Aug. 82(3):594-603, 2002; Ludolph AC, and Meyer T, Riepe MW J Neurol 2000 Mar;247 Suppl 1:17-16; Meyer T et al. J Neurol Neurosurg Psychiatry, Dec;65(6):954, 1998; Meyer T. et al., J Neurol Neurosurg Psychiatry, Oct;65(4):594-6, 1998). Glutamate also may lead to the production of detrimental calcium, which can churn out its own supply of DNA-harming free radicals. The free radicals also may injure neurofilaments, proteins that serve as the skeleton ofthe cell. In addition, the immune system (Hofmann, Y. and Wirth, B. Hum. Mol. Genet. 11, 2037-2049, 2002) may be involved in harming neurons. Abnormalities can lead to an accumulation of the toxic calcium.
Glutamate-induced excitotoxicity is a potential contributor to ALS pathogenesis. Depolarization of the neuronal membrane after activation of neuronal glutamate receptors activates voltage-dependent Ca2+ channels, allowing Ca2+ entry into the cell. Thus, excess activation of neuronal glutamate receptors can cause cell death via alterations in cytosolic free Ca2+ homeostasis. For spinal motor neurons, rapid recovery of synaptic glutamate is accomplished by the glutamate transporter EAAT2 present in astrocytes. Loss of EAAT2 transporter could lead to increased extracellular concentrations of glutamate and excitotoxic degeneration of motor neurons (Julien, Review; Cell. 2001 Feb 23;104(4):581-91).
ALS researchers at the John Hopkins University have recently enabled mouse ALS models to make an excess of glutamate transport proteins in both brains and spinal cords. Preliminary studies of these mice show huge increases in their survival time, which led to the development of an "EAAT2 replacement therapy" for ALS patients at the John Hopkins University (The Robert Packard Center for ALS Research at John Hopkins, www.alscenter.org, 2002).
The excitotoxicity hypothesis is supported by the observation that the majority of sporadic ALS cases (~ 65%) have a reduction in the astroglial glutamate transporter EAAT2 in motor cortex and spinal cord (Rothstein et al., Ann Neurol. 1995 Jul;38(l):73-84). Germline mutations in the EAAT2 gene are very rare. Only one sporadic ALS case was identified with an EAAT2 gene variant that affects N-linked glycosylation and glutamate clearance capacity (Aoki et al., Ann Neurol. 1998 May;43(5):645-53; Trotti et al., J Biol Chem. 2001 Jan 5;276(l):576-82.).
One major support for the excitotoxicity hypothesis comes from the first drug therapy for ALS which is Riluzole (Rilutek, (Rhone-Poulenc Rorer Pharmaceuticals
Inc., College- ville, PA) approved by the FDA in 1995), an antiglutamate compound.
Riluzole retards nerve cells' release of glutamate. Although the effects of Riluzole are clearly modest, it has been the only drug that reliably shows clinical efficacy compared to the dozens of drugs studied by clinicans around the world in thousands of ALS patiens (Nervous Breakdown, A detailed analysis of the neurology market, UBS
Warburg, June 2001). Riluzole was reported to extend survival of ALS diagnosed patients for a few months. However, all therapeutic approaches tested so far are prone to fail when applied in later stages of the disease (Al-Chalabi A, and Leigh PN. Curr
Opin Neurol, Aug;13(4):397-405, 2000; Munch C, and Ludolph AC. Neurol Neurochir Pol, ;35(1 Suppl):41-50, 2001; Ludolph AC. J Neurol, Dec;247:13-18,
2000). Therefore, an early or even subclinical diagnostic marker might also have implications for therapeutic effectiveness.
It has been postulated that defects in axonal transport may be an underlying common pathway that leads to the degeneration of motor neurons in ALS patients and in relevant spontaneous and transgenic mouse models such as wobbler, nmd or SOD1
(Yang,Y. et al.. Nat. Genet. 29, 160-165, 2001; Cleveland DW. Neuron,
Nov;24(3):515-20, 1999; Jonsson PA et al. Neurobiol Dis., Aug;10(3):327-33, 2002;
Winter SM et al. J Neurol., Oct;247(10):783-6, 2000) For example, SOD mice with a mutation in the SOD-1 gene display a motor neuron degenerative phenotype with a decreased rate of slow axonal transport (Collard et al., Nature 375:61-64, 1995;
Zhang et al., J. Cell Biol. 139:1307-1315, 1997; Williamson and Cleveland, Nat.
Neurosci. 2:50-56, 1999.
Motor neurons of the brain and spinal cord are characterized by the length of their axons, which can reach a meter in length in an adult human. The significant length of these neuronal projections makes active axonal transport essential for normal cellular function. The axonal transport is microtubule dependant and includes both, an anterograde transport of organelles to the axonal synapse and the retrograde transport of multivesicular bodies and trophic factors back to the neuron cell body. The retrograde transport is mediated by the dynein-dynactin complex.
The dynein-dynactin complex Dyneins are cytoskeletal motor proteins. These can be defined as molecules that convert chemical energy, originating from nucleotide hydrolysis, into the mechanical force necessary for them to move along cytoskeletal polymers (c/Nallee and Howard (1990) Annu. Rev. Biochem 59: 909-932). Dyneins and kinesins constitute the superfamily of microtubule-dependent motor proteins, (Hirokawa (1998) Science 279, 519-526). Although the superfamily of dyneins is probably less diverse than that of kinesins, the family, which contributes to the structure and function of flagellar and cilliary axonems (axonemal dyneins), comprises more than a dozen dynein heavy chain isoforms (Milisav (1998) Cell Motil Cytoskeleton 39, 261- 272). Only four dynein heavy chain isoforms, contributing to different forms of the protein complex, called cytoplasmic dynein, are known in mammals.
The most abundant form of cytoplasmic dynein, whose identity is defined by the cytoplasmic dynein heavy chainl, is involved in a wide range of cellular functions. In mouse and human, the homologous proteins are refened to as cytoplasmic dynein heavy chainl. These proteins conespond, respectively, to the translation product of the transcript ofthe mouse gene Dnchcl (Genbank Accession No. AY004877) and the translation product of the full-length cDNA of the human gene DNCH1. The full- length human cytoplasmic dynein heavy chainl cDNA is disclosed herein (SEQ ID NO: 17). Several lines of evidence (e.g. immunodepletion of cytoplasmic dynein heavy chainl in in vitro motility studies and antibody injection) revealed that it functions as a molecular motor in prometaphase chromosome movement, mitotic spindle pole organization, Golgi organization, spindle orientation, nuclear migration, microtubule organization and reorganization and intracellular trafficking, including retrograde axonal transport, of membraneous organelles, (e.g. lysosomes and endosomes) (for review see Milisav (1998) Cell Motil Cytoskeleton 39, 261-272). Another isoform has been reported to be involved in intraflagellar protein transport (Pazour et al. (1999) J Cell Biol 144, 473-481). Cytoplasmic dynein was initially identified in nervous tissue (Paschal et al. (1987) J Cell Biol 105, 1273-1282) although it is expressed in several tissues (Mikami et al. (1993) Neuron 10, 787-796). Harada et al. ((1998) J Cell Biol 141, 51-59) generated mice lacking cytoplasmic dynein heavy chain 1 by targeted disruption of the cDHC (= Dnchcl) gene. Whereas cDHC-l- preimplantation embryos were microscopically indistinguishable from cDHC+/- and cDHC+/+ littermates, by 8.5 days p.c, no cDHC-l- embryo were found. This observation demonstrates that cytoplasmic dynein is essential for embryonic development. In conjunction with the functional data mentioned above, Harada et al. found that cells from cDHC-l- blastocysts, in contrast to those from cDHC+/+ blastocysts, were incapable of dividing in culture. Additionally, the Golgi complex was highly vesiculated and distributed in these cells as were the endosomes and lysosomes.
The cytoplasmic dynein complex consists of at least four classes of subunits: heavy, intermediate, light intermediate and light dynein chains. The dynein intermediate chain, dynein light intermediate chain, and dynein light chain specify the
• intracellular location of the dynein complex and regulate its motor activity, whereas the dynein heavy chains contain the machinery which imparts the motor activity.
The architecture ofthe complex is dominated by two heavy chains of 530 kDA each, which form a stem by the interaction of a large portion (amino acids 300 - 1140) of their N-termini. This stem also binds the dynein chains of lower molecular weight, e.g. two 74 kDa intermediate chains (between amino acids 446 and 701 of the heavy chains) and four 53-59 kDa light intermediate chains (between amino acids 649 and 800 of the heavy chains) (Tynan et al. (2000) J Biol Chem. 275, 32769-32774). Several 8-22 kDa light chains bind to the complex via interaction with the intermediate or light intermediate chains (c *Makoka et al. (2002) Biochemistry 41, 4302-4311). The intermediate chains probably impart the tethering of the dynein complex to the cargos (review: Asai and Koonce (2001) Trends Cell Biol 11, 196- 202). Intracellular transport processes mediated by cytoplasmic dynein additionally involve a variety of accessory proteins that are thought to target the cytoplasmic dynein complex to the intracellular cargos. Another large complex formed by several of these accessory proteins is named dynactin. Dynactin binds to dynein by the interaction of a subunit called pl50Glued with the dynein intermediate chains (Vaughan and Vallee(1995) J Cell Biol 131, 1507-1516). This interaction implicates dynactin as a receptor or adaptor that mediates the association of cytoplasmic dynein with cargo. Subsequent studies have demonstrated the essential nature of the dynein- dynactin interaction for most examples of dynein-mediated transport (Holleran et al., Int. Rev. Cytol. 182:69-109, 1998)
The binding of dynactin to dynein is essential for dynein-dependent intracellular movements (Gill et al. (1991) J Cell Biol 115, 1639-1650; Schroer and Sheetz (1991) J Cell Biol 115, 1309-1318) including those required for neuronal function. It has been shown that antibodies which specifically disrupt the binding of dynactin to dynein block vesicle motility along micrombules in extruded squid axoplasm (Waterman-Storer et al. (1997) Proc Natl Acad Sci USA 94, 12180-12185). Additionally, an overexpression ofthe dynamitin subunit of dynactin, which results in the dissociation of the dynactin complex, (Eckley et al. (1999) J Cell Biol 147, 307- 320) causes an inhibition of dynein-mediated processes in the cell (Burkhardt et al. (1997) J Cell Biol 139, 469-484).
Dynein-mediated intracellular movements are directed along micrombules towards their proximal (-) ends. This process is accomplished by ATP hydrolysis, which is predominantly catalysed by the first of four (counted from the one nearest to the N-terminus) P-loop motifs of each of two C-terminal globular heads which are formed by approximately 3000 amino acids of each of the two dynein heavy chains. Both globular heads also contain a microtubule binding domain, which is thought to be located at the tip of a stalk (Asai and Koonce (2001) Trends Cell Biol 11, 196- 202).
The dynein-dynactin complex and neurodegeneration
Recently, disruption of the dynein-dynactin complex in postnatal motor neurons of transgenic mice that overexpress dynamitin has been shown to result in reduction of microtubule based axonal transport and degeneration of the motor neurons and muscle atrophy over a time-course of many months (LaMonte et al. (2002) Neuron 34, 715-727) The pathology described therein is the result of a highly artificial transgenic approach for regional and time dependent disruption of the dynein-dynactin complex selectively in adult motor neurons. This situation is not comparable with any clinical situation with an underlying genetic cause, but would only address motor neuron specific stress factors for the dynein-dynactin system. The model described by LaMonte et al. is thus quite different from the model described in the present invention.
No effective therapy exists for the neurodegenerative disorders described herein. The selective nature of the degeneration is unexplained, but may relate to the highly specialized form and function of the motor neuron. There are known gene mutations in some familial cases of ALS and in almost all SMA, but the underlying defect in the majority of familial and sporadic ALS and a small proportion of SMA remains unknown. As mentioned before, in ALS the pathogenetic link between causal mutations in SODl (superoxide dismutase) and the death of motor neurons is not clear, although a variety of mechanisms have been proposed, including pathways disrupting neurofilameήt secondary structure (Miller (2002) Cell Mol Life Sci 59, 323-330) that result in slowing of axonal transport. Only in 2 % of ALS cases a preclinical genetic diagnosis by detection of SODl mutations responsible for 20% of familial ALS is possible. No preclinical or subclinical diagnostic tool for the broad majority of ALS cases is available, therefore treatment can so far only start late in the course of the disease when already a large number of motor neurons have died. Therapy might not be suitable to stop the ongoing disease process. Therefore, new diagnostic tools such as a genetic test for disease relevant genes are urgently needed.
The present invention provides an animal model for conelating mutations or defects in the cytoplasmic dynein heavy chainl gene with human disorders, including movement hyperactivity, hyperexcitability disorders (e.g. myoclonic cramping, epilepsy), excitotoxicity disorders, and neurodegeneration, such as Alzheimer's disease, Parkinson's disease, and Huntington's disease, and specifically motor neuron degeneration, such as ALS (Amyotrophic Lateral Sclerosis), SMA (Spinal Muscular Atrophy), SBMA (Bulbo-Spinal Muscular Atrophy), PBP (progressive Bulbar Palpsy), PMA (Progressive Muscular Atrophy), and PLS (Primary Lateral Sclerosis), resulting in whole or in part from these mutations or defects in the cytoplasmic dynein heavy chainl gene or the protein it encodes. The Cral (cramping 1) mutation in cytoplasmic dynein itself results in progressive motor neuron degeneration in heterozygous mice. Specifically, this invention provides an animal model that demonstrates the role of cytoplasmic dynein heavy chainl in movement hyperactivity, hyperexcitability disorders (e.g. myoclonic cramping, epilepsy), excitotoxicity disorders and neurodegeneration, specifically α-motor neuron degeneration, resulting from a mutation or defect in cytoplasmic dynein heavy chainl. The Cral animal model described herein demonstrates a germline missense mutation that causes subtle changes in the cytoplasmic dynein heavy chain 1, and is sufficient to specifically induce age dependent motor neuron degeneration without grossly affecting the housekeeping function of the dynein-dynactin complex in other cell types. The Cral mutation in cytoplasmic dynein heavy chain 1 allows normal development and normal function ofthe organism in early adulthood. The animal model provided herein meets the cunently unfulfilled need for a validated model to study the causes and precise physiological effects of such diseases associated with abenant cytoplasmic dynein heavy chainl function. Similarly, this invention provides a means for identifying antagonists and inhibitors for cytoplasmic dynein heavy chainl in such disorders.
The present invention also provides significant data useful in neurobiology and clinical research, as it describes in an animal model a new pathway involved in neurodegeneration, and also suggests a possible genetic cause for ALS/Lou Gehrig's disease.
Furthermore, the present invention provides diagnostic tests for latent or progressive diseases, or a propensity to develope a disease or passing on a contributing or causatory recessive genetic mutation to progeny, wherein the disease is selected from, but not limited to, the group of human disorders, including movement hyperactivity, hyperexcitability disorders (e.g. myoclonic cramping, epilepsy), excitotoxicity disorders, and neurodegeneration, in particular Alzheimer's disease, Parkinson's disease, Huntington's disease, amyotropic lateral sclerosis, spinal muscular atrophy, and fiber type grouping in Musculus tibialis anterior. More specifically the present invention provides diagnostic tests for latent or progressive diseases, or a propensity to develope a disease or passing on a contributing or causatory recessive genetic mutation to progeny, wherein the disease is selected from, but not limited to, the group of human motor neuron degeneration disorders, including ALS (Amyotrophic Lateral Sclerosis), SMA (Spinal Muscular Atrophy), SBMA (Bulbo-Spinal Muscular Atrophy), PBP (progressive Bulbar Palpsy), PMA (Progressive Muscular Atrophy), and PLS (Primary Lateral Sclerosis). SUMMARY OF THE INVENTION
This invention provides inter alia a non-human animal useful as a model of dynein heavy chain disorders in humans, particularly cytoplasmic dynein heavy chainl disorders.
In one embodiment, the invention provides an animal model which carries a mutated cytoplasmic dynein heavy chainl gene encoding a cytoplasmic dynein heavy chainl protein with a modified amino acid sequence compared to the wild type sequence. The invention also provides cell lines derived from the animal model ofthe present invention.
The present invention also relates to the use of the animal model of the invention for the study of disorders associated with deficiencies or malfunctions in cytoplasmic dynein heavy chainl. In one embodiment, the invention provides methods of diagnosis for deficiencies or malfunction in cytoplasmic dynein heavy chainl or the gene encoding it. In another embodiment, the invention provides a method for screening of preventive or therapeutic agents of disorders and symptoms associated with movement hyperactivity, hyperexcitability disorders (e.g. myoclonic cramping, epilepsy), excitotoxicity disorders and neurodegenerative diseases; overactivity or undesirable activity of endogenous cytoplasmic dynein heavy chainl ; overexpression, over-production or under-production of endogenous cytoplasmic dynein heavy chainl; an excessive or undesirable condition shown to be modulated by endogenous cytoplasmic dynein heavy chainl.
Furthermore, the present invention provides mutated cytoplasmic dynein heavy chainl nucleic acids and amino acids having modified sequences compared to the wild type sequence, as well as vectors and cell lines for expressing the muteins recombinantly. These mutated nucleic acids and amino acids may also be used in the diagnostic and therapeutic methods contemplated herein. In a specific embodiment, the cytoplasmic dynein heaVy chainl mutein has an amino acid substitution at a position that conesponds to a conserved amino acid of mouse or human cytoplasmic dynein heavy chain 1 as described in an individualized manner in connection with the prefened muteins of the invention below. In a specific embodiment, the cytoplasmic dynein heavy chainl mutein has an amino acid substitution, e.g., at position 1055 resulting from a point mutation at nucleotide +3169 of the coding sequence, conesponding to position 3328 of SEQ ID NO:l (Genbank Ace. No. AY004877; murine Dnchcl mRNA). Also provided are recombinantly generated cytoplasmic dynein heavy chainl muteins of the invention (both the murine and human othologs), as well as antibodies binding to these muteins, and chimeric protein derivatives of these cytoplasmic dynein heavy chainl muteins.
Uses of these muteins as modulators (e.g. agonists or antagonists) of endogenous cytoplasmic dynein heavy chainl activity are also contemplated. Consequently, pharmaceutical compositions comprising the cytoplasmic dynein heavy chainl muteins of this invention with or without a pharmaceutically acceptable carrier are also contemplated. Specifically, the invention includes the use ofthe cytoplasmic dynein heavy chainl muteins of the present invention, the polynucleotides encoding them, and vectors bearing said polynucleotides, for the prevention, treatment or amelioration of a medical condition in a mammalian subject, particularly a human subject. In particular, the invention provides the use of these muteins for the manufacture of a medicament for prevention, treatment or amelioration of any medical conditions characterized by movement hyperactivity, hyperexcitability disorders (e.g. myoclonic cramping, epilepsy), excitotoxicity disorders and neurodegeneration.
The invention also includes a method of gene delivery and expression in a target cell of a mammal, comprising the step of introducing a viral vector into the target cell, wherein the viral vector is derived from a virus that has a low replicative efficiency in the target cell and has at least one insertion site containing a wild type or mutant cytoplasmic dynein heavy chainl nucleic acid, wherein the nucleic acid is operably linked to a promoter capable of expression in the host. In a prefened embodiment, the viral vector is a non-lytic viral vector.
The invention also provides a method of gene delivery and expression in a target cell of a mammal comprising the steps of: (a) providing an isolated nucleic acid fragment of wild type or mutant cytoplasmic dynein heavy chainl ofthe invention; (b) selecting a viral vector derived from a virus that has a low replicative efficiency in the target cell, wherein the vector has at least one insertion site for insertion of said isolated nucleic acid fragment operably linked to a promoter capable of expression in the target cells; (c) inserting the isolated nucleic acid fragment into the insertion site, and (d) introducing the vector into said target cell wherein said gene is expressed at detectable levels. In a prefened embodiment, the virus is selected from the group consisting of retrovirus, adeno virus, and pox virus. In another embodiment, the virus is a strain that has been genetically modified or selected to be non-virulent in a host. In another embodiment, the pox virus is vaccinia. In one embodiment, the virus is selected from the group consisting of retrovirus, adenovirus, iridoviruses, coronaviruses, togaviruses, caliciviruses and picornaviruses.
In the context ofthe present invention it has been recognized that all members (or subunits) of the dynein-dynactin complex should be considered as suitable targets for screening for a predisposition in hereditary and sporadic forms of motor neuron degenerative diseases like ALS (Amyotrophic Lateral Sclerosis), SMA (Spinal Muscular Atrophy), SBMA (Bulbo-Spinal Muscular Atrophy), PBP (progressive Bulbar Palpsy), PMA (Progressive Muscular Atrophy), and PLS (Primary Lateral Sclerosis). It is also contemplated that not only diseases such as ALS but also other neurodegenerative disorders will be connected to mutations or alterations within the dynein-dynactin complex. This applies, e.g., to disorders which are connected to axonal transport dysfunction such as Huntington's disease (dynein-dynactin binds Huntington associated binding protein 1 (Hapl)), Parkinson's disease (demonstration of inclusion body formation similar to ALS indicated intracellular transport enors) or Alzheimer's disease (disturbance of glutamate homeostasis similar to ALS could be a result of altered retrograde axonal transport kinetics). Thus, such neurodegenerative diseases are likewise disease targets contemplated e.g. in connection with the methods of screening for a predisposition for a neurodegenerative disease according to the present invention.
Accordingly, the present invention provides in a further embodiment a method of identifying a protein or nucleic acid marker indicative of an increased risk of a mammalian subject, particularly a human subject, or a mouse, a rat, a rabbit, a cow or a hamster, preferably a mouse or a rat, of developing a neurodegenerative disease, said method comprising the step of analyzing a test sample derived from said subject for the presence of a difference compared to a similar test sample if derived from a subject of the same species unaffected by or known not to be at risk of developing said disease, wherein said difference is indicative of the presence of a mutation in an allele of a gene coding for a protein, which is a subunit of the dynactin/dynein complex.
In a further aspect, the present invention provides a method of identifying a protein or nucleic acid marker indicative of an association of a neurodegenerative disease in a mammalian subject, particularly a human subject, or a mouse, a rat, a rabbit, a cow or a hamster, preferably a mouse or a rat, with a mutation in an allele of a gene coding for a protein, which is a subunit ofthe dynactin/dynein complex.
In yet a further aspect of the present invention, a method is provided for identifying a predisposition of a mammalian subject, particularly a human subject, or a mouse, a rat, a rabbit, a cow or a hamster, preferably a mouse or a rat, for developing a neurodegenerative disease, said method comprising the step of determining whether a test sample derived from said subject indicates the presence of a mutation in an allele of a gene coding for a protein, which is a subunit of the dynactin/dynein complex, indicative of an increased risk of said subject of developing said neurodegenerative disease.
Also provided is a method for determining whether a neurodegenerative disease in a mammalian subject, particularly a human subject, or a mouse, a rat, a rabbit, a cow or a hamster, preferably a mouse or a rat, is associated with a mutation in an allele of a gene coding for a protein, which is a subunit of the dynactin/dynein complex, said method comprising the step of determining whether a test sample derived from said subject indicates the presence of a mutation in an allele of a gene coding for said protein.
In yet another aspect of the present invention, oligonucleotides suitable for identifying the above-mentioned mutations, kits containing such oligonucleotides, and solid supports, such as DNA chips, to which said oligonucleotides are bound, are provided.
Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Although methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention, suitable methods and materials are described below. All publications, patent applications, patents, and other references mentioned herein are incorporated by reference in their entirety. In addition, the examples are illustrative only and are not intended to be limiting.
Features and advantages of the invention in addition to those explained above will be apparent from the following detailed description and claims.
BRIEF DESCRIPTION OF THE DRAWINGS
Figure 1 presents a heterozygous Cral animal (right) compared to a wildtype mouse (left) demonstrating cramping ofthe hindlimbs and forelimbs ofthe mutant animal.
Figure 2 is a chart diagram, indicating movement as ambulatory activity expressed as beam breaks (average counts per hour) detected by a Cage Rack Photobeam Activity Cage System (San Diego Instruments, Inc., San Diego, CA, USA) of heterozygous Cral (Cral/+) animals and wildtype individuals during four 6-hour periods of an artificial 24 hour diurnal cycle, in which darkness lasted from 6pm to 6am, and the period from 6 am to 6 pm was light.
Figure 3 is a listing ofthe latency to fall values (seconds) of heterozygous Cral mice (Cral/+) and control individuals (+/+) in a semi-quantitative hanging wire assay. Muscle endurance of adult heterozygous Cral individuals (Cral/+) was measured in comparison to wildtype individuals by measuring the mouse's latency to fall from an inverted wire grid, as described in Example 3. Figure 4 depicts photomicrographs of hematophilin and eosin (H&E) stained histological sections of a Cral/+ and a wildtype mouse hippocampus. Neurons characterized by reversible excitatory neuronal damage can be identified by the dark staining ("dark neurons"; indicated by anows). (See Example 5)
Figure 5 depicts photomicrographs of cross sections of the lumbar area of spinal cords from a wild type (left panel) and a homozygous Cral /Cral individual (right panel). The top row photomicrographs depicts a drastic reduction of the number of neurons in the anterior horn area of the Cral/Cral individual (right), as compared to the wildtype (left). In the middle row, TUNEL stains of anterior horn are shown (see anow), demonstrating significantly enhanced levels of apoptosis in the anterior horns of the Cral/Cral individuals (right). In the upper row of photomicrographs a reduction is seen in the number of spinal ganglia neurons of Cral/Cral individuals
(right).
Figure 5.2 shows that progressive impairment of muscle function and motor coordination is associated with decreasing numbers of α-motor neurons and altered composition of muscle fibre types. Motor neuron degeneration in 16 month old Cral/+ heterozygotes (b, d, f) mice in comparison to wildtype (+/+) littermates (a, c, e) (a-d: immunhistochemistry using NeuN primary antibody; e, f: H&E histochemical staining). Loss of spinal α-motor neurons in 16 months old Cral/+ (h) mice is accompanied by altered composition of muscle fibre types, with a predominance of large type 1 fibres in Periodic acid-Schiff (PAS) staining, compared to +/+ littermates
(g)-
Figure 6 represents a list of selected genes expressed in fetal brain of individual
Cral/Cral mice, shown to be transcriptionally deregulated by comparison of transcript levels to those detected in wildtype individuals. The direction of deregulation (up or down) and the biological significance of those genes is indicated.
Figure 7 schematically depicts an exon structure comparison of the human cytoplasmic dynein heavy chainl (HsDNCHl) and the mouse cytoplasmic dynein heavy chainl (MmDnchcl) genes. Exonic sequences were aligned with sequencher software (version 4.0.5, GeneCodes Corp., Ann Arbor Mi, USA). Assembly of the human exons and the mouse exons, respectively, results in a full-length cDNA of human DNCHl and a full-length cDNA of mouse Dnchcl (representing the protein coding sequence within the mRNA, defined under GenBank Accession No. AY004877) as indicated by the anows at the top of the figure. Equivalent exons are paired, with the human exon positioned above the conesponding mouse exon.
Figure 8 is a comparative listing of all exons of the mouse (MmDnchcl) and human (Hs DNCHl) dynein heavy chainl genes. The size of each exon is indicated by its length in basepairs (bp). The human gene consists of 78 exons, and the mouse gene consists of 77 exons. The difference in exon number between these two species is caused by an additional RNA splice event in human, separating exon 67 (61 bp) and exon 68 (124 bp); mouse exon 67 having 185 bp.
Figure 9 depicts the amino acid sequence alignment between the human (Hs DNCHl) and the mouse (Mm Dnchcl) cytoplasmic dynein heavy chainl proteins. Black boxes indicate amino acid identity, and grey boxes indicate conserved amino acid substitutions. The degree of identity is 97%.
Figure 10 depicts the amino acid sequence alignment between the human (Hs DNCHl), the mouse (Mm Dnchcl), and the rat cytoplasmic dynein heavy chainl proteins, indicating highly conserved amino acid residues between species. Black boxes indicate amino acid identity, and grey boxes indicate conserved amino acid substitutions. The degree of identity is 96%.
Figure 11 depicts the amino acid sequence alignment between the human and the mouse cytoplasmic dynein intermediate chain 1 proteins. Black boxes indicate amino acid identity, and grey boxes indicate conserved amino acid substitutions. The degree ofidentity is 88%.
Figure 12 depicts the amino acid sequence alignment between the human, the mouse, and the rat cytoplasmic dynein intermediate chain 1 proteins, indicating highly conserved amino acid residues between species. Black boxes indicate amino acid identity, and grey boxes indicate conserved amino acid substitutions. The degree of identity is 87%. Figure 13 depicts the amino acid sequence alignment between the human and the mouse cytoplasmic dynein intermediate chain 2 proteins. Black boxes indicate amino acid identity, and grey boxes indicate conserved amino acid substitutions. The degree ofidentity is 94%.
Figure 14 depicts the amino acid sequence alignment between the human, the mouse, and the rat cytoplasmic dynein intermediate chain 2 proteins, indicating highly conserved amino acid residues between species. Black boxes indicate amino acid identity, and grey boxes indicate conserved amino acid substitutions. The degree of identity is 93.5%.
Figure 15 depicts the amino acid sequence alignment between the human and the mouse DCTN1 proteins. Black boxes indicate amino acid identity, and grey boxes indicate conserved amino acid substitutions. The degree of identity is 97%.
Figure 16 depicts the amino acid sequence alignment between the human, the mouse, and the rat DCTN 1 proteins, indicating highly conserved amino acid residues between species. Black boxes indicate amino acid identity, and grey boxes indicate conserved amino acid substitutions. The degree of identity is 95%.
DETAILED DESCRIPTION OF THE INVENTION
This invention provides a non-human animal useful as a model of dynein heavy chain disorders in humans, particularly cytoplasmic dynein heavy chainl disorders. The Cral mutation, disclosed herein, was generated in offspring of male C3HeB/FeJ mice (Cral, Institute of Mammalian Genetics at the GSF - National Research Center for Environment and Health) mutagenized with N-ethyl-N- nitrosourea (EΝU). The mutation was detected by Cral mice displaying an unusual twisting of the body and clenching of the hindlimbs when suspended by the tail. Subsequent breeding and phenotype analysis showed Cral as an autosomal dominant trait that gives rise to progressive loss of muscle tone and locomotor ability in heterozygous mice, although life-span appears normal. Furthermore, Cral heterozygotes were impaired in motor coordination tests and in muscle function tests. Homozygous Cral mice die shortly after birth, and exhibit increased neuronal apoptosis. It is predicted that these homozygous mice also have neuronal inclusion bodies that are positive for both neurofilaments and SODl protein. This result implicates modulation of dynein gene function in mechanisms of human motor neuron degeneration, and cell death in general. It also shows an unexpected link between the dynein complex and SODl function that may shed further light on why SODl mutations cause motor neuron degeneration and ALS.
Dyneins are implicated in a number of different diseases and disorders.
Abnormalities in axonal transport are described in the human disease ALS (Sasaki and Iwata (1996) Neurology 47, 535-540). Such abnormalities are also observed in several mouse models with motor neuron degeneration, e.g. the wobbler mouse (Mitsumoto et al. (1986) Ann Neurol 19, 36-43) and transgenic mice overexpressing the heavy chain of neurofilament protein (Collard et al. (1995) Nature 375, 61-64), SOD-1 (Zhang et al. (1997) J Cell Biol 139, 1307-1315) and dynamitin (LaMonte et al. (2002) Neuron 34, 715-727). Studies in Drosophila have shown that mutations in the cytoplasmic dynein heavy chain (cDhc64c) lead to a disruption of axonal organelle transport in both directions and as a consequence to axonal swelling and posterior paralysis (Martin et al. (1999) Mol Biol Cell 10, 3717-3728).
In contrast to the dynactin-overexpressing transgenic mouse described by LaMonte et al. ((2002) Neuron 34, 715-727) which is characterized by an indirect mechanism of inhibition of dynein function in only the neurons, the mouse mutant of the present invention is suitable to investigate the role of cytoplasmic dynein heavy chainl not only in transport processes in neurons but in all cell types expressing cytoplasmic dynein heavy chainl. Additionally, the mouse mutant of the present invention enables the analysis of cytoplasmic dynein malfunction during development whereas the transgenic mouse described by LaMonte et al. ((2002) Neuron 34, 715- 727) does not express the transgene before birth and, therefore, it is characterized by a late onset of symptoms. It has been shown that dynein can associate with its cargo also through interactions with proteins other than dynactin (for review: Karcher et al. (2002) Trends in Cell Biology 12, 21-27). Since the mutation found in the cytoplasmic dynein heavy chain 1 gene of the mouse mutant of the present invention is located outside the binding site for the dynein intermediate chains which impart the binding of dynactin, the mouse mutant of the present invention will prove useful for studying dynactin-independant dynein functions.
Apart from diseases characterized by motorneuron degeneration other types of neurodegenerative diseases and age-related neurodegenerative processes may be related to disturbances of axonal transport. One example is the atrophy of basal forebrain cholinergic neurons in the rat which have been shown to be accompanied by an impairment of uptake or retrograde transport of tracer molecules (De Lacalle et al, (1996) Neuroscience 75, 19-27). It is predicted that dynein function may play a role in the development of such neurodegenerative diseases and age-related neurodegenerative processes, and embodiments of the invention include conelative diagnostic methods, therapeutic medicaments and treatments, as described inn greater detail below.
Another example is Huntington's disease. HAPl, a neuronal cytoplasmic protein, is associated with huntingtin, the protein which carries a polyglutamine repeat that is expanded in Huntington's disease (>36 units). It has been shown that the affinity of HAPl for huntingtin is increased if the latter bears an expanded polyglutamine repeat (cf Li et al. (2002) J Biol Chem, in press). HAPl has been found on synaptic vesicles (Gutekunst et al. (1998) J Neurosci 18, 7674-7686) and it binds to P150 (Li et al. (1998) J Biol Chem 273, 19220-19227), the largest subunit of the dynactin complex, which in turn, is required for cytoplasmic dynein mediated intracellular movement including retrograde axonal transport. Functional results obtained by Block-Galarza ((1997) Neuroreport 8, 2247-2251) are in agreement with this potential link between huntingtin and dynein-mediated axonal transport processes. Additionally, Li et al. ((2002) J Biol Chem, in press) provided evidence that HAPl is involved in the regulation of vesicular trafficking from early endosomes to the late endocytotic compartment as does dynein (Apodaca (2001) Traffic 2, 149-159). Recent work by Kamal et al. (2000, Neuron 28, 449-459) suggests that the amyloid precursor protein (APP), which plays a major role in the development of Alzheimer's disease might function as a membrane bound cargo receptor for kinesin which is responsible for the anterograde transport of vesicles in neurons. Gunawardena and Goldstein ((2001) Neuron 32, 389-401) again found that the axonal transport phenotypes of certain Appl (the Drosophila homolog of APP) mutants are suppressed by a reduction of dynein expression. This result for the first time suggests a functional link between dynein and APP.
The mouse mutant of the present invention provides a means to analyze whether three proteins (huntingtin, HAPl and APP) involved in the pathogenesis of the neurodegenerative diseases, Huntington's disease and Alzheimer's dementia are linked by the same intracellular transport pathways. This connection will help reveal the pathogenetic mechanisms of both diseases.
Lissencephaly syndromes are a familiy of diseases which involve incomplete development of the human brain (Dobyns et al. (1993) JAMA 270, 2838-2842) characterized by extensive disorganization of cortical neurons. This defect is thought to be due to a failure ofthe capability of neuronal cell body migration during the early stage of brain development. As a consequence of this, the convolutions characteristic of the normal brain surface are reduced in extent and number leading to a smooth appearence of wide portions ofthe brain.
Syndromes involving lissencephaly include Norman-Roberts Syndrome, Fukuyama Syndrome, Walker- Warberg Syndrome and Miller-Dieker Syndrome. Some cases of isolated lissencephaly have been shown to arise from mutations in the LIS-1 gene (e.g. Lo Nigro et al. (1997) Hum Mol Genet 6, 157-164).
Recent work has implicated the human LIS-1 gene in the regulation of function of cytoplasmic dyneins (for review see Nallee et al. (2000) Biochim Biophys Acta 1496, 89-98). Neurons in genetic mosaics of Drosophila which contain a mutated cytoplasmic dynein heavy chain (Dhc64C) display phenotypes similar to Lis 1 mutants (Liu et al. (2000) Nat Cell Biol 2, 776-783). We predict that deregulation of cytoplasmic dynein might be of causative relevance for the development of lissencephalic symptoms.
Homozygous null mice for the Lisl gene die early in embryogenesis whereas mice bearing mutations which cause different degrees of reduction of the function of Lisl exhibit conesponding degrees of brain disorganization as well as cerebellar defects (Hirotsune et al. (1998) Nature Genetics 19, 333-339). The mouse mutant of the present invention provides a mean to comparatively analyze the overlap and the differences of cytoplasmic dynein and Lis 1 function in a mammalian model organism.
The homozygous knockout of the gene encoding cytoplasmic dynein heavy chainl in the mouse results in embryonic lethality before 8.5 days post coitus. Heterozygous individuals have no obvious phenotype (Harada et al. (1998) J Cell Biol 141, 51-59). The transgenic dynamitin-overexpressing mouse described by LaMonte et al. ((2002) Neuron 34, 715-727) is characterized by a motomeuron specific inhibition ofthe functions of cytoplasmic dynein, which is mediated by the accessory protein complex dynactin. Due to the developmental regulation of the transgene by the Thy2 promotor of the transgene construct, inhibition is restricted to postnatal stages.
There is no animal model available which reflects the consequences of malfunction of cytoplasmic dynein heavy chainl in vivo in all types of cells and during embryonic and fetal development. The mutation leading to cytoplasmic dynein heavy chainl dysfunction in the mouse model of the present invention is located within a region of cytoplasmic dynein heavy chainl dimerization (Tynan et al. (2000) J Biol Chem 275, 32769-32774) which does not overlap with intermediate chain binding. Intermediate chain binding is required for dynactin binding although Naughan and Nallee ((1995) J Cell Biol 131, 1507-1516) and Tynan et al. ((2000) J Biol Chem 275, 32769-32774) have provided evidence for the existence of non- dynactin based cargo binding mechanisms.
The characterization of such an animal model (i.e. one that reflects the consequences of malfunction of cytoplasmic dynein heavy chainl in vivo in all types of cells and during embryonic and fetal development) would provide a model for determining the consequences of cytoplasmic dynein malfunction in humans. This in turn would help to evaluate the role of dynein malfunction in various disease processes such as those described above. The present invention provides a non-human animal model which expresses a modified cytoplasmic dynein heavy chainl protein compared to the amino acid sequence of the wild type protein. The expressed cytoplasmic dynein heavy chainl may have similarity in sequence and secondary structure to a vertebrate cytoplasmic dynein heavy chainl. In a prefened embodiment, the vertebrate is preferably from a genus selected from the group consisting of Homo sapiens, Mus musculus (e.g. mice), Rattus (e.g. rats), Oryctologus (e.g. rabbits) and Mesocricetus (e.g. hamsters).
Animals carrying a mutated cytoplasmic dynein heavy chainl allele expressing the modified cytoplasmic dynein heavy chainl, exhibit a variety of phenotypical features including: myoclonic cramps (which are especially pronounced in the hindlimbs), movement hyperactivity, reduced muscle endurance, excitatory neuronal damage ("dark neurons") in the hippocampus (gyrus dentatus, CA4, CA3) as well as in the upper layer ofthe cortex and in the Purkinje cell layer ofthe cerebellum. These animals also exhibit decreasing numbers of α-motor neurons and altered composition of musculus vastus fibre types.
Compared with heterozygous animals, homozygous individuals exhibit an elevated incidence of perinatal lethality (100% in homozygous animals, versus approximately 20% amongst heterozygous animals), accelerated neurondegeneration in the anterior horns of the spinal cord, and accelerated neurodegeneration in the dorsal root ganglia. Neurodegeneration in heterozygous animals is apparent at a much later stage, i.e. late adulthood.
The observed neurological phenotype of myoclonic cramping and epilepsy in combination with the morphological conelate of reversible excitatory neuronal cell stress within the hippocampal layers CA4 and CA3 are indications for a hyperexcitability status in Cral animals. This in turn is consistent with an ambulatory locomotor hyperactivity of Cral animals. Hyperexcitation, if occuring repeatedly or continuously over longer periods of time, could result in excitotoxicity by mechanisms such as enhanced generation of reactive oxygen species (ROS) (see Haberny et al. (2002) Toxicol Sci, 68, 9-17; Bondy and LeBel, (1993) Free Radic Biol Med 14, 633-642; Tapia et al. (1993) Neurochem Int 34, 23-31; Niebroj-Dobosz et al. (2002) Acta Neurol Scand 106, 39-43; Shaw and Bains (2002) Cell Mol Biol (Noisy-le-grand) 48, 127-136). ROS are suggested to be involved in the development of several neurodegenerative disorders, e.g. ALS, Parkinson's disease and Alzheimer's disease as well as aging. Therefore there is a possible link between the hyperexcitation status in Cral animals and the development of neurodegeneration at a later age.
The term "modified" according to the present invention refers to an alteration compared to the wild type. The term "phenotype" according to the invention refers to a collection of morphological, physiological, behavioral and biochemical traits possessed by a cell or organism that results from the interaction of the genotype and the environment. As mentioned above, the animal model of the present invention displays readily observable abnormalities. In a prefened embodiment the animal of the invention shows at least 2, preferably at least 4, more preferably 6 and most preferably all ofthe above listed phenotypical features.
Nucleic Acids
The present invention provides nucleic acid sequences encoding wild type and mutated murine and human cytoplasmic dynein heavy chainl proteins, i.e., muteins as described in an individualized manner in connection with the prefened muteins ofthe invention below. Specifically, this invention provides mutated nucleic acid sequences for wild type murine cytoplasmic dynein heavy chainl mRNA (GenBank Accession Number AY004877.1, SEQ ID NO:l). For example, a mutated version of SEQ ID NO:l, containing a point mutation at position 3328 (which is position +3164 of the polypeptide coding sequence) is shown in SEQ ID NO:3. In addition, this invention provides a mutated coding nucleic acid sequence for human cytoplasmic dynein heavy chainl containing the open reading frame for the human ortholog nucleic acid sequence, with a point mutation at the conesponding position (position +3170) in the sequence, as shown in SEQ ID NO:5. In addition, this invention provides the wild type coding nucleic acid sequence for human cytoplasmic dynein heavy chainl, as shown in SEQ ID NO: 17.
Table 1. GenBank Accession Number AY004877.1 (SEQ ID NO:l) gi I 9717244 I gb I AY004877.il Mus musculus cytoplasmic dynein heavy chainl mRNA, complete eds GCCGCGTCGACAGCCGGCTCCGCTGTCCGCAGTCGGCCGCGGGTT AGCG.GGCAGAGCGTCTCCTGTCGCCGGTTCCCCTCGCTTACTGCT CTCTCGTGCCGGAGGCCGCTCCTCTCGGCTCTCGCTCTCTCTCTT TCTATCTCTCTCCCTTCCGCGGATCCGCCATGTCGGAGCCGGGCG GCGGCGAGGACGGCTCGGCAGGCCTGGAGGTGTCGGCGGTGCAGA ATGTGGCGGACGTGGCGGTGCTGCAGAAGCACCTGCGTAAGCTGG TGCCGCTGCTGCTGGAGGACGGCGGCGACGCGCCGGCTGCGCTGG AGGCGGCGCTGGAGGAGAAGAGCGCCCTGGAGCAGATGCGCAAGT TCCTGTCAGACCCGCAGGTCCACACGGTCCTGGTGGAGCGCTCCA CCCTCAAAGAGGACGTTGGTGATGAAGGAGAAGAGGAGAAAGAAT CATTTCCTATAACATCΆACATAGACAT CAT ACGGGGTAAAGT CCAACAGCTTGGCGTTCATCAAGCGAGCTCC GTGATTGATGCAG ACAAGCCAGTGTCGTCCCAGCTCCGAGTCCTCACTCTGAGTGAAG ACTCGCCGTATGAGACACTGCACTCTTTCATCAGCAATGCAGTGG CTCCTTTCTTTAAGTCCTACATCAGAGAGTCTGGCAAAGCAGACA GGGATGGTGATAAGATGGCTCCTTCAGTTGAAAAAAAGATTGCAG AGCTTGAAATGGGACTCCTCCACCTGCAGCAGAACATTGAGATCC CAGAGATCAGCTTGCCAATTCATCCCATCATCACGAACGTTGCGA AGCAGTGCTATGAGCGCGGAGAAAAGCCCAAAGTTACAGATTTTG GTGATAΆGGTTGAAGACCCAACTTTCCTTAACCAATTACAGTCTG GAGTTAATCGGTGGATCCGAGAAATTCAAAAGGTGACCAAGCTTG ACCGGGATCCAGCATCAGGAACTGCCTTGCAGGAAATCAGCTTTT GGCTAAACTTGGAACGTGCGTTGTACCGCATCCAAGAGAAGCGGG AGAGCCCCGAGGTGCTCCTGACTCTGGACATCCTGAAGCATGGCA AACGTTTCCATGCCACTGTCAGTTTTGACACTGACACAGGTCTGA AGCAGGCGTTGGAAACGGTGAATGACTACAACCCTCTGATGAAAG ACTTCCCTCTGAATGACTTGCTGTCTGCCACGGAGCTGGACAAGA TAAGGCAGGCCCTTGTTGCAATTTTCACACATCTGAGAAAGATCC GCAACACGAAGTACCCGATTCAGCGGGCCCTGCGTCTCGTGGAGG CCATCTCCAGAGACCTGAGTTCTCAGCTGCTCAAGGTCTTGGGCA
CTCGGAAGTTGATGCATGTAGCCTATGAAGAGTTTGAAAAGGTCA GGTGGCTTGCTTCGAAGTCTTCCAGACGTGGGACGACGAGTACG
AGAAGCTCCAGGTGCTGCTGCGAGACATCGTCAAGAGGAAGCGGG AGGAGAACCTGAAGATGGTGTGGCGCATCAACCCCGCTCACAGGA AGCTTCAGGCCCGCCTCGACCAGATGAGGAAGTTCCGCCGCCAGC ACGAGCAGCTGAGGGCTGTCATTGTCAGGGTCCTGAGGCCACAGG TCACAGCAGTCGCACAACAGAACCAAGGAGAAGCACCTGAACCCC AAGACATGAAAGTGGCCGAGGTGCTCTTTGATGCTGCCGACGCCA ACACCATTGAGGAGGTGAACCTGGCCTACGAGAATGTCAAGGAAG CGATGGTCTGGATGTTTCCAAAGAAGGGACGGAGGCCTGGGAGG CCGCGATGAAGAGATACGATGAGAGGATCGACCGTGTGGAGACCC GCATCACCGCCCGCCTCCGAGATCAGCTCGGCACGGCCAAGAATG CCAATGAGATGTTCAGGATTTTCTCCAGGTTCAATGCACTGTTCG TCCGCCCACACATCCGAGGGGCCATTCGTGAATACCAGACCCAGC GATCCAACGTGTGAAAGATGACATCGAATCTCTGCACGACAAGT TCAAGGTCCAGTACCCGCAAAGCCAAGCTTG AAAATGAGTCATG CCGTGACCTGCCCCCCGTGTCAGGGTCTATCATCTGGGCTAAAC AGATCGACAGACAGCTCACTGCCTACATGAAGCGAGTGGAGGATG TCCTGGGCAAAGGCTGGGAGAACCACGTGGAAGGGCAGAAGCTGA AGCAGGATGGAGACAGCTTCCGAATGAAGCTCAACACCCAGGAGA TCTTCGATGACTGGGCGAGGAAGGTTCAGCAGCGCAACCTTGGTG TCTCCGGGCGCATCT CACCATTGAGAGCGC CGCGTGCGGGGCC GCACTGGGAATGTCCTCAAGCTAAAGGTGAACTTCCTTCCAGAGA TCATAACACTCTCCAAAGAAGTCCGGAACCTCAAGTGGCTTGGCT TCCGAGTGCCACTTGCAATTGTGAACAAGGCTCACCAAGCCAACC AGCTCTACCCATTTGCCATCTCGCTGATTGAAAGCGTCCGGACTT ACGAGCGCACCTGTGAGAAGGTGGAGGAGCGCAATACCATT CCC TGCTAGTGGCCGGCCTAAAGAAGGAGGTGCAGGCCTTAATCGCAG AAGGCATCGCGT GGTGTGGGAGTCCTACAAGCTCGACCCCTACG TGCAGCGCCTGGCAGAGACGGTTTTCAACTTCCAGGAGAAGGTGG ACGACCTACTGA ATTGAGGAAAAGATAGACCTGGAGGTCCGCT CCTTGGAAACCTGCATGTATGACCACAAGACATTCTCAGAGATCT TGAACAGAGTGCAGAAAGCAGTGGACGACCTAAACCTGCACTCCT ATTCCAATCTGCCCATCTGGGTCAACAAGCTGGACATGGAGATTG AAAGGATACTGGGCGTCCGCCTGCAAGCTGGCCTTCGAGCTTGGA CCCAGGTTCTTCTTGGACAAGCTGAGGATAAAGCAGAAGTCGACA TGGATACAGATGCTCCACAAGTCAGTCACAAGCCTGGTGGAGAGC CCAAGATCAAAAACGTGGTTCACGAGCTGAGGATAACAAATCAGG TCATCTATCTGAACCCACCCATTGAGGAGTGCAGGTACAAGCTGT ACCAGGAGATGTTCGCGTGGAAGATGGTTGTGCTGTCCCTGCCCA GGATCCAGAGCCAGAGGTACCAGGTGGGAGTGCATTACGAGTTGA CGGAGGAAGAGAAGTTCTATCGGAATGCACTGACAAGGATGCCCG ACGGCCCTGTCGCCCTGGAAGAGTCCTACTCTGCGGTCATGGGCA TAGTGACTGAAGTTGAGCAGTATGTTAAGGTTTGGCTTCAGTACC AGTGTTTGTGGGATATGCAGGCAGAAAACATTTACAACAGGCTAG GGGAAGATCTCAACAAGTGGCAAGCTCTCCTGGTCCAGATAAGGA AAGCCAGAGGAACCTTTGACAATGCGGAAACCAAGAAAGAGTTTG GTCCGGTGGTGATAGATTACGGCAAGGTCCAGTCCAAGGTGAACT TGAAGTATGACTCCTGGCATAAGGAGGTTCTCAGCAAGTTTGGGC AGATGCTGGGCTCAAACATGACAGAATTCCACTCCCAGATCTCAA AGTCTCGCCAAGAGCTGGAGCAGCACTCCGTTGACACAGCCAGTA CCTCTGACGCGGTGACCTTCATCACCTATGTGCAGTCTCTGAAAC GGAAGATCAAACAGTTTGAGAAGCAAGTTGAACTCTACCGCAATG GTCAGCGTCTGCTGGAAAAACAAAGGTTCCAGTTCCCGCCTTCTT GGCTTTACATTGACAACATCGAGGGTGAGTGGGGGGCCTTCAATG ACATCATGCGGCGGAAGGACTCTGCCATTCAGCAACAGGTGGCAA ACCTGCAAATGAAGATCGTACAGGAGGACAGAGCTGTGGAAAGCC GGACCACGGATCTGTTGACAGACTGGGAGAAGACCAAACCTGTCA CAGGCAATCTGCGTCCTGAGGAGGCTCTTCAGGCCCTCACCATAT ATGAAGGGAAGTTCGGCCGGCTGAAGGACGACAGAGAGAAATGTG CAAAGGCTAAGGAAGCGTTGGAACTCACAGACACAGGCCTCCTCA GTGGCAGTGAAGAGCGTGTACAGGTGGCCTTGGAGGAGTTACAAG ACCTCAAAGGTGTGTGGTCAGAGCTTTCTAAGGTCTGGGAACAAA TTGATCAAATGAAGGAGCAGCCGTGGGTCTCCGTTCAGCCTCGGA AGCTTCGACAAAACCTAGACGGCCTCTTGAACCAGCTGAAGAACT TCCCTGCGAGGCTTCGGCAGTATGCTTCCTATGAGTTTGTTCAGA GGCTGCTGAAAGGCTACATGAAGATAAACATGTTGGTAATTGAAC TGAAATCAGAAGCACTCAAAGACCGGCACTGGAAACAGCTGATGA AGAGGCTTCATGTTAACTGGGTGGTTTCTGAGCTGACGCTGGGCC AGATCTGGGACGTGGACCTTCAGAAGAACGAAGCTGTCGTCAAGG ATGTGCTGCTGGTGGCACAAGGCGAGATGGCCTTGGAAGAATTTT TGAAGCAGATACGAGAAGTGTGGAACACATACGAACTAGACTTGG TCAACTA CAGAACAAATGCCGCC CATCCGAGGCTGGGATGACC TCTTCAACAAGGTCAAGGAGCATATCAACAGCGTCTCTGCCATGA AACTCTCTCCCTATTACAAGGTTTTTGAAGAAGATGCCCTGAGCT GGGAGGACAAGCTGAACCGAATCATGGCTCTCTTTGACGTGTGGA TTGACGTGCAGAGGCGCTGGGTCTACTTGGAAGGCATCTTCACAG GCAGTGCGGACATCAAACATCTGCTGCCTGTGGAAACCCAGCGCT TCCAGAGTATCAGCACGGAGTTTTTGGCTCTGATGAAAAAAGTCT CCAAGTCTCCACTTGTGATGGATGTTCTGAACATACAGGGAGTCC AGAGGTCTCTGGAAAGGTTGGCAGACCTGCTGGGGAAGATCCAGA AAGCATTGGGGGAGTACCTGGAACGGGAGCGCTCGTCTTTCCCCA GGTTCTACTTTGTGGGTGATGAGGATTTGCTTGAGATCATTGGGA ATAGCAAGAACGTGGCTAAGTTGCAGAAGCACTTCAAGAAAATGT TCGCCGGCGTTTCCAGCATCATCTTAAATGAGGATAACTCTGTGG TCCTCGGCATCTCATCCCGAGAAGGGGAGGAGGTTATGTTTAAAA CTCCAGTGTCCATCACTGAACACCCCAAAATCAATGAGTGGCTCA CTCTGGTGGAAAAGGAGATGAGAGTCACCTTGGCTAAACTTCTGG CAGAGTCTGTTACAGAAGTGGAGATTTTTGGAAAAGCAACTTCTA TTGACCCAAATACCTACATTACTTGGATTGATAAATACCAGGCCC AGCTAGTGGTATTGTCAGCCCAGATAGCCTGGTCCGAGAACGTGG AGAATGCGCTGAGCAACGTTGGGGGAGGTGGTGATGTGGGGCCCT TGCAGTCTGTGCTGAGCAATGTGGAGGTCACACTCAACGTCTTAG CGGACTCTGTCCTCATGGAGCAGCCTCCTCTCCGGAGACGGAAGC TGGAGCACTTGATCACAGAGCTGGTTCACCAAAGAGACGTTACCA GGTCCTTGATCAAAAGCAAGATCGACAACGCCAAATCTTTCGAAT GGCTCAGCCAGATGCGATTTTACTTTGACCCTAAGCAAACGGACG TGTTACAGCAGCTGTCCATTCAGATGGCCAATGCCAAGTTTAACT ACGGCTTTGAGTACCTGGGTGTTCAAGACAAGCTGGTTCAGACGC CCCTCACTGACCGTTGCTATTTGACAATGACACAAGCTTTGGAGG CCAGGCTTGGGGGCTCCCCATTTGGACCTGCTGGAACCGGAAAGA CGGAGTCCGTCAAAGCCCTCGGCCATCAGCTGGGGCGGTTCGTCT TAGTTTTCAACTGTGACGAAACCTTTGATTTCCAGGCGATGGGAC GTATCTTTGTGGGGCTTTGCCAAGTGGGCGCGTGGGGCTGCTTTG ATGAGTTTAACCGCCTGGAGGAGCGGATGCTCTCAGCTGTATCCC AGCAGGTGCAGTGCATACAAGAGGCACTGCGGGAGCATTCCAACC CCAACTACGACAAGACCTCAGCCCCCATTACTTGTGAGCTGCTGA ACAAACAAGTCAAGGTTAGCCCAGACATGGCTATCTTCATCACCA TGAACCCAGGCTATGCAGGTCGCTCAAACCTCCCCGACAACCTCA AGAAGCTCTTCCGGAGCTTGGCGATGACCAAGCCTGACCGGCAGC TGATCGCCCAGGTCATGCTGTACTCGCAGGGCTTCCGGACTGCTG AGGTCCTTGCCAACAAGATCGTCCCGTTCTTCAAACTGTGTGATG AGCAACTGTCTTCTCAAAGCCATTATGACTTTGGGCTTCGGGCTT TGAAGAGTGTGCTTGTAAGTGCAGGCAATGTGAAGAGGGAGAGGA TCCAGAAGATAAAGAGGGAGAAAGAAGAACGGGGGGAAGCAGTTG ATGAAGGAGAGATCGCTGAGAACCTACCTGAGCAGGAGATTCTGA TCCAGAGTGTCTGCGAGACAATGGTGCCCAAGCTGGTGGCAGAAG ATATCCCGCTGCTCTTCAGCCTCCTGTCTGACGTGTTCCCTGGAG TCCAGT.ACCACCGTGGGGAGATGACAGCCCTTCGAGAAGAGCTGA AGAAAGTGTGTCAGGAGATGTACTTGACATATGGCGACGGAGAAG AAGTTGGCGGGATGTGGGTTGAAAAGGTTCTCCAGCTCTATCAGA TCACGCAGATTAACCACGGCCTGATGATGGTTGGGCCTTCAGGAA GTGGGAAGAGCATGGCCTGGCGAGTGCTGCTGAAGGCTCTAGAGA GGCTTGAGGGTGTGGAGGGCGTGGCCCACATAATTGACCCCAAGG CCATCAGCAAAGACCACCTCTACGGAACCTTGGATCCCAACACCA GGGAGTGGACAGACGGACTCTTCACACACGTGCTGAGAAAGATCA TAGACAATGTGAGAGGTGAGCTGCAGAAACGCCAGTGGATTGTCT TTGATGGCGATGTGGACCCCGAGTGGGTGGAGAACCTGAACTCCG TGCTGGATGACAACAAGCTCCTGACGCTGCCTAATGGAGAGCGCC TTAGCCTGCCTCCCAATGTGCGGATAATGTTTGAAGTGCAGGACT TGAAATACGCGACGCTGGCCACGGTGTCTCGCTGTGGCA GG GT GGTTCAGTGAGGACG CCTGAGCACAGACA GATCTTAAATAACT TCCTGGCCAGGCTGCGCAGCATTCCCCTGGATGAAGGGGAGGACG AGGCACAGCGTAGGCGAAAAGGCAAAGAAGACGAGGGCGAAGAGG CGGCTTCTCCAATGCTACAGATTCAAAGAGATGCAGCAACGATCA TGCAGCCG AC TCACGTCCAACGGCCTGGTCACCAAGGCGCTGG AGCACGCCTTCAAGCTGGAGCACA CATGGACCTGACGCGCCTGC GCTGCCTGGGCTCGCTCTTCTCCATGCTGCACCAGGCCTGCCGCA ' ACGTGGCGCAGTACAATGCCAACCATCCTGATTTCCCCATGCAGA TTGAGCAGCTGGAGCGCTACATTCAGCGCTATCTGGTTTACGCCA TCCTCTGGTCCTTATCTGGAGACAGCCGGCTGAAGATGAGAGCAG AGCTGGGCGAGTACATCCGGAGGATCACCACTGTGCCGCTGCCCA CTGCGCCCAACGTCCCCATCATTGACTATGAGGTGTCCATCAGTG GAGAGTGGTCGCCGTGGCAGGCCAAGGTGCCTCAGATTGAAGTGG AGACACACAAGGTGGCAGCCCCAGATGTCGTCGTGCCAACCTTAG A ACAGTCCGCCATGAAGCTCTCCTGTACACTTGGCTGGCTGAAC ACAAACCCCTGGTCTTATGTGGCCCTCCTGGGTCTGGCAAGACCA TGACACTCTTCAGTGCTCTCCGGGCCTTGCCTGACATGGAGGTTG TGGGCCTAAACTTCTCAAGTGCCACTACACCAGAGCTGTTGCTGA AGACGTTTGACCACTACTGCGAATACAGGCGCACACCTAACGGTG TTGTCTTGGCTCCTGTTCAGCTTGGAAAGTGGCTGGTC TGTTCT GTGATGAAATCAACTTGCCCGATATGGATAAATACGGCACACAGA GAGTCATCTCCTTCATCAGACAGATGGTGGAGCATGGAGCCTTCT ATCGTACCTCAGACCAAACGTGGGTAAAGCTAGAGAGAATCCAGT TTGTTGGGGCTTGCAATCCACCCACTGACCCTGGGAGAAAGCCCC TCTCACACAGGTTCTTGCGCCACGTGCCTGTTGTATATGTGGATT ACCCAGGACCAGCCTCCCTGACGCAAATCTATGGCACCTTCAACC GCGCCATGCTGAGGCTCATTCCCTCTCTCCGTACCTATGCAGAAC CCCTCACTGCCGCCATGGTGGAGTTCTATACCATGTCACAGGAGC GGTTTACTCAGGACACACAGCCACACTATATCTACTCGCCCCGTG AGATGACTCGGTGGGTAAGAGGAATCTTTGAAGCACTGAGACCCC TGGAGACATTGCCTGTTGAAGGTCTCATTCGTATTTGGGCACATG AAGCCCTCCGTCTCTTCCAAGACAGGCTTGTGGAGGATGAGGAGC GGCGCTGGACTGACGAAAACATTGACATGGTTGCCTTGAAGCACT TCCCTAACATAGACAAAGAGAAAGCCATGAGCCGGCCTATCCTGT ACAGCAACTGGCTGTCAAAGGATTATATCCCAGTTGACCAAGAAG AGCTAAGGGATTATGTCAAGGCTAGGCTGAAGGTCTTCTATGAAG AAGAACTTGATGTTCCCTTGGTCTTGTTCAATGAAGTTCTGGACC ATGTGCTGAGGATAGACAGAATATTCCGACAACCTCAAGGCCATC TGCTTCTGATTGGTGTTAGTGGAGCTGGAAAAACCACCCTGTCTC GCTTTGTCGCCTGGATGAATGGCTTGAGTGTATACCAGATTAAGG TCCACAGGAAGTACACTGGGGAAGACTTCGATGAAGATCTTAGGA CAGTGCTGAGACGGTCTGGCTGTAAAAATGAAAAGATAGCATTCA TAATGGATGAGTCCAACGTCTTAGATTCCGGATTCCTGGAACGAA TGAATACCCTTCTGGCTAATGGCGAGGTTCCTGGGCTCTTTGAAG GGGATGAGTACGCCACGCTGATGACACAGTGCAAAGAGGGGGCCC AGAAGGAGGGGCTCATGCTGGACTCCCACGAGGAGCTCTACAAGT GGTTCACCAGCCAGGTGATCCGCAACCTGCACGTGGTCTTCACCA TGAACCCGTCCTCAGAGGGGCTCAAGGACAGGGCGGCCACCTCAC CAGCCCTTTTCAACAGGTGTGTGCTGAACTGGTTTGGTGAC GGT CCACTGAAGCACTGTATCAAGTCGGCAAAGAATTCACCAGTAAGA TGGACCTGGAGAAGCCGAACTATATAGTGCCTGACTACATGCCAG TTGTGTATGATAAACTGCCGCAGCCCCCAACACACCGGGAAGCCA TTGTGAACAGCTGTGTGTTTGTCCATCAGACTCTTCACCAGGCTA ATGCGCGCCTGGCGAAGCGAGGTGGCAGAACGATGGCCATCACAC CTCGGCACTACCTGGACTTCATCAACCACTACGCCAACCTCTTCC ATGAGAAGCGCAGCGAGTTGGAGGAGCAGCAGATGCACCTGAATG TTGGGCTCCGAAAAATCAAAGAGACCGTGGACCAGGTGGAAGAAC TGCGCCGTGACCTGAGGATCAAGAGCCAAGAGCTGGAGGTCAAGA ACGCAGCGGCCAATGACAAGCTGAAGAAAATGGTGAAAGACCAGC AAGAGGCTGAGAAGAAGAAGGTCATGAGCCAAGAAATCCAGGAGC AGCTACACAAACAGCAGGAAGTGATCGCAGACAAGCAGATGAGTG TCAAGGAGGACCTGGATAAAGTGGAGCCTGCTGTCATCGAGGCCC AGAACGCTGTGAAGTCCATCAAGAAGCAGCACCTGGTGGAGGTGA GGTCCATGGCCAACCCTCCTGCAGCTGTGAAGCTGGCTCTGGAGT CCATCTGCCTGCTGCTTGGTGAGAGCACCACGGACTGGAAGCAGA TCCGCTCCATCATCATGAGAGAGAACTTCATCCCCACCATCGTCA ACTTCTCGGCTGAGGAGATCAGTGATGCCATACGAGAGAAGATGA AGAAAAACTACATGTCCAACCCCAGTTACAACTATGAGATCGTCA ACCGGGCTTCCCTGGCTTGTGGTCCTATGGTGAAGTGGGCGATTG CACAGCTCAATTATGCAGACATGTTAAAGCGAGTGGAGCCCCTGA GGAATGAGCTGCAGAAGCTGGAAGATGACGCCAAGGACAACCAGC AGAAAGCCAATGAGGTGGAGCAGATGATCAGGGACCTGGAAGCCA GCATTGCCCGCTACAAGGAGGAGTACGCTGTCCTCATCTCTGAGG CCCAGGCCATCAAGGCAGACCTGGCAGCTGTGGAAGCAAAGGTAA ACCGGAGCACTGCACTTCTAAAGAGTTTATCTGCCGAAAGGGAAC GTTGGGAAAAGACGAGTGAAACTTTCAAAAACCAGATGTCTACCA TTGCTGGGGACTGCCTCCTGTCGGCGGCCTTCATTGCTTACGCTG GCTACTTTGACCAGCAAATGCGCCAGAACTTGTTCACCACCTGGT CTCATCAGTTACAGCAAGCCAACATCCAGTTCCGCACAGACATTG CAAGGACGGAGTACCTCTCCAATGCTGACGAACGCCTCCGCTGGC AGGCCAGCTCTCTGCCTGCCGACGACCTGTGCACAGAGAATGCCA TCATGCTAAAACGATTCAATAGGTACCCGCTGATCATCGACCCCT CCGGACAGGCCACAGAATTCATCATGAATGAATATAAGGACCGGA AGATCACAAGGACCAGCTTCTTAGATGATGCCTTCCGGAAGAATT TGGAGAGTGCTCTGAGATTTGGCAATCCCCTTCTTGTCCAGGATG TGGAAAGCTACGATCCAGTTTTGAATCCAGTACTGAACCGTGAAG TTCGGCGAACAGGAGGGAGGGTGCTGATTACCCTCGGTGACCAAG ACATAGACCTGTCACCATCCTTTGTCATCTTTCTGTCTACCCGAG ACCCAACTGTGGAGTTCCCACCAGACCTCTGCTCCCGGGTGACCT TTGTGAACTTCACCGTCACCCGCAGCAGTTTACAGAGCCAGTGTC TCAATGAAGTGCTTAAAGCAGAAAGGCCAGACGTGGACGAGAAGC GCTCCGACCTCCTGAAACTGCAAGGGGAGTTCCAACTCCGTTTAC GGCAGCTTGAAAAGTCTCTGCTCCAAGCTCTGAATGAGGTAAAAG GCCGCATTCTGGTTGACGACACCATCATTACAACCCTGGAGAATC TGAAGCGGGAAGCTGCCGAGGTTACCAGAAAGGTGGAGGAGACAG ATATTGTCATGCAGGAGGTGGAGACCGTGTCCCAGCAGTACCTGC CGCTGTCCACTGCCTGCAGCAGCATCTACTTCACTATGGAGTCCT TGAAGCAGGTTCACTTCCTGTACCAGTACTCTCTGCAGTTCTTCC TGGACATCTACCACAACGTGCTGTATGAGAACCCCAACCTGAAGG GTGCCACCGATCACACACAGCGCCTCTCCGTCATAACCAAGGACC TCTTCCAGGTGGCCTTTAACCGAGTGGCTCGAGGCATGCTGCACC AGGACCACATCACCTTCGCCATGCTGCTAGCGAGGATCAAGCTGA AAGGCACCGTGGGGGAGCCCACCTATGATGCAGAGTTCCAGCACT TCCTCAGAGGGAAGGAGATTGTGCTGAGTGCTGGCTCCACCCCCA AAATCCAGGGCCTGACCGTAGAGCAGGCAGAAGCTGTCGTGAGGT TGAGCTGTCTGCCTGCATTTAAAGATCTGATTGCCAAGGTGCAGG CAGATGAGCAGTTTGGCATTTGGCTGGATAGCAGTTCACCAGAGC AGACCGTGCCATACCTCTGGAGCGAGGAAACGCCTACAACTCCCA TTGGGCAGGCCATCCACCGCCTGCTCCTGATTCAAGCCTTCCGAC CCGACCGCCTGTTGGCCATGGCCCACATGTTTGTTTCCACAAACC TCGGAGAGTCCTTCATGTCCATCATGGAGCAGCCTCTCGACCTCA CCCACATTGTGGGCACAGAGGTGAAGCCAAACACACCTGTCCTGA TGTGCTCTGTGCCTGGGTATGATGCCAGCGGACATGTTGAGGACC TCGCAGCAGAGCAGAACACGCAGATCACGTCTAT GCCATCGGCT CAGCAGAAGGCTTTAACCAAGCAGATAAGGCCATCAACACCGCCG TGAAGTCAGGCAGGTGGGTGATGTTGAAGAACGTGCACCTGGCCC CGGGCTGGCTGATGCAGCTGGAGAAGAAGCTGCACTCCCTGCAGC CCCACGCCTGCTTCCGACTTTTCCTCACCATGGAGATCAACCCCA AGGTGCCCGTGAACCTGCTCCGTGCTGGTCGGATCTTTGTGTTTG AGCCACCACCCGGAGTGAAAGCCAACATGCTGAGGACATTTAGCA GCATCCCTGTCTCTAGGATATGCAAGTCTCCAAATGAGCGCGCCC GCTTGTATTTCCTGCTGGCTTGGTTCCATGCCATCATCCAAGAGC GCCTGCGCTATGCTCCACTGGGGTGGTCAAAGAAGTACGAATTTG GAGAATCTGACCTTCGATCAGCTTGTGACACGGTGGACACGTGGC TGGACGACACAGCCAAGGGCCGGCAGAACATCTCACCGGATAAGA TCCCATGGTCTGCCCTGAAGACCCTGATGGCGCAGTCCATCTATG GTGGGCGGGTGGACAATGAGTTCGACCAGCGTCTGCTCAACACCT TCCTGGAGCGGCTGTTCACCACCCGCAGCTTCGACAGTGAATTCA AGCTGGCGTGCAAGGTTGACGGGCACAAGGACATCCAGATGCCTG ATGGTATCAGGCGAGAGGAGTTTGTGCAGTGGGTGGAGCTGCTGC CTGACGCCCAGACACCCTCATGGCTGGGCCTCCCCAACAATGCTG AAAGGGTCCTGCTTACCACCCAAGGCGTGGACATGATCAGCAAGA TGCTGAAGATGCAGATGCTGGAGGACGAGGATGACCTGGCCTACG CAGAGACGGAGAAGAAGGCAAGGACGGACTCCACCTCCGATGGCC GTCCAGCCTGGATGAGGACACTGCACACCACGGCGTCCAACTGGC TGCACCTCATCCCACAGACACTGAGCCCCCTGAAGCGCACCGTGG AGAACATCAAGGATCCTTTGTTTAGGTTCTTTGAGAGAGAAGTAA AGATGGGGGCCAAGTTACTCCAAGATGTGCGCCAAGACCTTGCTG ACGTCGTTCAAGTGTGCGAGGGGAAAAAGAAGCAGACAAACTACC TGCGCACGCTCATCAATGAGCTGGTGAAAGGGATCTTGCCTCGGA GCTGGTCCCATTACACAGTGCCTGCAGGCATGACGGTGATCCAGT GGGTGTCAGATTTCAGCGAGAGGATCAAACAGCTGCAGAACATCT CACAAGCAGCTGCATCTGGTGGTGCCAAGGAACTGAAGAACATCC ACGTGTGCCTGGGTGGCCTGTTTGTACCTGAGGCCTACATCACTG CCACCAGACAGTATGTGGCACAAGCTAACAGCTGGTCCCTGGAGG AACTCTGCCTGGAAGTCAAT.GTCACCGCCTCACAGAGTGCCACCC TTGATGCCTGCAGCTTTGGAGTCACAGGTCTGAAGCTCCAAGGGG CCACGTGCAGCAACAACAAGCTATCACTCTCCAATGCCATCTCCA CAGTCCTCCCCCTCACACAGCTGCGCTGGGTGAAACAAACAAGCG CCGAGAAGAAGGCCAGCGTGGTGACCTTACCTGTCTACCTGAACT TCACCCGGGCAGACCTCATCTTCACCGTGGACTTTGAAATTGCTA CAAAGGAAGATCCTCGCAGCTTCTATGAGCGTGGAGTTGCCGTTC TGTGCACTGAGTAAAGCTAGACTTTTCTCCAGTCCTCTTTCTGGA ATAGGAAACTCCCAATATTTAACCTTCA TCATCCTTAACGGTGT GGAAGGGTTGATGGACTGGAAAGCAAGTGGTTGGTTCGCGTTGGC GGGTGACAGGTGCTGCGGTTGGAGACGGTGGGATGGGAGAAGAGA AGAGTGCGCTGTCCGAGGGCTGACCGAATGGCTGGGTTTAG AAA TAAAACACTAAGCATGACGGGCAAAAAAAAAAAAAAAAAAA
Table 2. Mutated murine cytoplasmic dynein heavy chainl , mRNA (SEQ ID
NO:3)
GCCGCGTCGACAGCCGGCTCCGCTGTCCGCAGTCGGCCGCGGGTTAGCGGGC AGAGCGTCTCCTGTCGCCGGTTCCCCTCGCTTACTGCTCTCTCGTGCCGGAG GCCGCTCCTCTCGGCTCTCGCTCTCTCTCTTTCTATCTCTCTCCCTTCCGCG GATCCGCCATGTCGGAGCCGGGCGGCGGCGAGGACGGCTCGGCAGGCCTGGA GGTGTCGGCGGTGCAGAATGTGGCGGACGTGGCGGTGCTGCAGAAGCACCTG CGTAAGCTGGTGCCGCTGCTGCTGGAGGACGGCGGCGACGCGCCGGCTGCGC TGGAGGCGGCGCTGGAGGAGAAGAGCGCCCTGGAGCAGATGCGCAAGTTCCT GTCAGACCCGCAGGTCCACACGGTCCTGGTGGAGCGCTCCACCCTCAAAGAG GACGTTGGTGATGAAGGAGAAGAGGAGAAAGAATTCATTTCCTATAACATCA ACATAGACATTCATTACGGGGTAAAGTCCAACAGCTTGGCGTTCATCAAGCG AGCTCCTGTGATTGATGCAGACAAGCCAGTGTCGTCCCAGCTCCGAGTCCTC ACTCTGAGTGAAGACTCGCCGTATGAGACACTGCACTCTTTCATCAGCAATG CAGTGGCTCCTTTCTTTAAGTCCTACATCAGAGAGTCTGGCAAAGCAGACAG GGATGGTGATAAGATGGCTCCTTCAGTTGAAAAAAAGATTGCAGAGCTTGAA ATGGGACTCCTCCACCTGCAGCAGAACATTGAGATCCCAGAGATCAGCTTGC CAATTCATCCCATCATCACGAACGTTGCGAAGCAGTGCTATGAGCGCGGAGA AAAGCCCAAAGTTACAGATTTTGGTGATAAGGTTGAAGACCCAACTTTCCTT AACCAATTACAGTCTGGAGTTAATCGGTGGATCCGAGAAATTCAAAAGGTGA CCAAGCTTGACCGGGATCCAGCATCAGGAACTGCCTTGCAGGAAATCAGCTT TTGGCTAAACTTGGAACGTGCGTTGTACCGCATCCAAGAGAAGCGGGAGAGC CCCGAGGTGCTCCTGACTCTGGACATCCTGAAGCATGGCAAACGTTTCCATG CCACTGTCAGTTTTGACACTGACACAGGTCTGAAGCAGGCGTTGGAAACGGT GAATGACTACAACCCTCTGATGAAAGACTTCCCTCTGAATGACTTGCTGTCT GCCACGGAGCTGGACAAGATAAGGCAGGCCCTTGTTGCAATTTTCACACATC TGAGAAAGATCCGCAACACGAAGTACCCGATTCAGCGGGCCCTGCGTCTCGT GGAGGCCATCTCCAGAGACCTGAGTTCTCAGCTGCTCAAGGTCTTGGGCACT CGGAAGTTGATGCATGTAGCCTATGAAGAGTTTGAAAAGGTCATGGTGGCTT GCTTCGAAGTCTTCCAGACGTGGGACGACGAGTACGAGAAGCTCCAGGTGCT GCTGCGAGACATCGTCAAGAGGAAGCGGGAGGAGAACCTGAAGATGGTGTGG CGCATCAACCCCGCTCACAGGAAGCTTCAGGCCCGCCTCGACCAGATGAGGA AGTTCCGCCGCCAGCACGAGCAGCTGAGGGCTGTCATTGTCAGGGTCCTGAG GCCACAGGTCACAGCAGTCGCACAACAGAACCAAGGAGAAGCACCTGAACCC CAAGACATGAAAGTGGCCGAGGTGCTCTTTGATGCTGCCGACGCCAACACCA TTGAGGAGGTGAACCTGGCCTACGAGAATGTCAAGGAAGTCGATGGTCTGGA TGTTTCCAAAGAAGGGACGGAGGCCTGGGAGGCCGCGATGAAGAGATACGAT GAGAGGATCGACCGTGTGGAGACCCGCATCACCGCCCGCCTCCGAGATCAGC CGGCACGGCCAAGAATGCCAATGAGATGTTCAGGATTTTCTCCAGGTTCAA TGCACTGTTCGTCCGCCCACACATCCGAGGGGCCATTCGTGAATACCAGACC CAGCTGATCCAACGTGTGAAAGATGACATCGAATCTCTGCACGACAAGTTCA AGGTCCAGTACCCGCAAAGCCAAGCTTGTAAAATGAGTCATGTCCGTGACCT GCCCCCCGTGTCAGGGTCTATCATCTGGGCTAAACAGATCGACAGACAGCTC ACTGCCTACATGAAGCGAGTGGAGGATGTCCTGGGCAAAGGCTGGGAGAACC ACGTGGAAGGGCAGAAGCTGAAGCAGGATGGAGACAGCTTCCGAATGAAGCT CAACACCCAGGAGATCTTCGATGACTGGGCGAGGAAGGTTCAGCAGCGCAAC CTTGGTGTCTCCGGGCGCATCTTCACCATTGAGAGCGCTCGCGTGCGGGGCC GCACTGGGAATGTCCTCAAGCTAAAGGTGAACTTCCTTCCAGAGATCATAAC ACTCTCCAAAGAAGTCCGGAACCTCAAGTGGCTTGGCTTCCGAGTGCCACTT GCAATTGTGAACAAGGCTCACCAAGCCAACCAGCTCTACCCATTTGCCATCT CGCTGATTGAAAGCGTCCGGACTTACGAGCGCACCTGTGAGAAGGTGGAGGA GCGCAATACCATTTCCCTGCTAGTGGCCGGCCTAAAGAAGGAGGTGCAGGCC TTAATCGCAGAAGGCATCGCGTTGGTGTGGGAGTCCTACAAGCTCGACCCCT ACGTGCAGCGCCTGGCAGAGACGGTTTTCAACTTCCAGGAGAAGGTGGACGA CCTACTGATTATTGAGGAAAAGATAGACCTGGAGGTCCGCTCCTTGGAAACC TGCATGTATGACCACAAGACATTCTCAGAGATCTTGAACAGAGTGCAGAAAG CAGTGGACGACCTAAACCTGCACTCCTATTCCAATCTGCCCATCTGGGTCAA CAAGCTGGACATGGAGATTGAAAGGATACTGGGCGTCCGCCTGCAAGCTGGC CTTCGAGCTTGGACCCAGGTTCTTCTTGGACAAGCTGAGGATAAAGCAGAAG TCGACATGGATACAGATGCTCCACAAGTCAGTCACAAGCCTGGTGGAGAGCC CAAGATCAAAAACGTGGTTCACGAGCTGAGGATAACAAATCAGGTCATCTAT CTGAACCCACCCATTGAGGAGTGCAGGTACAAGCTGTACCAGGAGATGTTCG CGTGGAAGATGGTTGTGCTGTCCCTGCCCAGGATCCAGAGCCAGAGGTACCA
GGTGGGAGTGCATTACGAGTTGACGGAGGAAGAGAAGTTCTATCGGAATGCA
CTGACAAGGATGCCCGACGGCCCTGTCGCCCTGGAAGAGTCCTACTCTGCGG
TCATGGGCATAGTGACTGAAGTTGAGCAGTATGTTAAGGTTTGGCTTCAGΕQi
■ CCAGTGTTTGTGGGATATGCAGGCAGAAAACATTTACAACAGGCTAGGGGAA GATCTCAACAAGTGGCAAGCTCTCCTGGTCCAGATAAGGAAAGCCAGAGGAA CCTTTGACAATGCGGAAACCAAGAAAGAGTTTGGTCCGGTGGTGATAGATTA CGGCAAGGTCCAGTCCAAGGTGAACTTGAAGTATGACTCCTGGCATAAGGAG GTTCTCAGCAAGTTTGGGCAGATGCTGGGCTCAAACATGACAGAATTCCACT CCCAGATCTCAAAGTCTCGCCAAGAGCTGGAGCAGCACTCCGTTGACACAGC CAGTACCTCTGACGCGGTGACCTTCATCACCTATGTGCAGTCTCTGAAACGG AAGATCAAACAGTTTGAGAAGCAAGTTGAACTCTACCGCAATGGTCAGCGTC TGCTGGAAAAACAAAGGTTCCAGTTCCCGCCTTCTTGGCTTTACATTGACAA CATCGAGGGTGAGTGGGGGGCCTTCAATGACATCATGCGGCGGAAGGACTCT GCCATTCAGCAACAGGTGGCAAACCTGCAAATGAAGATCGTACAGGAGGACA GAGCTGTGGAAAGCCGGACCACGGATCTGTTGACAGACTGGGAGAAGACCAA ACCTGTCACAGGCAATCTGCGTCCTGAGGAGGCTCTTCAGGCCCTCACCATA TATGAAGGGAAGTTCGGCCGGCTGAAGGACGACAGAGAGAAATGTGCAAAGG CTAAGGAAGCGTTGGAACTCACAGACACAGGCCTCCTCAGTGGCAGTGAAGA GCGTGTACAGGTGGCCTTGGAGGAGTTACAAGACCTCAAAGGTGTGTGGTCA GAGCTTTCTAAGGTCTGGGAACAAATTGATCAAATGAAGGAGCAGCCGTGGG TCTCCGTTCAGCCTCGGAAGCTTCGACAAAACCTAGACGGCCTCTTGAACCA GCTGAAGAACTTCCCTGCGAGGCTTCGGCAGTATGCTTCCTATGAGTTTGTT CAGAGGCTGCTGAAAGGCTACATGAAGATAAACATGTTGGTAATTGAACTGA AATCAGAAGCACTCAAAGACCGGCACTGGAAACAGCTGATGAAGAGGCTTCA TGTTAACTGGGTGGTTTCTGAGCTGACGCTGGGCCAGATCTGGGACGTGGAC CTTCAGAAGAACGAAGCTGTCGTCAAGGATGTGCTGCTGGTGGCACAAGGCG AGATGGCCTTGGAAGAATTTTTGAAGCAGATACGAGAAGTGTGGAACACATA CGAACTAGACTTGGTCAACTATCAGAACAAATGCCGCCTCATCCGAGGCTGG GATGACCTCTTCAACAAGGTCAAGGAGCATATCAACAGCGTCTCTGCCATGA AACTCTCTCCCTATTACAAGGTTTTTGAAGAAGATGCCCTGAGCTGGGAGGA CAAGCTGAACCGAATCATGGCTCTCTTTGACGTGTGGATTGACGTGCAGAGG CGCTGGGTCTACTTGGAAGGCATCTTCACAGGCAGTGCGGACATCAAACATC TGCTGCCTGTGGAAACCCAGCGCTTCCAGAGTATCAGCACGGAGTTTTTGGC TCTGATGAAAAAAGTCTCCAAGTCTCCACTTGTGATGGATGTTCTGAACATA CAGGGAGTCCAGAGGTCTCTGGAAAGGTTGGCAGACCTGCTGGGGAAGATCC AGAAAGCATTGGGGGAGTACCTGGAACGGGAGCGCTCGTCTTTCCCCAGGTT CTACTTTGTGGGTGATGAGGATTTGCTTGAGATCATTGGGAATAGCAAGAAC GTGGCTAAGTTGCAGAAGCACTTCAAGAAAATGTTCGCCGGCGTTTCCAGCA TCATCTTAAATGAGGATAACTCTGTGGTCCTCGGCATCTCATCCCGAGAAGG GGAGGAGGTTATGTTTAAAACTCCAGTGTCCATCACTGAACACCCCAAAATC AATGAGTGGCTCACTCTGGTGGAAAAGGAGATGAGAGTCACCTTGGCTAAAC TTCTGGCAGAGTCTGTTACAGAAGTGGAGATTTTTGGAAAAGCAACTTCTAT TGACCCAAATACCTACATTACTTGGATTGATAAATACCAGGCCCAGCTAGTG GTATTGTCAGCCCAGATAGCCTGGTCCGAGAACGTGGAGAATGCGCTGAGCA ACGTTGGGGGAGGTGGTGATGTGGGGCCCTTGCAGTCTGTGCTGAGCAATGT GGAGGTCACACTCAACGTCTTAGCGGACTCTGTCCTCATGGAGCAGCCTCCT CTCCGGAGACGGAAGCTGGAGCACTTGATCACAGAGCTGGTTCACCAAAGAG ACGTTACCAGGTCCTTGATCAAAAGGAAGATCGACAACGCCAAATCTTTCGA ATGGCTCAGCCAGATGCGATTTTACTTTGACCCTAAGCAAACGGACGTGTTA CAGCAGCTGTCCATTCAGATGGCCAATGCCAAGTTTAACTACGGCTTTGAGT ACCTGGGTGTTCAAGACAAGCTGGTTCAGACGCCCCTCACTGACCGTTGCTA TTTGACAATGACACAAGCTTTGGAGGCCAGGCTTGGGGGCTCCCCATTTGGA CCTGCTGGAACCGGAAAGACGGAGTCCGTCAAAGCCCTCGGCCATCAGCTGG GGCGGTTCGTCTTAGTTTTCAACTGTGACGAAACCTTTGATTTCCAGGCGAT GGGACGTATCTTTGTGGGGCTTTGCCAAGTGGGCGCGTGGGGCTGCTTTGAT GAGTTTAACCGCCTGGAGGAGCGGATGCTCTCAGCTGTATCCCAGCAGGTGC AGTGCATACAAGAGGCACTGCGGGAGCATTCCAACCCCAACTACGACAAGAC CTCAGCCCCCATTACTTGTGAGCTGCTGAACAAACAAGTCAAGGTTAGCCCA GACATGGCTATCTTCATCACCATGAACCCAGGCTATGCAGGTCGCTCAAACC ' TCCCCGACAACCTCAAGAAGCTCTTCCGGAGCTTGGCGATGACCAAGCCTGA CCGGCAGCTGATCGCCCAGGTCATGCTGTACTCGCAGGGCTTCCGGACTGCT GAGGTCCTTGCCAACAAGATCGTCCCGTTCTTCAAACTGTGTGATGAGCAAC TGTCTTCTEAAAGCCATTATGACTTTGGGCTTCGGGCTTTGAAGAGTGTGCT TGTAAGTGCAGGCAATGTGAAGAGGGAGAGGATCCAGAAGATAAAGAGGGAG AAAGAAGAACGGGGGGAAGCAGTTGATGAAGGAGAGATCGCTGAGAACCTAC CTGAGCAGGAGATTCTGATCCAGAGTGTCTGCGAGACAATGGTGCCCAAGCT GGTGGCAGAAGATATCCCGCTGCTCTTCAGCCTCCTGTCTGACGTGTTCCCT GGAGTCCAGTACCACCGTGGGGAGATGACAGCCCTTCGAGAAGAGCTGAAGA AAGTGTGTCAGGAGATGTACTTGACATATGGCGACGGAGAAGAAGTTGGCGG GATGTGGGTTGAAAAGGTTCTCCAGCTCTATCAGATCACGCAGATTAACCAC GGCCTGATGATGGTTGGGCCTTCAGGAAGTGGGAAGAGCATGGCCTGGCGAG TGCTGCTGAAGGCTCTAGAGAGGCTTGAGGGTGTGGAGGGCGTGGCCCACAT AATTGACCCCAAGGCCATCAGCAAAGACCACCTCTACGGAACCTTGGATCCC AACACCAGGGAGTGGACAGACGGACTCTTCACACACGTGCTGAGAAAGATCA TAGACAATGTGAGAGGTGAGCTGCAGAAACGCCAGTGGATTGTCTTTGATGG CGATGTGGACCCCGAGTGGGTGGAGAACCTGAACTCCGTGCTGGATGACAAC AAGCTCCTGACGCTGCCTAATGGAGAGCGCCTTAGCCTGCCTCCCAATGTGC GGATAATGTTTGAAGTGCAGGACTTGAAATACGCGACGCTGGCCACGGTGTC TCGCTGTGGCATGGTGTGGTTCAGTGAGGACGTCCTGAGCACAGACATGATC TTAAATAACTTCCTGGCCAGGCTGCGCAGCATTCCCCTGGATGAAGGGGAGG ACGAGGCACAGCGTAGGCGAΆΆAGGCAAAGAAGACGAGGGCGAAGAGGCGGC TTCTCCAATGCTACAGATTCAAAGAGATGCAGCAACGATCATGCAGCCGTAC TTCACGTCCAACGGCCTGGTCACCAAGGCGCTGGAGCACGCCTTCAAGCTGG AGCACATCATGGACCTGACGCGCCTGCGCTGCCTGGGCTCGCTCTTCTCCAT GCTGCACCAGGCCTGCCGCAACGTGGCGCAGTACAATGCCAACCATCCTGAT TTCCCCATGCAGATTGAGCAGCTGGAGCGCTACATTCAGCGCTATCTGGTTT ACGCCATCCTCTGGTCCTTATCTGGAGACAGCCGGCTGAAGATGAGAGCAGA GCTGGGCGAGTACATCCGGAGGATCACCACTGTGCCGCTGCCCACTGCGCCC AACGTCCCCATCATTGACTATGAGGTGTCCATCAGTGGAGAGTGGTCGCCGT GGCAGGCCAAGGTGCCTCAGATTGAAGTGGAGACACACAAGGTGGCAGCCCC AGATGTCGTCGTGCCAACCTTAGATACAGTCCGCCATGAAGCTCTCCTGTAC ACTTGGCTGGCTGAACACAAACCCCTGGTCTTATGTGGCCCTCCTGGGTCTG GCAΆGACCATGΆCACTCTTCAGTGCTCTCCGGGCCTTGCCTGACATGGAGGT GTGGGCCTAAACTTCTCAAGTGCCACTΆCACCAGAGCTGTTGCTGAAGACG TTTGACCACTACTGCGAATACAGGCGCACACCTAACGGTGTTGTCTTGGCTC CTGTTCAGCTTGGAAAGTGGCTGGTCTTGTTCTGTGATGAAATCAACTTGCC CGATATGGATAAATACGGCACACAGAGAGTCATCTCCTTCATCAGACAGATG GTGGAGCATGGAGCCTTCTATCGTACCTCAGACCAAACGTGGGTAAΆGCTAG AGAGAATCCAGTTTGTTGGGGCTTGCAATCCACCCACTGACCCTGGGAGAAA GCCCCTCTCACACAGGTTCTTGCGCCACGTGCCTGTTGTATATGTGGATTAC CCAGGACCAGCCTCCCTGACGCAΆΆTCTATGGCACCTTCAACCGCGCCATGC TGAGGCTCATTCCCTCTCTCCGTACCTATGCAGAACCCCTCACTGCCGCCAT GGTGGAGTTCTATACCATGTCACAGGAGCGGTTTACTCAGGACACACAGCCA CACTATATCTACTCGCCCCGTGAGATGACTCGGTGGGTAAGAGGAATCTTTG AAGCACTGAGACCCCTGGAGACATTGCCTGTTGAAGGTCTCATTCGTATTTG GGCACATGAAGCCCTCCGTCTCTTCCAAGACAGGCTTGTGGAGGATGAGGAG CGGCGCTGGACTGACGAAAACATTGACATGGTTGCCTTGAAGCACTTCCCTA ACATAGACAAAGAGAAAGCCATGAGCCGGCCTATCCTGTACAGCAACTGGCT GTCAAAGGATTATATCCCAGTTGACCAAGAAGAGCTAAGGGATTATGTCAAG GCTAGGCTGAAGGTCTTCTATGAAGAAGAACTTGATGTTCCCTTGGTCTTGT TCAATGAAGTTCTGGACCATGTGCTGAGGATAGACAGAATATTCCGACAACC TCAAGGCCATCTGCTTCTGATTGGTGTTAGTGGAGCTGGAAAAACCACCCTG TCTCGCTTTGTCGCCTGGATGAATGGCTTGAGTGTATACCAGATTAAGGTCC ACAGGAAGTACACTGGGGAAGACTTCGATGAAGATCTTAGGACAGTGCTGAG ACGGTCTGGCTGTAΆAAATGAAAAGATAGCATTCATAΆTGGATGAGTCCAAC GTCTTAGATTCCGGATTCCTGGAACGAATGAATACCCTTCTGGCTAATGGCG AGGTTCCTGGGCTCTTTGAAGGGGATGAGTACGCCACGCTGATGACACAGTG CAAAGAGGGGGCCCAGAAGGAGGGGCTCATGCTGGACTCCCACGAGGAGCTC TACAAGTGGTTCACCAGCCAGGTGATCCGCAACCTGCACGTGGTCTTCACCA TGAACCCGTCCTCAGAGGGGCTCAAGGACAGGGCGGCCACCTCACCAGCCCT TTTCAACAGGTGTGTGCTGAACTGGTTTGGTGACTGGTCCACTGAAGCACTG TATCAAGTCGGCAAAGAATTCACCAGTAAGATGGACCTGGAGAAGCCGAACT ATATAGTGCCTGACTACATGCCAGTTGTGTATGATAAACTGCCGCAGCCCCC AACACACCGGGAAGCCATTGTGAACAGCTGTGTGTTTGTCCATCAGACTCTT CACCAGGCTAATGCGCGCCTGGCGAAGCGAGGTGGCAGAACGATGGCCATCA CACCTCGGCACTACCTGGACTTCATCAACCACTACGCCAACCTCTTCCATGA GAAGCGCAGCGAGTTGGAGGAGCAGCAGATGCACCTGAATGTTGGGCTCCGA AAAATCAAAGAGACCGTGGACCAGGTGGAAGAACTGCGCCGTGACCTGAGGA TCAAGAGCCAAGAGCTGGAGGTCAAGAACGCAGCGGCCAATGACAAGCTGAA GAAAATGGTGAAAGACCAGCAAGAGGCTGAGAAGAAGAAGGTCATGAGCCAA GAAATCCAGGAGCAGCTACACAAACAGCAGGAAGTGATCGCAGACAAGCAGA TGAGTGTCAAGGAGGACCTGGATAAAGTGGAGCCTGCTGTCATCGAGGCCCA GAACGCTGTGAAGTCCATCAAGAAGCAGCACCTGGTGGAGGTGAGGTCCATG GCCAACCCTCCTGCAGCTGTGAAGCTGGCTCTGGAGTCCATCTGCCTGCTGC TTGGTGAGAGCACCACGGACTGGAAGCAGATCCGCTCCATCATCATGAGAGA GAACTTCATCCCCACCATCGTCAACTTCTCGGCTGAGGAGATCAGTGATGCC ATACGAGAGAAGATGAAGAAAAACTACATGTCCAACCCCAGTTACAACTATG AGATCGTCAACCGGGCTTCCCTGGCTTGTGGTCCTATGGTGAAGTGGGCGAT TGCACAGCTCAATTATGCAGACATGTTAAAGCGAGTGGAGCCCCTGAGGAAT GAGCTGCAGAAGCTGGAAGATGACGCCAAGGACAACCAGCAGAAAGCCAATG AGGTGGAGCAGATGATCAGGGACCTGGAAGCCAGCATTGCCCGCTACAAGGA GGAGTACGCTGTCCTCATCTCTGAGGCCCAGGCCATCAAGGCAGACCTGGCA GCTGTGGAAGCAAAGGTAAACCGGAGCACTGCACTTCTAAAGAGTTTATCTG CCGAAAGGGAACGTTGGGAAAAGACGAGTGAAACTTTCAAAAACCAGATGTC TACCATTGCTGGGGACTGCCTCCTGTCGGCGGCCTTCATTGCTTACGCTGGC TACTTTGACCAGCAAATGCGCCAGAACTTGTTCACCACCTGGTCTCATCACT TACAGCAAGCCAACATCCAGTTCCGCACAGACATTGCAAGGACGGAGTACCT CTCCAATGCTGACGAACGCCTCCGCTGGCAGGCCAGCTCTCTGCCTGCCGAC GACCTGTGCACAGAGAATGCCATCATGCTAAAACGATTCAATAGGTACCCGC TGATCATCGACCCCTCCGGACAGGCCACAGAATTCATCATGAATGAATATAA GGACCGGAAGATCACAAGGACCAGCTTCTTAGATGATGCCTTCCGGAAGAAT TTGGAGAGTGCTCTGAGATTTGGCAATCCCCTTCTTGTCCAGGATGTGGAAA GCTACGATCCAGΪ TTGAATCCAGTACTGAACCGTGAAGTTCGGCGAACAGG AGGGAGGGTGCTGATTACCCTCGGTGACCAAGACATAGACCTGTCACCATCC TTTGTCATCTTTCTGTCTACCCGAGACCCAACTGTGGAGTTCCCACCAGACC TCTGCTCCCGGGTGACCTTTGTGAACTTCACCGTCACCCGCAGCAGTTTACA GAGCCAGTGTCTCAATGAAGTGCTTAAAGCAGAAAGGCCAGACGTGGACGAG AAGCGCTCCGACCTCCTGAAACTGCAAGGGGAGTTCCAACTCCGTTTACGGC AGCTTGAAAAGTCTCTGCTCCAAGCTCTGAATGAGGTAAAAGGCCGCATTCT GGTTGACGACACCATCATTACAACCCTGGAGAATCTGAAGCGGGAAGCTGCC GAGGTTACCAGAAAGGTGGAGGAGACAGATATTGTCATGCAGGAGGTGGAGA CCGTGTCCCAGCAGTACCTGCCGCTGTCCACTGCCTGCAGCAGCATCTACTT CACTATGGAGTCCTTGAAGCAGGTTCACTTCCTGTACCAGTACTCTCTGCAG TTCTTCCTGGACATCTACCACAACGTGCTGTATGAGAACCCCAACCTGAAGG GTGCCACCGATCACACACAGCGCCTCTCCGTCATAACCAAGGACCTCTTCCA GGTGGCCTTTAACCGAGTGGCTCGAGGCATGCTGCACCAGGACCACATCACC TTCGCCATGCTGCTAGCGAGGATCAAGCTGAAAGGCACCGTGGGGGAGCCCA CCTATGATGCAGAGTTCCAGCACTTCCTCAGAGGGAAGGAGATTGTGCTGAG TGCTGGCTCCACCCCCAAAATCCAGGGCCTGACCGTAGAGCAGGCAGAAGCT GTCGTGAGGTTGAGCTGTCTGCCTGCATTTAAAGATCTGATTGCCAAGGTGC AGGCAGATGAGCAGTTTGGCATTTGGCTGGATAGCAGTTCACCAGAGCAGAC CGTGCCATACCTCTGGAGCGAGGAAACGCCTACAACTCCCATTGGGCAGGCC ATCCACCGCCTGCTCCTGATTCAAGCCTTCCGACCCGACCGCCTGTTGGCCA TGGCCCACATGTTTGTTTCCACAAACCTCGGAGAGTCCTTCATGTCCATCAT GGAGCAGCCTCTCGACCTCACCCACATTGTGGGCACAGAGGTGAAGCCAAAC ACACCTGTCCTGATGTGCTCTGTGCCTGGGTATGATGCCAGCGGACATGTTG AGGACCTCGCAGCAGAGCAGAACACGCAGATCACGTCTATTGCCATCGGCTC AGCAGAAGGCTTTAACCAAGCAGATAAGGCCATCAACACCGCCGTGAAGTCA GGCAGGTGGGTGATGTTGAAGAACGTGCACCTGGCCCCGGGCTGGCTGATGC AGCTGGAGAAGAAGCTGCACTCCCTGCAGCCCCACGCCTGCTTCCGACTTTT CCTCACCATGGAGATCAACCCCAAGGTGCCCGTGAACCTGCTCCGTGCTGGT CGGATCTTTGTGTTTGAGCCACCACCCGGAGTGAAAGCCAACATGCTGAGGA CATTTAGCAGCATCCCTGTCTCTAGGATATGCAAGTCTCCAAATGAGCGCGC CCGCTTGTATTTCCTGCTGGCTTGGTTCCATGCCATCATCCAAGAGCGCCTG CGCTATGCTCCACTGGGGTGGTCAAAGAAGTACGAATTTGGAGAATCTGACC TTCGATCAGCTTGTGACACGGTGGACACGTGGCTGGACGACACAGCCAAGGG CCGGCAGAACATCTCACCGGATAAGATCCCATGGTCTGCCCTGAAGACCCTG ATGGCGCAGTCCATCTATGGTGGGCGGGTGGACAATGAGTTCGACCAGCGTC TGCTCAACACCTTCCTGGAGCGGCTGTTCACCACCCGCAGCTTCGACAGTGA ATTCAAGCTGGCGTGCAAGGTTGACGGGCACAAGGACATCCAGATGCCTGAT GGTATCAGGCGAGAGGAGTTTGTGCAGTGGGTGGAGCTGCTGCCTGACGCCC AGACACCCTCATGGCTGGGCCTCCCCAACAATGCTGAAAGGGTCCTGCTTAC CACCCAAGGCGTGGACATGATCAGCAAGATGCTGAAGATGCAGATGCTGGAG GACGAGGATGACCTGGCCTACGCAGAGACGGAGAAGAAGGCAAGGACGGACT CCACCTCCGATGGCCGTCCAGCCTGGATGAGGACACTGCACACCACGGCGTC CAACTGGCTGCACCTCATCCCACAGACACTGAGCCCCCTGAAGCGCACCGTG GAGAACATCAAGGATCCTTTGTTTAGGTTCTTTGAGAGAGAAGTAAAGATGG GGGCCAAGTTACTCCAAGATGTGCGCCAAGACCTTGCTGACGTCGTTCAAGT GTGCGAGGGGAAAAAGAAGCAGACAAACTACCTGCGCACGCTCATCAATGAG CTGGTGAAAGGGATCTTGCCTCGGAGCTGGTCCCATTACACAGTGCCTGCAG GCATGACGGTGATCCAGTGGGTGTCAGATTTCAGCGAGAGGATCAAACAGCT GCAGAACATCTCACAAGCAGCTGCATCTGGTGGTGCCAAGGAACTGAAGAAC ATCCACGTGTGCCTGGGTGGCCTGTTTGTACCTGAGGCCTACATCACTGCCA CCAGACAGTATGTGGCACAAGCTAACAGCTGGTCCCTGGAGGAACTCTGCCT GGAAGTCAATGTCACCGCCTCACAGAGTGCCACCCTTGATGCCTGCAGCTTT GGAGTCACAGGTCTGAAGCTCCAAGGGGCCACGTGCAGCAACAACAAGCTAT CACTCTCCAATGCCATCTCCACAGTCCTCCCCCTCACACAGCTGCGCTGGGT GAAACAAACAAGCGCCGAGAAGAAGGCCAGCGTGGTGACCTTACCTGTCTAC CTGAACTTCACCCGGGCAGACCTCATCTTCACCGTGGACTTTGAAATTGCTA CAAAGGAAGATCCTCGCAGCTTCTATGAGCGTGGAGTTGCCGTTCTGTGCAC TGAGTAAAGCTAGACTTTTCTCCAGTCCTCTTTCTGGAATAGGAAACTCCCA ATATTTAACCTTCATTCATCCTTAACGGTGTGGAAGGGTTGATGGACTGGAA AGCAAGTGGTTGGTTCGCGTTGGCGGGTGACAGGTGCTGCGGTTGGAGACGG TGGGATGGGAGAAGAGAAGAGTGCGCTGTCCGAGGGCTGACCGAATGGCTGG
GTTTAGTAAATAAAACACTAAGCATGACGGGCAAAAAAAAAAAAAAAAAAA
Table 3. Mutated human cytoplasmic dynein heavy chain 1, cDNA (SEQ ID NO:5)
ATGTCGGAGCCCGGGGGCGGCGGCGGCGAGGACGGCTCGGCCGGA TTGGAAGTGTCGGCCGTGCAGAATGTGGCGGACGTGTCGGTGCTG CAGAAGCACCTGCGCAAGCTGGTGCCGCTGCTGCTGGAGGACGGC GGCGAGGCGCCGGCCGCGCTGGAGGCGGCGCTGGAGGAGAAGAGC GCCCTGGAGCAGATGCGCAAGTTCCTTTCGGACCCGCAGGTCCAC ACGGTGCTGGTGGAGCGCTCCACGCTCAAAGAGGACGTCGGTGAT GAAGGAGAAGAAGAAAAAGAATTCATTTCCTATAACATCAACATA GACATTCATTATGGGGTTAAATCCAATAGCTTGGCATTCATTAAA CGTACTCCCGTGATTGATGCAGATAAACCCGTGTCTTCTCAGCTC CGGGTCCTTACACTCAGTGAAGACTCGCCCTACGAAACTTTGCAT TCTTTCATTAGCAATGCAGTGGCTCCTTTTTTTAAGTCCTACATT AGAGAGTCTGGCAAGGCAGACAGGGATGGTGATAAAATGGCTCCT TCAGTTGAAAAGAAGATTGCAGAACTCGAAATGGGACTCCTTCAC TTGCAGCAAAATATTGAAATTCCGGAGATCAGCCTGCCGATTCAT CCAATGATCACAAATGTTGCAAAACAGTGTTATGAGCGTGGAGAA AAGCCAAAAGTTACAGACTTTGGTGATAAGGTTGAAGACCCAACA TTTCTTAATCAGTTACAATCTGGAGTTAACCGCTGGATCCGAGAA ATTCAAAAAGTGACCAAACTGGATCGAGATCCTGCATCAGGAACT GCCTTACAGGAAATTAGTTTTTGGCTAAACTTGGAACGTGCGTTA TACCGCATCCAGGAGAAACGGGAGAGCCCGGAAGTTCTCCTGACT CTGGATATCTTGAAACATGGCAAGCGCTTCCATGCCACCGTCAGT TTTGACACTGACACAGGTCTAAAACAGGCTTTGGAAACTGTGAAT GACTACAATCCTCTGATGAAAGATTTCCCTCTGAATGATTTGCTG TCTGCCACGGAGCTGGACAAAATAAGACAGGCGCTTGTTGCCATT TTCACACATTTGAGAAAGATCCGAAACACAAAATATCCTATTCAG AGGGCACTGCGTTTGGTGGAGGCAATTTCAAGAGACTTGAGTTCT CAATTACTCAAAGTATTGGGCACTAGGAAATTGATGCATGTTGCT TATGAAGAATTTGAAAAAGTTATGGTAGCATGCTTTGAAGTTTTT CAGACTTGGGATGATGAGTATGAGAAACTTCAGGTATTGTTGAGA GACATCGTCAAAAGAAAAAGGGAAGAAAATCTGAAGATGGTGTGG CGTATCAACCCTGCCCACAGGAAGCTGCAGGCCCGCCTTGACCAG ATGAGAAAATTTAGACGCCAGCATGAACAGCTAAGAGCTGTTATC GTCAGGGTCCTGAGGCCACAGGTCACGGCAGTTGCACAACAGAAT CAAGGAGAGGTCCCTGAACCCCAAGATATGAAAGTGGCTGAGGTT CTCTTTGATGCTGCAGATGCAAATGCCATTGAGGAAGTAAACCTT GCTTATGAGAACGTCAAGGAAGTGGATGGACTGGATGTTTCCAAA GAGGGCACGGAAGCCTGGGAGGCTGCTATGAAGAGGTACGA GAG AGGATCGACAGAGTGGAGACCCGGATCACCGCTCGCCTTCGGGAT CAGCTTGGCACAGCCAAGAATGCCAACGAGATGTTTAGGATTTTC TCCAGGTTTAATGCACTGTTTGTCAGGCCTCACATCCGTGGGGCC ATTCGCGAATACCAGACCCAGCTGATCCAGCGCGTGAAAGATGAC ATTGAGTCTCTTCACGACAAGTTCAAGGTCCAGTACCCACAGAGT CAGGCTTGTAAGATGAGTCACGTTCGTGACTTGCCCCCTGTGTCA GGGTCTATCATCTGGGCTAAACAGATCGACAGGCAGCTGACGGCC TACATGAAGCGGGTGGAAGATGTCCTTGGCAAGGGCTGGGAGAAT CACGTGGAGGGGCAGAAGCTGAAGCAGGATGGAGACAGCTTCCGC ATGAAGCTCAACACGCAGGAGATCTTTGATGACTGGGCAAGGAAG GTGCAGCAGCGCAACCTCGGTGTCTCGGGGCGCATTTTCACCATC GAAAGTACTCGGGTTCGGGGCCGAACTGGAAATGTGCTTAAGCTG AAAGTTAACTTTCTTCCTGAGATTATCACACTATCCAAAGAAGTC CGGAACCTCAAATGGCTTGGTTTCCGCGTCCCACTGGCGATTGTG AACAAAGCCCATCAAGCAAACCAGCTTTACCCGTTTGCCATCTCA CTGATCGAGAGCGTTCGTACCTATGAACGGACCTGCGAGAAGGTG GAGGAGCGGAACACCATTTCCCTTTTGGTGGCTGGCTTGAAAAAG GAAGTGCAGGCCCTGATCGCAGAAGGCATTGCGTTGGTGTGGGAG TCCTACAAACTTGACCCATATGTACAGCGCTTAGCAGAGACTGTC TTCAACTTCCAAGAAAAGGTGGATGATCTGCTGATCATTGAAGAA AAAATAGACCTAGAAGTCCGTTCCTTGGAAACTTGTATGTATGAC CATAAGACATTCTCGGAAATCTTGAACAGAGTCCAGAAAGCAGTG GATGACTTAAATCTGCACTCCTATTCCAATTTGCCCATCTGGGTC AACAAGCTTGACATGGAGATTGAAAGAATATTGGGCGTCCGTCTG CAAGCTGGCCTGAGAGCTTGGACGCAGGTTCTTCTTGGACAAGCT GAAGATAAAGCAGAAGTTGACATGGACACAGATGCTCCACAAGTT AGTCACAAGCCTGGTGGAGAGCCAAAGATCAAAAATGTCGTTCAT GAGCTAAGAATAACCAATCAGGTAATCTACTTGAATCCACCAATT GAAGAGTGCAGATACAAGCTGTATCAGGAAATGTTTGCCTGGAAG ATGGTTGTACTGTCTCTCCCCAGGATCCAGAGTCAGAGGTACCAG GTGGGTGTACATTACGAATTGACTGAGGAAGAGAAATTCTATCGG AATGCTTTAACACGGATGCCTGATGGCCCTGTTGCCCTGGAAGAG TCGTATTCTGCTGTCATGGGCATTGTATCTGAAGTTGAACAGTAT GTCAAGGTTTGGCTTCAGT'GjTCAGTGTTTATGGGATATGCAAGCT GAAAACATC ATAACAGACTTGGAGAAGATCTCAACAAATGGCAG GCTCTCCTGGTCCAAATAAGGAAGGCCAGAGGAACCTTTGACAAT GCAGAAACCAAGAAAGAGTTTGGACCAGTAGTTATAGATTATGGC AAGGTACAATCTAAGGTGAACTTGAAATATGACTCTTGGCATAAG GAGGTTCTTAGCAAATTTGGGCAGATGCTAGGATCAAACATGACG GAATTCCATTCCCAGATCTCAAAGTCCCGCCAAGAGTTGGAGCAG CACTCAGTAGACACGGCCAGCACCTCCGATGCAGTGACCTTCATC ACCTATGTGCAG.TCTTTGAAACGGAAGATCAAGCAGTTTGAGAAG CAAGTTGAGCTCTACCGCAATGGCCAGCGCTTACTGGAAAAGCAA AGGTTCCAGTTCCCACCTTCCTGGCTTTATATTGACAACATCGAG GGAGAGTGGGGAGCCTTCAATGACATCATGCGGCGAAAGGACTCT GCCATTCAGCAGCAGGTGGCAAACCTGCAAATGAAGATTGTCCAG GAGGATCGGGCCGTGGAAAGCCGCACCACCGACCTGCTGACTGAC TGGGAGAAGACCAAGCCTGTCACGGGCAACCTTCGCCCAGAAGAG GCACTTCAGGCTCTCACCATATATGAGGGGAAGTTTGGTAGGCTG AAGGACGACAGAGAGAAGTGTGCAAAGGCCAAGGAGGCGCTGGAA TTGACAGATACTGGGCTTCTCAGTGGCAGTGAAGAGCGCGTGCAG GTGGCCTTAGAAGAATTACAGGACCTCAAAGGCGTTTGGTCAGAA CTTTCTAAGGTTTGGGAGCAAATCGATCAGATGAAGGAGCAACCC TGGGTTTCAGTACAGCCTCGAAAGCTTCGACAAAATTTGGATGCC CTCCTGAACCAGCTGAAAAGCTTCCCTGCCCGGTTGCGACAGTAT GCGTCCTATGAGTTTGTTCAGAGGCTTCTGAAAGGTTACATGAAG ATAAATATGCTGGTGATTGAACTGAAATCCGAAGCACTTAAAGAC CGCCATTGGAAACAGCTCATGAAAAGGCTTCACGTTAATTGGGTT GTTTCTGAGCTAACCCTTGGCCAAATCTGGGATGTTGACTTGCAG AAAAATGAAGCGATTGTCAAGGATGTACTGCTTGTGGCACAAGGG GAGATGGCTTTGGAAGAATTTTTGAAGCAGATAAGAGAAGTGTGG AATACTTATGAACTAGACTTGGTTAATTATCAGAACAAGTGCCGC TTGATCCGTGGCTGGGATGACCTCTTCAACAAGGTCAAAGAACAC ATCAACAGCGTCTCGGCCATGAAGCTCTCTCCGTATTACAAGGTT TTTGAAGAGGATGCTCTCAGCTGGGAAGATAAGCTGAACAGGATC ATGGCTCTCTTTGATGTGTGGATTGATGTGCAGAGGCGGTGGGTC TACCTGGAAGGTATCTTCACAGGCAGTGCAGATATCAAGCACCTG CTGCCAGTGGAAACCCAGCGGTTTCAGAGCATCAGCACTGAGTTT TTGGCTCTAATGAAAAAAGTGTCCAAGTCTCCCCTTGTTATGGAT GTTCTGAACATCCAGGGAGTACAGAGGTCTCTGGAAAGATTGGCA GACCTGCTAGGAAAGATCCAGAAAGCATTGGGAGAATATCTGGAA AGAGAGCGGTCATCTTTCCCCAGGTTCTATTTTGTGGGTGATGAA GATTTGCTTGAAATCATTGGAAACAGCAAGAATGTCGCTAAATTA CAGAAACACTTCAAGAAGATGTTTGCTGGAGTTTCGAGCATCATC CTGAACGAGGATAACTCTGTTGTTTTGGGTATT CATCTCGGGAA GGAGAGGAGGTTATGTTTAAAACTCCTGTGTCAATT CTGAACAT CCCAAAATCAATGAGTGGCTCACAT GGTAGAAAAGGAGATGAGA GTCACCCTGGCCAAACTGCTTGCTGAGTCTGTTACGGAAGTTGAG ATTTTTGGTAAAGCAACTTCAATTGACCCAAATACCTACATCACT TGGATTGATAAATACCAGGCCCAGCTTGTGGTT TGTCAGCCCAG ATAGCCTGGTCTGAGAACGTGGAGACCGCACTGAGCAGCATGGGC GGAGGTGGAGATGCCGCGCCCTTGCACTCTGTGCTGAGCAATGTG GAGGTCACCCTCAATGTGTTAGCAGACTCTGTCCTCATGGAGCAG CCCCCACTCCGAAGGCGGAAGCTAGAACACTTGATTACAGAGTTG GTTCACCAGAGAGATGTTACAAGGTCCTTGATCAAAAGCAAGATT GACAACGCCAAATCTTTTGAATGGCTCAGCCAGATGCGATTTTAC TTTGACCCTAAGCAAACTGATGTGTTACAGCAGTTGTCAAT CAA ATGGCAAATGCCAAATTTAACTATGGCTTTGAGTACCTGGGTGTT CAGGACAAACTGGTCCAGACCCCCCTCACTGACCGCTGCTATTTG ACAATGACACAAGCCTTGGAGGCCAGGCTGGGGGGTTCCCCATTT GGACCTGCTGGAACTGGGAAAACAGAGTCTGTCAAAGCTCTTGGC CATCAGCTTGGACGGTTTGTTTTAGTTTTCAACTGTGATGAAACC TTTGATTTCCAGGCAATGGGCCGGATCTTTGTGGGCCTTTGCCAG GTGGGTGCCTGGGGCTGCTTTGACGAGTTCAACCGCCTGGAGGAG CGGATGCTCTCGGCTGTGTCCCAGCAGGTGCAGTGCATACAGGAA GCACTGCGTGAACATTCCAACCCCAACTACGACAAGACCTCTGCC CCCATTACTTGTGAGCTGCTGAACAAACAAGTCAAGGTGAGCCCG GACATGGCCATCTTCATCACCATGAACCCTGGCTACGCGGGCCGG TCTAACCTTCCTGACAACTTGAAGAAGCTGTTCCGGAGCTTGGCC ATGACCAAGCCCGACCGGCAGTTAATCGCCCAGGTCATGCTGTAC TCACAGGGTTTCCGCACTGCTGAAGTGCTTGCCAACAAAATCGTC CCGTTTTTTAAACTATGCGATGAGCAGCTCTCTTCCCAAAGCCAT TATGACTTCGGTCTTCGGGCTTTGAAGAGTGTGCTGGTGAGTGCA GGCAATGTGAAGAGAGAGAGAATCCAGAAGATAAAGAGGGAGAAA GAGGAACGAGGGGAAGCAGTTGATGAAGGAGAAATTGCTGAAAAT CTCCCTGAACAAGAGATTCTGATACAGAGCGTCTGTGAGACGATG GTGCCAAAGCTGGTGGCAGAGGACATCCCGCTGCTCTTCAGCCTC CTGTCGGACGTGTTCCCTGGAGTCCAGTATCACAGGGGTGAGATG ACTGCCCTTCGAGAGGAGCTGAAGAAAGTGTGTCAGGAGATGTAT TTGACATATGGAGATGGAGAAGAAGTTGGTGGAATGTGGGTTGAA AAGGTTCTCCAGCTCTATCAGATCACCCAGATCAATCATGGCCTG ATGATGGTGGGGCCCTCGGGAAGTGGGAAGAGCATGGCCTGGCGT GTCCTGCTGAAGGCATTGGAGAGACTCGAGGGTGTGGAAGGTGTG GCCCATATCATCGACCCCAAGGCCATCAGCAAAGACCACCTCTAC GGAACCCTGGACCCCAACACCAGGGAATGGACAGATGGGCTCTTC ACACACGTGCTGAGAAAGATCATCGACAGCGTGAGAGGCGAGCTG CAGAAGCGCCAGTGGATCGTCTTCGATGGCGATGTGGATCCAGAG TGGGTTGAGAACTTGAACTCAGTGCTGGATGACAATAAGCTCCTA ACTTTGCCCAATGGAGAGCGCCTCAGTCTTCCACCCAATGTGAGA ATAATGTTTGAGGTACAGGACTTGAAATACGCGACCTTGGCCACA GTGTCGCGCTGCGGCATGGTCTGGTTCAGTGAGGATGTGCTGAGC ACCGACATGATCTTCAACAACTTCCTGGCCAGGCTGCGCAGCATC CCGCTGGATGAAGGGGAGGATGAGGCACAGCGGCGGCGTAAGGGC AAAGAGGATGAGGGGGAGGAGGCCGCTTCCCCCATGCTGCAGATC CAAAGAGATGCAGCTACGATCATGCAACCGTACTTCACGTCCAAC GGCCTGGTCACCAAGGCGCTAGAGCACGCCTTCCAGCTGGAGCAC ATCATGGACCTAACACGCCTGCGCTGCCTGGGCTCGCTCTTCTCC ATGCTGCACCAGGCCTGCCGCAACGTGGCGCAGTATAACGCCAAC CATCCCGACTTCCCCATGCAGATCGAGCAGCTGGAGCGCTACATT CAGCGA ATCTGGTTTATGCCA ACTCTGGTCCCTGTCTGGAGAC AGCCGGCTAAAAATGAGAGCAGAGCTGGGTGAATACATCAGAAGA ATCACGACCGTGCCTCTGCCCACTGCGCCCAACATACCCATTATC GATTATGAGGTGTCCATCAGCGGAGAATGGTCTCCGTGGCAGGCC AAGGTGCCTCAGATTGAAGTGGAGACGCACAAGGTGGCAGCCCCT GATGTCGTCGTGCCAACGCTGGACACAGTCCGCCACGAAGCCCTC TTGTACACTTGGCTGGCCGAACACAAGCCCCTGGTCTTGTGTGGC CCTCCTGGGTCTGGCAAGACCATGACACTCTTCAGCGCCCTCCGG GCCTTGCCTGACATGGAGGTGGTGGGTCTCAACTTCTCCAG GCT ACTACTCCAGAGCTGCTTCTGAAGACTTTTGATCACTACTGCGAG TACAGGCGCACACCTAATGGGGTGGTTTTGGCTCCTGT CAACTT GGAAAGTGGCTGGTGTTGTTCTGTGATGAAATCAACTTGCCAGAT ATGGATAAATATGGGACCCAGAGGGTCATATCCTTCATCAGACAG ATGGTGGAGCACGGAGGCTTTTACCGTACCTCAGATCAAACATGG GTGAAGCTGGAGAGAATCCAGTTTGTTGGGGCTTGTAATCCCCCC ACAGACCCTGGAAGAAAGCCCCTCTCACACAGGTTCCTGCGCCAC GTGCCTGTCGTGTATGTGGATTACCCGGGCCCCGCCTCCCTCACA CAGATCTACGGCACCTTCAACCGCGCCATGCTGAGGCTCATTCCA TCCCTGCGGACGTATGCAGAGCCGCTCACTGCTGCCATGGTGGAG TTCTACACCATGTCTCAGGAGAGATTCACCCAGGATACACAACCT CACTATATCTATTCACCCCGTGAAATGACTAGGTGGGTGAGAGGC ATCTTTGAAGCGCTGAGACCTCTGGAGACCCTGCCTGTTGAAGGC CTCATTCGGATTTGGGCACATGAAGCTCTGCGTCTCTTCCAAGAT AGACTCGTAGAGGATGAGGAGAGGCGTTGGACTGATGAGAACATC GACACGGTTGCTCTGAAGCACTTCCCTAACATCGACAGAGAGAAG GCAATGAGCCGACCCATCTTGTACAGCAACTGGCTGTCAAAGGAT TACATCCCAGTAGACCAAGAAGAGTTAAGAGATTATGTCAAAGCT AGGCTGAAGGTCTTTTATGAAGAAGAACTTGATGTTCCGCTGGTG CTGTTTAATGAAGTCCTAGACCACGTGCTGAGGATTGACAGAATA TTCCGTCAACCTCAAGGCCACTTGCTTCTGATTGGTGTTAGTGGA GCAGGAAAAACTACCCTGTCTCGTTTCGTCGCCTGGATGAACGGT TTGAGTGTGTACCAGATTAAGGTCCATAGGAAGTACACAGGGGAA GACTTTGATGAAGATCTACGGACAGTGTTGAGACGTTCTGGCTGT AAAAATGAAAAGATAGCATTTATAATGGATGAATCTAATGTGTTA GATTCTGGATTCCTGGAGCGAATGAATACCCTTCTGGCCAATGGA GAGGTGCCTGGTCTCTTTGAAGGAGACGAGTATGCCACCTTGATG ACGCAGTGCAAAGAGGGGGCACAGAAGGAAGGCCTGATGCTGGAC TCGCACGAGGAGCTCTACAAGTGGTTCACTAGCCAGGTTATCCGC AACCTCCACGTCGTGTTCACCATGAACCCGTCCTCGGAGGGACTC AAGGACCGGGCAGCTACATCACCAGCACTTTTCAACAGGTGTGTG TTGAATTGGTTTGGAGACTGGTCCACCGAAGCACTGTATCAGGTT GGCAAAGAATTCACAAGTAAGATGGATCTGGAGAAGCCAAATTAC ATCGTGCCTGATTACATGCCAGTTGTGTATGATAAGCTGCCGCAG CCACCATCCCATCGGGAAGCCATTGTGAACAGCTGTGTGTTTGTT CATCAGACTCTTCACCAGGCGAATGCTCGGCTAGCAAAGCGAGGC GGCAGAACGATGGCCATCACCCCTCGCCACTACCTGGACTTCATC AATCACTATGCCAACCTGTTCCACGAGAAGCGGAGCGAGCTGGAG GAGCAGCAGATGCACTTGAACGTGGGGCTCAGGAAGATCAAAGAG ACAGTCGACCAGGTAGAAGAACTGCGTCGTGACTTGAGGATAAAG AGCCAAGAGCTGGAGGTGAAGAATGCAGCAGCCAATGACAAGCTG AAAAAGATGGTGAAAGACCAGCAGGAGGCTGAAAAGAAGAAGGTT ATGAGCCAAGAAATCCAGGAACAGCTGCATAAGCAGCAGGAGGTA ATTGCAGACAAACAGATGAGTGTCAAAGAAGATCTTGATAAGGTG GAACCTGCCGTCATTGAGGCCCAGAATGCTGTGAAGTCGATCAAG AAGCAGCACCTGGTGGAGGTGAGGTCCATGGCCAACCCTCCTGCT GCTGTGAAGCTGGCGCTGGAGTCCATCTGCCTGCTGCTGGGGGAA AGCACCACAGACTGGAAGCAGATCCGCTCCATCATCATGCGGGAG AACTTCATCCCCACCATCGTCAACTTCTCTGCAGAGGAGATCAGT GACGCCATAAGGGAGAAGATGAAGAAAAATTACATGTCCAATCCA AGTTACAATTATGAAATTGTGAATCGGGCTTCCCTGGCTTGCGGC CCTATGGTGAAATGGGCAATTGCACAGCTTAACTATGCAGACATG TTAAAGAGAGTGGAGCCCCTACGCAATGAGCΪGCAGAAGCTGGAA GATGACGCCAAGGACAACCAGCAGAAGGCCAACGAGGTGGAGCAG ATGATCCGAGACCTGGAAGCCAGCATCGCCCGCTACAAGGAGGAA TACGCCGTCCTGATCTCAGAGGCCCAGGCCATCAAGGCAGACCTG GCAGCTGTCGAGGCAAAAGTAAACCGGAGCACTGCTCTTCTGAAG AGCTTGTCTGCTGAACGTGAACGATGGGAAAAAACAAGTGAAACT TTCAAAAACCAGATGTCCACCATTGCTGGGGACTGTCTCTTGTCA GCTGCGTTCATTGCCTACGCGGGTTACTTTGACCAGCAGATGCGT CAGAACTTGTTCACTACCTGGTCCCATCACCTACAGCAAGCCAAC ATCCAGTTCCGTACAGATATTGCCAGGACGGAATACCTTTCCAAT GCTGATGAGCGTCTTCGCTGGCAGGCCAGCTCCTTGCCTGCTGAT GACCTTTGCACAGAAAATGCCATCATGCTGAAACGATTCAATAGG TATCCGCTGATCATTGACCCCTCTGGACAGGCCACAGAATTCATT ATGAATGAATATAAGGATCGTAAGATCACACGGACCAGCTTCCTG GATGACGCCTTCAGAAAGAACTTAGAGAGTGCACTGAGATTCGGT AACCCCCTTCTGGTCCAGGATGTGGAAAGCTACGATCCAGTTTTG AACCCGGTGCTGAACCGTGAAGTGCGGCGAACAGGGGGGAGAGTG CTGATCACTCTCGGGGACCAGGACATAGACCTGTCGCCATCGTTT GTCATCTTCCTGTCCACCCGGGATCCAACTGTCGAGTTCCCACCA GATCTCTGTTCCCGGGTTACTTTTGTAAACTTCACAGTTACCCGT AGCAGTTTACAAAGCCAGTGTCTAAATGAAGTACTTAAAGCAGAA AGACCTGATGTGGACGAGAAACGATCTGATCTTCTTAAACTTCAA GGGGAATTTCAGCTCCGTTTGCGTCAGCTGGAAAAATCTCTACTA CAAGCTCTGAACGAGGTGAAAGGGCGCATTTTGGATGACGACACG ATCATAACCACTCTGGAGAACCTGAAGAGAGAGGCTGCAGAGGTC ACCAGGAAAGTTGAGGAGACGGACATTGTCATGCAGGAGGTGGAG ACCGTGTCCCAGCAGTACCTCCCGCTCTCCACCGCCTGCAGCAGC ATCTACTTCACCATGGAGTCCCTCAAGCAGATACACTTCTTGTAC CAGTACTCCCTCCAGTTTTTCCTGGACATTTATCACAACGTCCTA TACGAGAACCCGAACCTGAAGGGTGTCACCGACCACACACAGCGC CTGTCCATTATAACAAAGGACCTCTTCCAGGTGGCGTTTAACCGA GTGGCTCGAGGCATGCTGCATCAGGACCACATTACCTTTGCCATG CTGCTGGCAAGAATCAAACTGAAGGGCACCGTGGGGGAGCCCACC TACGATGCAGAATTCCAGCACTTCTTGAGAGGAAATGAGATTGTC CTGAGTGCTGGCTCCACCCCCAGGATCCAGGGCCTGACTGTGGAG CAGGCGGAGGCGGTGGTGAGGCTGAGCTGCCTTCCCGCGTTTAAG GACTTGATTGCAAAGGTTCAGGCAGACGAGCAATTTGGCATCTGG CTGGACAGCAGCTCCCCGGAGCAGACTGTGCCCTACCTCTGGAGT GAAGAAACACCTGCAACACCCATTGGCCAGGCCATCCACCGCCTG CTCCTGATCCAGGCTTTCCGGCCCGATCGCCTGTTGGCCATGGCC CACATGTTTGTTTCAACAAACCTTGGGGAGTCTTTCATGTCCATC ATGGAGCAGCCGCTCGACCTGACCCACATTGTGGGCACAGAGGTG AAGCCCAACACTCCTGTCTTAATGTGCTCTGTGCCTGGTTATGAT GCCAGTGGACATGTCGAGGACCTTGCAGCCGAGCAGAACACGCAG ATCACTTCAATTGCAATCGGCTCTGCAGAAGGCTTTAACCAAGCA GATAAGGCAATAAACACCGCTGTAAAGTCGGGCAGGTGGGTGATG CTGAAGAATGTGCATCTGGCCCCAGGGTGGCTGATGCAGCTGGAG AAGAAGTTGCATTCCCTGCAGCCGCATGCCTGCTTCCGACTCTTC CTCACCATGGAGATCAACCCCAAGGTGCCTGTGAATCTGCTCCGT GCGGGCCGCATCTTTGTGTTCGAGCCACCGCCAGGGGTGAAGGCC AACATGCTGAGGACGTTCAGCAGCATTCCCGTCTCACGGATATGC AAGTCTCCCAACGAGCGTGCCCGCTTGTACTTCCTGCTGGCCTGG TTTCATGCGATCATCCAAGAACGCTTACGATACGCACCACTGGGG TGGTCAAAGAAGTATGAATTTGGAGAGTCTGACCTGCGGTCAGCT TGCGATACGGTGGACACGTGGCTGGATGACACGGCCAAGGGCAGG CAGAACATCTCACCGGATAAGATCCCGTGGTCTGCACTAAAGACC TTAATGGCCCAGTCCATTTATGGCGGGCGCGTGGACAACGAGTTT GACCAGCGTCTGCTCAACACCTTCCTGGAGCGCCTGTTCACAACC AGGAGTTTCGACAGTGAGTTTAAGCTGGCATGCAAGGTCGACGGA CATAAAGACATTCAAATGCCAGATGGCATCAGGCGAGAGGAGTTT GTGCAGTGGGTGGAGTTGCTCCCCGACACCCAGACGCCCTCCTGG CTGGGCCTGCCCAACAACGCCGAGAGAGTCCTCCTTACCACACAG GGTGTGGACA GATCAGTAAAATGCTGAAGATGCAGATGTTGGAG GATGAGGACGACCTGGCCTACGCAGAGACTGAGAAGAAGACGAGG ACAGACTCCACGTCCGACGGGCGCCCTGCCTGGATGCGGACACTG CACACCACCGCGTCCAACTGGCTGCACCTCATCCCCCAGACGCTG AGCCACCTCAAGCGCACCGTGGAGAATATCAAGGATCCTTTGTTC AGGTTCTTTGAGAGAGAAGTGAAGATGGGCGCAAAGCTGCTTCAG GACGTTCGCCAGGACCTTGCAGATGTCGTCCAGGTGTGCGAAGGA AAGAAGAAGCAGACCAACTACTTGCGCACGCTGATCAACGAGCTA GTGAAAGGGA CT GCCTCGGAGCTGGTCCCACTACACGGTGCCT GCCGGCATGACCGTCATCCAGTGGGTGTCCGACTTCAGCGAGAGG ATCAAACAGCTGCAGAACATCTCACTGGCAGCTGCATCTGGTGGC GCCAAGGAGCTAAAGAACATCCACGTGTGCCTGGGTGGCCTGTTC GTGCCTGAGGCGTACATCACTGCCACCAGGCAGTATGTGGCCCAG GCCAACAGCTGGTCCCTGGAGGAGCTCTGCCTGGAAGTCAACGTC ACCACCTCACAGGGCGCCACCCTTGACGCTTGCAGCTTCGGAGTC ACGGGTTTGAAACTTCAAGGGGCCACGTGCAACAACAACAAGCTG TCACTGTCCAATGCCATCTCAACCGCCGTTCCCCTGACGCAGCTG CGCTGGGTCAAGCAGACAAACACCGAGAAGAAGGCCAGTGTGGTA ACCTTACCTGTCTACCTGAACTTCACCCGTGCAGACCTCATCTTC ACCGTGGACTTCGAAATTGCTACAAAGGAGGATCCTCGCAGCTTC TACGAGCGGGGTGTCGCAGTCTTGTGCACAGAGTAA
Table 4. Wild type human cytoplasmic dynein heavy chain 1, cDNA (SEQ ID NO: 17)
ATGTCGGAGCCCGGGGGCGGCGGCGGCGAGGACGGCTCGGCCGGA TTGGAAGTGTCGGCCGTGCAGAATGTGGCGGACGTGTCGGTGCTG CAGAAGCACCTGCGCAAGCTGGTGCCGCTGCTGCTGGAGGACGGC GGCGAGGCGCCGGCCGCGCTGGAGGCGGCGCTGGAGGAGAAGAGC GCCCTGGAGCAGATGCGCAAGTTCCTTTCGGACCCGCAGGTCCAC ACGGTGCTGGTGGAGCGCTCCACGCTCAAAGAGGACGTCGGTGAT GAAGGAGAAGAAGAAAAAGAATTCATTTCCTATAACATCAACATA GACATTCATTATGGGGTTAAATCCAATAGCTTGGCATTCATTAAA CGTACTCCCGTGATTGATGCAGATAAACCCGTGTCTTCTCAGCTC CGGGTCCTTACACTCAGTGAAGACTCGCCCTACGAAACTTTGCAT TCTTTCATTAGCAATGCAGTGGCTCCTTTTTTTAAGTCCTACATT AGAGAGTCTGGCAAGGCAGACAGGGATGGTGATAAAATGGCTCCT TCAGTTGAAAAGAAGATTGCAGAACTCGAAATGGGACTCCT CAC TTGCAGCAAAATATTGAAATTCCGGAGATCAGCCTGCCGATTCAT CCAATGATCACAAATGTTGCAAAACAG GTTATGAGCGTGGAGAA AAGCCAAAAGTTACAGACTTTGGTGATAAGGTTGAAGACCCAACA TTTCTTAATCAGTTACAATCTGGAGTTAACCGCTGGATCCGAGAA ATTCAAAAAGTGACCAAACTGGATCGAGATCCTGCATCAGGAACT GCCTTACAGGAAATTAGTTTTTGGCTAAACTTGGAACGTGCGTTA TACCGCATCCAGGAGAAACGGGAGAGCCCGGAAGTTCTCCTGACT CTGGATATCTTGAAACATGGCAAGCGCTTCCATGCCACCGTCAGT TTTGACACTGACACAGGTCTAAAACAGGCTTTGGAAACTGTGAAT GACTACAATCCTCTGATGAAAGATTTCCCTCTGAATGATTTGCTG TCTGCCACGGAGCTGGACAAAATAAGACAGGCGCTTGTTGCCATT TTCACACATTTGAGAAAGATCCGAAACACAAAATATCC ATTCAG AGGGCACTGCGTTTGGTGGAGGCAATTTCAAGAGACTTGAGTTCT CAATTACTCAAAGTATTGGGCACTAGGAAATTGATGCATGTTGCT TATGAAGAATTTGAAAAAGTTATGGTAGCATGCTTTGAAGTTTTT CAGACTTGGGATGATGAGTATGAGAAACTTCAGGTATTGTTGAGA GACATCGTCAAAAGAAAAAGGGAAGAAAATCTGAAGATGGTGTGG CGTATCAACCCTGCCCACAGGAAGCTGCAGGCCCGCCTTGACCAG ATGAGAAAATTTAGACGCCAGCATGAACAGCTAAGAGCTGTTATC GTCAGGGTCCTGAGGCCACAGGTCACGGCAGTTGCACAACAGAAT CAAGGAGAGGTCCCTGAACCCCAAGATATGAAAGTGGCTGAGGTT CTCTTTGATGCTGCAGATGCAAATGCCATTGAGGAAGTAAACCTT GCTTATGAGAACGTCAAGGAAGTGGATGGACTGGATGTTTCCAAA GAGGGCACGGAAGCCTGGGAGGCTGCTATGAAGAGGTACGATGAG AGGATCGACAGAGTGGAGACCCGGATCACCGCTCGCCTTCGGGAT CAGCTTGGCACAGCCAAGAATGCCAACGAGATGTTTAGGATTTTC TCCAGGTTTAATGCACTGTTTGTCAGGCCTCACATCCGTGGGGCC ATTCGCGAATACCAGACCCAGCTGATCCAGCGCGTGAAAGATGAC ATTGAGTCTCTTCACGACAAGTTCAAGGTCCAGTACCCACAGAGT CAGGCTTGTAAGATGAGTCACGTTCGTGACTTGCCCCCTGTGTCA GGGTCTATCATCTGGGCTAAACAGATCGACAGGCAGCTGACGGCC TACATGAAGCGGGTGGAAGATGTCCTTGGCAAGGGCTGGGAGAAT CACGTGGAGGGGCAGAAGCTGAAGCAGGATGGAGACAGCTTCCGC ATGAAGCTCAACACGCAGGAGATCTTTGATGACTGGGCAAGGAAG GTGCAGCAGCGCAACCTCGGTGTCTCGGGGCGCATTTTCACCATC GAAAGTACTCGGGTTCGGGGCCGAACTGGAAATGTGCTTAAGCTG AAAGTTAACTTTCTTCCTGAGATTATCACACTATCCAAAGAAGTC CGGAACCTCAAATGGCTTGGTTTCCGCGTCCCACTGGCGATTGTG AACAAAGCCCATCAAGCAAACCAGCTTTACCCGTTTGCCATCTCA CTGATCGAGAGCGTTCGTACCTATGAACGGACCTGCGAGAAGGTG GAGGAGCGGAACACCATTTCCCTTTTGGTGGCTGGCTTGAAAAAG GAAGTGCAGGCCCTGATCGCAGAAGGCATTGCGTTGGTGTGGGAG TCCTACAAACTTGACCCATATGTACAGCGCTTAGCAGAGACTGTC TTCAACTTCCAAGAAAAGGTGGATGATCTGCTGATCATTGAAGAA AAAATAGACCTAGAAGTCCGTTCCTTGGAAACTTGTATGTATGAC CATAAGACATTCTCGGAAATCTTGAACAGAGTCCAGAAAGCAGTG GATGACTTAAATCTGCACTCCTATTCCAATTTGCCCATCTGGGTC AACAAGCTTGACATGGAGATTGAAAGAATATTGGGCGTCCGTCTG CAAGCTGGCCTGAGAGCTTGGACGCAGGTTCTTCTTGGACAAGCT GAAGATAAAGCAGAAGTTGACATGGACACAGATGCTCCACAAGTT AGTCACAAGCCTGGTGGAGAGCCAAAGATCAAAAATGTCGTTCAT GAGCTAAGAATAACCAATCAGGTAATCTACTTGAATCCACCAATT GAAGAGTGCAGATACAAGCTGTATCAGGAAATGTTTGCCT-GGAAG ATGGTTGTACTGTCTCTCCCCAGGATCCAGAGTCAGAGGTACCAG GTGGGTGTACATTACGAATTGACTGAGGAAGAGAAATTCTATCGG AATGCTTTAACACGGATGCCTGATGGCCCTGTTGCCCTGGAAGAG TCGTATTCTGCTGTCATGGGCATTGTATCTGAAGTTGAACAGTAT GTCAAGGTTTGGCTTCAGTATCAGTGTTTATGGGATATGCAAGCT GAAAACATCTATAACAGACTTGGAGAAGATCTCAACAAATGGCAG GCTCTCCTGGTCCAAATAAGGAAGGCCAGAGGAACCTTTGACAAT GCAGAAACCAAGAAAGAGTTTGGACCAGTAGTTATAGATTATGGC AAGGTACAATCTAAGGTGAACTTGAAATATGACTCTTGGCATAAG GAGGTTCTTAGCAAATTTGGGCAGATGCTAGGATCAAACATGACG GAATTCCATTCCCAGATCTCAAAGTCCCGCCAAGAGTTGGAGCAG CACTCAGTAGACACGGCCAGCACCTCCGATGCAGTGACCTTCATC ACCTATGTGCAGTCTTTGAAACGGAAGATCAAGCAGTTTGAGAAG CAAGTTGAGCTCTACCGCAATGGCCAGCGC TACTGGAAAAGCAA AGGTTCCAG TCCCACCTTCC GGCTTTA ATTGACAACATCGAG GGAGAGTGGGGAGCCTTCAATGACATCATGCGGCGAAAGGACTCT GCCATTCAGCAGCAGGTGGCAAACCTGCAAATGAAGATTGTCCAG GAGGATCGGGCCGTGGAAAGCCGCACCACCGACCTGCTGACTGAC TGGGAGAAGACCAAGCCTGTCACGGGCAACCTTCGCCCAGAAGAG GCACTTCAGGCTCTCACCATATATGAGGGGAAGTTTGGTAGGCTG AAGGACGACAGAGAGAAGTGTGCAAAGGCCAAGGAGGCGCTGGAA TTGACAGATACTGGGCTTCTCAGTGGCAGTGAAGAGCGCGTGCAG GTGGCCTTAGAAGAATTACAGGACCTCAAAGGCGTTTGGTCAGAA CTTTCTAAGGTTTGGGAGCAAATCGATCAGATGAAGGAGCAACCC TGGGTTTCAGTACAGCCTCGAAAGCTTCGACAAAATTTGGATGCC CTCCTGAACCAGCTGAAAAGCTTCCCTGCCCGGTTGCGACAGTAT GCGTCCTATGAGTTTGTTCAGAGGCTTCTGAAAGGTTACATGAAG ATAAATATGCTGGTGATTGAACTGAAATCCGAAGCACTTAAAGAC CGCCATTGGAAACAGCTCATGAAAAGGCTTCACGTTAATTGGGTT GTTTCTGAGCTAACCCTTGGCCAAATCTGGGATGTTGACTTGCAG AAAAATGAAGCGATTGTCAAGGATGTACTGCTTGTGGCACAAGGG GAGATGGCTTTGGAAGAATTTTTGAAGCAGATAAGAGAAGTGTGG AATACTTATGAACTAGACTTGGTTAATTATCAGAACAAGTGCCGC TTGATCCGTGGCTGGGATGACCTCTTCAACAAGGTCAAAGAACAC ATCAACAGCGTCTCGGCCATGAAGCTCTCTCCGTATTACAAGGTT TTTGAAGAGGATGCTCTCAGCTGGGAAGATAAGCTGAACAGGATC ATGGCTCTCTTTGATGTGTGGATTGATGTGCAGAGGCGGTGGGTC TACCTGGAAGGTATCTTCACAGGCAGTGCAGATATCAAGCACCTG CTGCCAGTGGAAACCCAGCGGTTTCAGAGCATCAGCACTGAGTTT TTGGCTCTAATGAAAAAAGTGTCCAAGTCTCCCCTTGTTATGGAT GTTCTGAACATCCAGGGAGTACAGAGGTCTCTGGAAAGATTGGCA GACCTGCTAGGAAAGATCCAGAAAGCATTGGGAGAATATCTGGAA AGAGAGCGGTCATCTTTCCCCAGGTTCTATTTTGTGGGTGATGAA GATTTGCTTGAAATCATTGGAAACAGCAAGAATGTCGCTAAATTA CAGAAACACTTCAAGAAGATGTTTGCTGGAGTTTCGAGCATCATC CTGAACGAGGATAACTCTGTTGTTTTGGGTATTTCATCTCGGGAA GGAGAGGAGGTTATGTTTAAAACTCCTGTGTCAATTACTGAACAT CCCAAAATCAATGAGTGGCTCACATTGGTAGAAAAGGAGATGAGA GTCACCCTGGCCAAACTGCTTGCTGAGTCTGTTACGGAAGTTGAG ATTTTTGGTAAAGCAACTTCAATTGACCCAAATACCTACATCACT TGGATTGATAAATACCAGGCCCAGCTTGTGGTTTTGTCAGCCCAG ATAGCCTGGTCTGAGAACGTGGAGACCGCACTGAGCAGCATGGGC GGAGGTGGAGATGCCGCGCCCTTGCACTCTGTGCTGAGCAATGTG GAGGTCACCCTCAATGTGTTAGCAGACTCTGTCCTCATGGAGCAG CCCCCACTCCGAAGGCGGAAGCTAGAACACTTGATTACAGAGTTG GTTCACCAGAGAGATGTTACAAGGTCCTTGATCAAAAGCAAGATT GACAACGCCAAATCTTTTGAATGGCTCAGCCAGATGCGATTTTAC TTTGACCCTAAGCAAACTGATGTGTTACAGCAGTTGTCAATTCAA ATGGCAAATGCCAAATTTAACTATGGCTTTGAGTACCTGGGTGTT CAGGACAAACTGGTCCAGACCCCCCTCACTGACCGCTGCTATTTG ACAATGACACAAGCCTTGGAGGCCAGGCTGGGGGGTTCCCCATTT GGACCTGCTGGAACTGGGAAAACAGAGTCTGTCAAAGCTCTTGGC CATCAGCTTGGACGGTTTGTTTTAGTTTTCAACTGTGATGAAACC TTTGATTTCCAGGCAATGGGCCGGATCTTTGTGGGCCTT GCCAG GTGGGTGCCTGGGGCTGCTTTGACGAGTTCAACCGCCTGGAGGAG CGGATGCTCTCGGCTGTGTCCCAGCAGGTGCAGTGCATACAGGAA GCACTGCGTGAACATTCCAACCCCAACTACGACAAGACCTCTGCC CCCATTACTTGTGAGCTGCTGAACAAACAAGTCAAGGTGAGCCCG GACATGGCCATCTTCATCACCATGAACCCTGGCTACGCGGGCCGG TCTAACCTTCCTGACAACTTGAAGAAGCTGTTCCGGAGCTTGGCC ATGACCAAGCCCGACCGGCAGTTAATCGCCCAGGTCATGCTGTAC TCACAGGGTTTCCGCACTGCTGAAGTGCTTGCCAACAAAATCGTC CCGTTTTTTAAACTATGCGATGAGCAGCTCTCTTCCCAAAGCCAT TATGACTTCGGTCTTCGGGCTTTGAAGAGTGTGCTGGTGAGTGCA GGCAATGTGAAGAGAGAGAGAATCCAGAAGATAAAGAGGGAGAAA GAGGAACGAGGGGAAGCAGTTGATGAAGGAGAAATTGCTGAAAAT CTCCCTGAACAAGAGATTCTGATACAGAGCGTCTGTGAGACGATG GTGCCAAAGCTGGTGGCAGAGGACATCCCGCTGCTCTTCAGCCTC CTGTCGGACGTGTTCCCTGGAGTCCAGTATCACAGGGGTGAGATG ACTGCCCTTCGAGAGGAGCTGAAGAAAGTGTGTCAGGAGATGTAT TTGACATATGGAGATGGAGAAGAAGTTGGTGGAATGTGGGTTGAA AAGGTTCTCCAGCTCTATCAGATCACCCAGATCAATCATGGCCTG ATGATGGTGGGGCCCTCGGGAAGTGGGAAGAGCATGGCCTGGCGT GTCCTGCTGAAGGCATTGGAGAGACTCGAGGGTGTGGAAGGTGTG GCCCATATCATCGACCCCAAGGCCATCAGCAAAGACCACCTCTAC GGAACCCTGGACCCCAACACCAGGGAATGGACAGATGGGCTCTTC ACACACGTGCTGAGAAAGATCATCGACAGCGTGAGAGGCGAGCTG CAGAAGCGCCAGTGGATCGTCTTCGATGGCGATGTGGATCCAGAG TGGGTTGAGAACTTGAACTCAGTGCTGGATGACAATAAGCTCCTA ACTTTGCCCAATGGAGAGCGCCTCAGTCTTCCACCCAATGTGAGA ATAATGTTTGAGGTACAGGACTTGAAATACGCGACCTTGGCCACA GTGTCGCGCTGCGGCATGGTCTGGTTCAGTGAGGATGTGCTGAGC ACCGACATGATCTTCAACAACTTCCTGGCCAGGCTGCGCAGCATC CCGCTGGATGAAGGGGAGGATGAGGCACAGCGGCGGCGTAAGGGC AAAGAGGATGAGGGGGAGGAGGCCGCTTCCCCCATGCT'GCAGATC CAAAGAGATGCAGCTACGATCATGCAACCGTACTTCACGTCCAAC GGCCTGGTCACCAAGGCGCTAGAGCACGCCTTCCAGCTGGAGCAC ATCATGGACCTAACACGCCTGCGCTGCCTGGGCTCGCTCTTCTCC ATGCTGCACCAGGCCTGCCGCAACGTGGCGCAGTATAACGCCAAC CATCCCGACTTCCCCATGCAGATCGAGCAGCTGGAGCGCTACATT CAGCGATATCTGGTTTATGCCATACTCTGGTCCCTGTCTGGAGAC AGCCGGCTAAAAATGAGAGCAGAGCTGGGTGAATACATCAGAAGA ATCACGACCGTGCCTCTGCCCACTGCGCCCAACATACCCATTATC GATTATGAGGTGTCCATCAGCGGAGAATGGTCTCCGTGGCAGGCC AAGGTGCCTCAGATTGAAGTGGAGACGCACAAGGTGGCAGCCCCT GATGTCGTCGTGCCAACGCTGGACACAGTCCGCCACGAAGCCCTC TTGTACACTTGGCTGGCCGAACACAAGCCCCTGGTCTTGTGTGGC CCTCCTGGGTCTGGCAAGACCATGACACTCTTCAGCGCCCTCCGG GCCTTGCCTGACATGGAGGTGGTGGGTCTCAACTTCTCCAGTGCT ACTACTCCAGAGCTGCTTCTGAAGACTTTTGATCACTACTGCGAG TACAGGCGCACACCTAATGGGGTGGTTTTGGCTCCTGTTCAACTT GGAAAGTGGCTGGTGTTGTTCTGTGATGAAATCAACTTGCCAGAT ATGGATAAATATGGGACCCAGAGGGTCATATCCTTCATCAGACAG ATGGTGGAGCACGGAGGCTTTTACCGTACCTCAGATCAAACATGG ■ GTGAAGCTGGAGAGAATCCAGTTTGTTGGGGCTTGTAATCCCCCC ACAGACCCTGGAAGAAAGCCCCTCTCACACAGGTTCCTGCGCCAC GTGCCTGTCGTGTATGTGGATTACCCGGGCCCCGCCTCCCTCACA CAGATCTACGGCACCTTCAACCGCGCCATGCTGAGGCTCATTCCA TCCCTGCGGACGTATGCAGAGCCGCTCACTGCTGCCATGGTGGAG TTCTACACCATGTCTCAGGAGAGATTCACCCAGGATACACAACCT CACTATATCTATTCACCCCGTGAAATGACTAGGTGGGTGAGAGGC ATCTTTGAAGCGCTGAGACCTCTGGAGACCCTGCCTGTTGAAGGC CTCATTCGGATTTGGGCACATGAAGCTCTGCGTCTCTTCCAAGAT AGACTCGTAGAGGATGAGGAGAGGCGTTGGACTGATGAGAACATC GACACGGTTGCTCTGAAGCACTTCCCTAACATCGACAGAGAGAAG GCAATGAGCCGACCCATCTTGTACAGCAACTGGCTGTCAAAGGAT TACATCCCAGTAGACCAAGAAGAGTTAAGAGATTATGTCAAAGCT AGGCTGAAGGTCTTTTATGAAGAAGAACTTGATGTTCCGCTGGTG CTGTTTAATGAAGTCCTAGACCACGTGCTGAGGATTGACAGAATA TTCCGTCAACCTCAAGGCCACTTGCTTCTGATTGGTGTTAGTGGA GCAGGAAAAACTACCCTGTCTCGTTTCGTCGCCTGGATGAACGGT TTGAGTGTGTACCAGATTAAGGTCCATAGGAAGTACACAGGGGAA GACTTTGATGAAGATCTACGGACAGTGTTGAGACGTTCTGGCTGT AAAAATGAAAAGATAGCATTTATAATGGATGAATCTAATGTGT A GATTCTGGATTCCTGGAGCGAATGAATACCCTTCTGGCCAATGGA GAGGTGCCTGGTCTCTTTGAAGGAGACGAGTATGCCACCTTGATG ACGCAGTGCAAAGAGGGGGCACAGAAGGAAGGCCTGATGCTGGAC TCGCACGAGGAGCTCTACAAGTGGTTCACTAGCCAGGTTATCCGC AACCTCCACGTCGTGTTCACCATGAACCCGTCCTCGGAGGGACTC AAGGACCGGGCAGCTACATCACCAGCACTTTTCAACAGGTGTGTG TTGAATTGGTTTGGAGACTGGTCCACCGAAGCACTGTATCAGGTT GGCAAAGAATTCACAAGTAAGATGGATCTGGAGAAGCCAAATTAC ATCGTGCCTGATTACATGCCAGTTGTGTATGATAAGCTGCCGCAG CCACCATCCCATCGGGAAGCCATTGTGAACAGCTGTGTGTTTGTT CATCAGACTCTTCACCAGGCGAATGCTCGGCTAGCAAAGCGAGGC GGCAGAACGATGGCCATCACCCCTCGCCACTACCTGGACTTCATC AATCACTATGCCAACCTGTTCCACGAGAAGCGGAGCGAGCTGGAG GAGCAGCAGATGCACTTGAACGTGGGGCTCAGGAAGATCAAAGAG ACAGTCGACCAGGTAGAAGAACTGCGTCGTGACTTGAGGATAAAG AGCCAAGAGCTGGAGGTGAAGAATGCAGCAGCCAATGACAAGCTG AAAAAGATGGTGAAAGACCAGCAGGAGGCTGAAAAGAAGAAGGTT ATGAGCCAAGAAATCCAGGAACAGCTGCATAAGCAGCAGGAGGTA ATTGCAGACAAACAGATGAGTGTCAAAGAAGATCTTGATAAGGTG GAACCTGCCGTCATTGAGGCCCAGAATGCTGTGAAGTCGATCAAG AAGCAGCACCTGGTGGAGGTGAGGTCCATGGCCAACCCTCCTGCT GCTGTGAAGCTGGCGCTGGAGTCCATCTGCCTGCTGCTGGGGGAA AGCACCACAGACTGGAAGCAGATCCGCTCCATCATCATGCGGGAG AACTTCATCCCCACCATCGTCAACTTCTCTGCAGAGGAGATCAGT GACGCCATAAGGGAGAAGATGAAGAAAAATTACATGTCCAATCCA AGTTACAATTATGAAATTGTGAATCGGGCTTCCCTGGCTTGCGGC CCTATGGTGAAATGGGCAATTGCACAGCTTAACTATGCAGACATG TTAAAGAGAGTGGAGCCCCTACGCAATGAGCTGCAGAAGCTGGAA GATGACGCCAAGGACAACCAGCAGAAGGCCAACGAGGTGGAGCAG ATGATCCGAGACCTGGAAGCCAGCATCGCCCGCTACAAGGAGGAA TACGCCGTCCTGATCTCAGAGGCCCAGGCCATCAAGGCAGACCTG GCAGCTGTCGAGGCAAAAGTAAACCGGAGCACTGCTCTTCTGAAG AGCTTGTCTGCTGAACGTGAACGATGGGAAAAAACAAGTGAAACT TTCAAAAACCAGATGTCCACCATTGCTGGGGACTGTCTCTTGTCA GCTGCGTTCATTGCCTACGCGGGTTACTTTGACCAGCAGATGCGT CAGAACTTGTTCACTACCTGGTCCCATCACCTACAGCAAGCCAAC ATCCAGTTCCGTACAGATATTGCCAGGACGGAATACCTTTCCAAT GCTGATGAGCGTCTTCGCTGGCAGGCCAGCTCCTTGCCTGCTGAT GACCTTTGCACAGAAAATGCCATCATGCTGAAACGATTCAATAGG TATCCGCTGATCATTGACCCCTCTGGACAGGCCACAGAATTCATT ATGAATGAATATAAGGATCGTAAGATCACACGGACCAGCTTCCTG GATGACGCCTTCAGAAAGAACTTAGAGAGTGCACTGAGATTCGGT AACCCCCTTCTGGTCCAGGATGTGGAAAGCTACGATCCAGTTTTG AACCCGGTGCTGAACCGTGAAGTGCGGCGAACAGGGGGGAGAGTG CTGATC CTCTCGGGGACCAGGACATAGACCTGTCGCCATCGTTT GTCATCTTCCTGTCCACCCGGGATCCAACTGTCGAGTTCCCACCA GATCTCTGTTCCCGGGTTACTTTTGTAAACTTCACAGTTACCCGT AGCAGTTTACAAAGCCAGTGTCTAAATGAAGTACTTAAAGCAGAA AGACCTGATGTGGACGAGAAACGATCTGATCTTCTTAAACTTCAA GGGGAATTTCAGCTCCGTTTGCGTCAGCTGGAAAAATCTCTACTA CAAGCTCTGAACGAGGTGAAAGGGCGCATTTTGGATGACGACACG ATCATAACCACTCTGGAGAACCTGAAGAGAGAGGCTGCAGAGGTC ACCAGGAAAGTTGAGGAGACGGACATTGTCATGCAGGAGGTGGAG ACCGTGTCCCAGCAGTACCTCCCGCTCTCCACCGCCTGCAGCAGC ATCTACTTCACCATGGAGTCCCTCAAGCAGATACACTTCTTGTAC CAGTACTCCCTCCAGTTTTTCCTGGACATTTATCACAACGTCCTA TACGAGAACCCGAACCTGAAGGGTGTCACCGACCACACACAGCGC CTGTCCATTATAACAAAGGACCTCTTCCAGGTGGCGTTTAACCGA GTGGCTCGAGGCATGCTGCATCAGGACCACATTACCTTTGCCATG CTGCTGGCAAGAATCAAACTGAAGGGCACCGTGGGGGAGCCCACC TACGATGCAGAATTCCAGCACTTCTTGAGAGGAAATGAGATTGTC CTGAGTGCTGGCTCCACCCCCAGGATCCAGGGCCTGACTGTGGAG CAGGCGGAGGCGGTGGTGAGGCTGAGCTGCCTTCCCGCGTTTAAG GACTTGATTGCAAAGGTTCAGGCAGACGAGCAATTTGGCATCTGG CTGGACAGCAGCTCCCCGGAGCAGACTGTGCCCTACCTCTGGAGT GAAGAAACACCTGCAACACCCATTGGCCAGGCCATCCACCGCCTG CTCCTGATCCAGGCTTTCCGGCCCGATCGCCTGTTGGCCATGGCC CACATGTTTGTTTCAACAAACCTTGGGGAGTCTTTCATGTCCATC ATGGAGCAGCCGCTCGACCTGACCCACATTGTGGGCACAGAGGTG AAGCCCAACACTCCTGTCTTAATGTGCTCTGTGCCTGGTTATGAT GCCAGTGGACATGTCGAGGACCTTGCAGCCGAGCAGAACACGCAG ATCACTTCAATTGCAATCGGCTCTGCAGAAGGCTTTAACCAAGCA GATAAGGCAATAAACACCGCTGTAAAGTCGGGCAGGTGGGTGATG CTGAAGAATGTGCATCTGGCCCCAGGGTGGCTGATGCAGCTGGAG AAGAAGTTGCATTCCCTGCAGCCGCATGCCTGCTTCCGACTCTTC CTCACCATGGAGATCAACCCCAAGGTGCCTGTGAATCTGCTCCGT GCGGGCCGCATCTTTGTGTTCGAGCCACCGCCAGGGGTGAAGGCC AACATGCTGAGGACGTTCAGCAGCATTCCCGTCTCACGGATATGC AAGTCTCCCAACGAGCGTGCCCGCTTGTACTTCCTGCTGGCCTGG TTTCATGCGATCATCCAAGAACGCTTACGATACGCACCACTGGGG TGGTCAAAGAAGTATGAATTTGGAGAGTCTGACCTGCGGTCAGCT TGCGATACGGTGGACACGTGGCTGGATGACACGGCCAAGGGCAGG CAGAACATCTCACCGGATAAGATCCCGTGGTCTGCACTAAAGACC TTAATGGCCCAGTCCATTTATGGCGGGCGCGTGGACAACGAGTTT GACCAGCGTCTGCTCAACACCTTCCTGGAGCGCCTGTTCACAACC AGGAGTTTCGACAGTGAGTTTAAGCTGGCATGCAAGGTCGACGGA CATAAAGACATTCAAATGCCAGATGGCATCAGGCGAGAGGAGTTT GTGCAGTGGGTGGAGTTGCTCCCCGACACCCAGACGCCCTCCTGG CTGGGCCTGCCCAACAACGCCGAGAGAGTCCTCCTTACCACACAG GGTGTGGACATGATCAGTAAAATGCTGAAGATGCAGATGTTGGAG GATGAGGACGACCTGGCCTACGCAGAGACTGAGAAGAAGACGAGG ACAGACTCCACGTCCGACGGGCGCCCTGCCTGGATGCGGACACTG CACACCACCGCGTCCAACTGGCTGCACCTCATCCCCCAGACGCTG AGCCACCTCAAGCGCACCGTGGAGAATATCAAGGATCCTTTGTTC AGGTTCTTTGAGAGAGAAGTGAAGATGGGCGCAAAGCTGCTTCAG GACGTTCGCCAGGACCTTGCAGATGTCGTCCAGGTGTGCGAAGGA AAGAAGAAGCAGACCAACTACTTGCGCACGCTGATCAACGAGCTA GTGAAAGGGATCTTGCCTCGGAGCTGGTCCCACTACACGGTGCCT GCCGGCATGACCGTCATCCAGTGGGTGTCCGACTTCAGCGAGAGG ATCAAACAGCTGCAGAACATCTCACTGGCAGCTGCATCTGGTGGC GCCAAGGAGCTAAAGAACATCCACGTGTGCCTGGGTGGCCTGTTC GTGCCTGAGGCGTACATCACTGCCACCAGGCAGTATGTGGCCCAG GCCAACAGCTGGTCCCTGGAGGAGCTCTGCCTGGAAGTCAACGTC ACCACCTCACAGGGCGCCACCCTTGACGCTTGCAGCTTCGGAGTC ACGGGTTTGAAACTTCAAGGGGCCACGTGCAACAACAACAAGCTG TCACTGTCCAATGCCATCTCAACCGCCCTTCCCCTGACGCAGCTG CGCTGGGTCAAGCAGACAAACACCGAGAAGAAGGCCAGTGTGGTA ACCTTACCTGTCTACCTGAACTTCACCCGTGCAGACCTCATCTTC ACCGTGGACTTCGAAATTGCTACAAAGGAGGATCCTCGCAGCTTC TACGAGCGGGGTGTCGCAGTCTTGTGCACAGAGTAA
Other nucleic acid sequences that are contemplated as within the scope of this invention include sequences that hybridize to the nucleic acid sequences encoding cytoplasmic dynein heavy chainl shown in SEQ ID NOS:l, 3, 5, and 17, other than those known in the prior art (as described above), with at least 75%, preferably at least 80%, more preferably at least 90%, even more preferably 95% and most preferably at least 99% sequence homology to the sequence of SEQ ID NOS: 1, 3, 5, or 17. Additionally, nucleic acid sequences that are degenerate with respect to the foregoing sequences are contemplated.
The nucleic acid sequences encoding cytoplasmic dynein heavy chainl or mutant cytoplasmic dynein heavy chainl of the invention may exist alone or in combination with other nucleic acids as, for example, vector molecules, such as plasmids, including expression or cloning vectors.
The term "nucleic acid sequence" as used herein refers to any contiguous sequence series of nucleotide bases, e.g., a polynucleotide, and may be ribonucleic acid (RNA) or deoxy-ribonucleic acid (DNA). Preferably the nucleic acid sequence is cDNA.
The term "isolated nucleic acid molecule", as utilized herein, refers to a nucleic acid molecule that is separated from other nucleic acid molecules ordinarily present in the natural source of the nucleic acid. Preferably, an "isolated" nucleic acid is free of sequences which naturally flank the nucleic acid (e.g., sequences located at the 5'- and 3'-termini of the nucleic acid) in the genomic DNA of the organism that is the natural (wild type) source of the DNA.
Cytoplasmic dynein heavy chainl molecules can be isolated using standard hybridization and cloning techniques, as described, for instance, in Sambrook et al.
(eds.), Molecular Cloning: A Laboratory Manual (2nd Ed.) (Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, USA, 1989); and Ausubel et al. (eds.), Current Protocols in Molecular Biology (John Wiley & Sons, New York, NY, USA, 1993).
A nucleic acid of the invention can be amplified using cDNA, mRNA or, 5 alternatively, genomic DNA, as a template and appropriate oligonucleotide primers according to standard PCR amplification techniques. The nucleic acid so amplified can be cloned into an appropriate vector and characterized by DNA sequence analysis. Furthermore, oligonucleotides conesponding to cytoplasmic dynein heavy chainl nucleotide sequences can be prepared by standard synthetic techniques, e.g., using an 10 automated DNA synthesizer.
As used herein, the term "oligonucleotide" refers to a series of linked nucleotide residues, which oligonucleotide has a sufficient number of nucleotide bases to be used in a PCR reaction. A short oligonucleotide sequence may be based on, or
15. designed from, a genomic or cDNA sequence and is used to amplify, confirm, or reveal the presence of an identical, similar or complementary DNA or RNA in a particular cell or tissue. Generally, the term "oligonucleotide" is used to refer to a series of continguous nucleotides (a polynucleotide) of about 100 nucleotdies (nt) or less, e.g., portions of a nucleic acid sequence of about 100 nt, 50 nt, or 20 nt in length,
20 preferably nucleotide sequences of about 15 nt to 30 nt in length.
As used herein, the term "complementary" refers to Watson-Crick or Hoogsteen base pairing between nucleotide units of a nucleic acid molecule, and the term "binding" means the physical or chemical interaction between two polypeptides or compounds or associated polypeptides or compounds or combinations thereof.
25
The terms "homologous nucleic acid sequence" or "homologous amino acid sequence," or variations thereof, refer to sequences characterized by a homology at the nucleotide level or amino acid level, respectively. Homologous nucleotide sequences encode those sequences coding for isoforms of cytoplasmic dynein heavy chainl
30 polypeptides. Isoforms can be expressed in different tissues ofthe same organism as a result of, for example, alternative splicing of RNA. Alternatively, isoforms can be encoded by different genes. As used herein, the phrase "stringent hybridization conditions" refers to conditions under which a probe, primer or oligonucleotide will hybridize to its target sequence, but to no other sequences. Stringent conditions are sequence-dependent and will be different in different circumstances. Longer sequences hybridize specifically at higher temperatures than shorter sequences. Generally, stringent conditions are selected to be about 5°C lower than the thermal melting point (Tm) for the specific sequence at a defined ionic strength and pH. The Tm is the temperature (under defined ionic strength, pH and nucleic acid concentration) at which 50% ofthe probes complementary to the target sequence hybridize to the target sequence at equilibrium. Since the target sequences are generally present at excess, at Tm, 50% of the probes are occupied at equilibrium. Typically, stringent conditions will be those in which the salt concentration is less than about 1.0 M sodium ion, typically about 0.01 to 1.0 M sodium ion (or other salts) at pH 7.0 to 8.3, and the temperature is at least about 30°C for short probes, primers or oligonucleotides (e.g., 10 nt to 50 nt) and at least about 60°C for longer probes, primers and oligonucleotides. Stringent conditions may also be achieved with the addition of destabilizing agents, such as formamide. Stringent conditions are known to those skilled in the art and can be found in Ausubel et al. (eds.), Current Protocols in Molecular Biology (John Wiley & Sons, New York, NY, USA, 1989) at 6.3.1-6.3.6. Preferably, the conditions are such that sequences at least about 65%, 70%, 75%, 85%, 90%, 95%, 98%, or 99% homologous to each other typically remain hybridized to each other. A non-limiting example of stringent hybridization conditions are hybridization in a high salt buffer comprising 6X SSC, 50 mM Tris-HCl (pH 7.5), 1 mM EDTA, 0.02% PVP, 0.02% Ficoll, 0.02% BSA, and 500 mg/ml denatured salmon sperm DNA at 65°C, followed by one or more washes in 0.2X SSC, 0.01% BSA at 50°C.
As used herein, the term "ortholog" denotes a polypeptide or protein obtained from one species that is the functional counterpart of a polypeptide or protein from a different species. Sequence differences among orthologs are the result of speciation.
Amino Acids
The present invention also provides murine and human cytoplasmic dynein heavy chainl amino acid sequences (wild type polypeptides and muteins). As used herein, the term "mutein" applies to a protein arising as a result of a mutation. The wild type murine cytoplasmic dynein heavy chainl amino acid sequence is shown in SEQ ID NO:2. A mutated version wherein Tyr at position 1055 has been mutated to a Cys is shown in SEQ ID NO:4. A prefened embodiment is of a human mutein with the same amino acid change at the conesponding position (native Tyr residue to mutant Cys residue at position 1057) in the sequence is shown in SEQ ID NO:6. Another prefened embodiment is the wild type human dynein heavy chein 1 amino acid sequence, as shown in SEQ ID NO: 18.
Table 5. Accession Number AAF91078 (SEQ ID NO:2)
MSEPGGGEDGSAGLEVSAVQNVADVAV QKHLRKLVPLLLEDGGD APAALEAALEEKSALEQMRKFLSDPQVHTVLVERSTLKEDVGDEG EEEKEFISY INIDIHYGVKSNSLAFIKRAPVIDADKPVSSQLRV LTLSEDSPYETLHSFISNAVAPFFKSYIRESGKADRDGDKMAPSV EKKIAELEMGLLHLQQNIEIPEISLPIHPIITNVAKQCYERGEKP KVTDFGDKVEDPTFLNQLQSGVNRWIREIQKVTKLDRDPASGTAL QEISFWLNLERALYRIQEKRESPEVLLTLDILKHGKRFHATVSFD TDTGLKQALETVNDYNPLMKDFPLNDLLSATELDKIRQALVAIFT HLRKIRNTKYPIQRALRLVEAISRDLSSQLLKVLGTRKLMHVAYE EFEKVMVACFEVFQTWDDEYEK QVLLRDIVKRKREENLKMVWRI NPAHRKLQARLDQMRKFRRQHEQLRAVIVRVLRPQVTAVAQQNQG EAPEPQD KVAEVLFDAADANTIEEVN AYENVKEVDGLDVSKEG TEA EAAMKRYDERIDRVETRITARLRDQLGTAKNANEMFRIFSR FNALFVRPHIRGAIREYQTQLIQRVKDDIESLHDKFKVQYPQSQA CKMSHVRDLPPVSGSII AKQIDRQLTAYMKRVEDVLGKGWENHV EGQKLKQDGDSFRMKLNTQEIFDDWARKVQQRNLGVSGRIFTIES ARVRGRTGNVLKLKVNFLPEIITLSKEVRNLK LGFRVPLAIVNK AHQANQLYPFAISLIESVRTYERTCEKVEERNTISLLVAGLKKEV QALIAEGIALVWESYKLDPYVQRLAETVFNFQEKVDDLLIIEEKI DLEVRSLETCMYDHKTFSEILNRVQKAVDDLNLHSYSNLPI VNK DMEIERILGVRLQAGLRAWTQVLLGQAEDKAEVDMDTDAPQVSH
■ KPGGEPKIKNVVHELRITNQVIYLNPPIEECRYKLYQEMFAWKMV
VLSLPRIQSQRYQVGVHYELTEEEKFYRNALTRMPDGPVALEESY
SAVMGIVTEVEQYVKVWLQYQCL D QAE IYNRLGEDLNKWQAL LVQIRKARGTFDNAETKKΞFGPVVIDYGKVQSKVNLKYDSWHKEV LSKFGQMLGSNMTEFHSQISKSRQELEQHSVDTASTSDAVTFITY VQSLKRKIKQFEKQVELYRNGQRLLEKQRFQFPPSWLYIDNIEGE WGAFNDIMRRKDSAIQQQVANLQMKIVQEDRAVESRTTD LTDWE KTKPVTGNLRPEEALQALTIYEGKFGRLKDDREKCAKAKEALELT DTGLLSGSEERVQVALEELQDLKGVWSELSKVWEQIDQMKEQPWV SVQPRKLRQN DGLLNQLKNFPARLRQYASYEFVQRLLKGYMKIN MLVIELKSEALKDRHWKQLMKRLHVNWVVSELTLGQIWDVDLQKN EAVVKDVLLVAQGEMALEEFLKQIREV NTYELDLVNYQNKCRLI RG DDLFNKVKEHINSVSAMKLSPYYKVFEEDALS EDKLNRIMA LFDV IDVQRR VYLEGIFTGSADIKHLLPVETQRFQSISTEFLA LMKKVSKSPLVMDVLNIQGVQRSLERLADLLGKIQKALGEYLERE RSSFPRFYFVGDEDLLEIIGNSKNVAKLQKHFKKMFAGVSSIILN EDNSVVLGISSREGEEVMFKTPVSITEHPKINEWLTLVEKEMRVT LAK LAESVTEVEIFGKATSIDPNTYI IDKYQAQLVVLSAQIA WSENVENALSNVGGGGDVGPLQSVLSNVEVTLNV ADSVL EQPP LRRRKLEHLI ELVHQRDVTRSLIKSKIDNAKSFE LSQMRFYFD PKQTDVLQQLSIQMANAKFNYGFEYLGVQDKLVQTPLTDRCYLTM TQALEARLGGSPFGPAGTGKTESVKALGHQLGRFVLVFNCDETFD FQAMGRIFVGLCQVGA GCFDEFNRLEERMLSAVSQQVQCIQEAL REHSNPNYDK SAPITCELLNKQVKVSPDMAIFITMNPGYAGRSN LPDNLKKLFRSLAMTKPDRQ IAQVMLYSQGFRTAEVLANKIVPF FKLCDEQLSSQSHYDFGLRALKSVLVSAGNVKRERIQKIKREKEE RGEAVDEGEIAENLPEQEI IQSVCETMVPK VAEDIPLLFSLLS DVFPGVQYHRGEMTALREELKKVCQEMYLTYGDGEEVGGMWVEKV LQLYQITQINHGLMMVGPSGSGKSMA RVLLKALERLEGVEGVAH IIDPKAISKDHLYGTLDPNTREWTDGLFTHVLRKIIDNVRGELQK RQWIVFDGDVDPE VENLNSVLDDNKL TLPNGERLSLPPNVRI FEVQDLKYATLATVSRCGMVWFSEDVLSTDMILNNFLARLRSIPL DEGEDEAQRRRKGKEDEGEEAASPMLQIQRDAATIMQPYFTSNGL VTKALEHAFKLEHIMD TRLRCLGSLFSMLHQACRNVAQYNANHP DFP QIEQLERYIQRYLVYAILWSLSGDSRLKMRAELGEYIRRIT TVPLPTAPNVPIIDYEVSISGEWSPWQAKVPQIEVETHKVAAPDV VVPTLDTVRHEALLYT LAEHKPLVLCGPPGSGKTMTLFSALRA PDMEVVGLNFSSATTPELL TFDHYCEYRRTPNGVVLAPVQLGK LVLFCDEINLPDMDKYGTQRVISFIRQMVEHGAFYRTSDQTWVK LERIQFVGACNPPTDPGRKPLSHRFLRHVPVVYVDYPGPASLTQI YGTFNRAMLRLIPSLRTYAEPLTAAMVEFYTMSQERFTQDTQPHY IYSPRE TRWVRGIFEALRPLETLPVEGLIRI AHEALRLFQDRL VEDEERRWTDENIDMVALKHFPNIDKEKAMSRPILYSN LSKDYI PVDQEELRDYVKARLKVFYEEELDVPLVLFNEVLDHVLRIDRIFR QPQGHLLLIGVSGAGKTTLSRFVAWMNGLSVYQIKVHRKYTGEDF DEDLRTVLRRSGCKNEKIAFIMDESNVLDSGFLERMNTLLANGEV PGLFEGDEYATLMTQCKEGAQKEGLMLDSHEELYKWFTSQVIRNL HVVFTMNPSSEGLKDRAATSPALFNRCVLN FGDWSTEALYQVGK EFTSKMDLEKPNYIVPDYMPVVYDKLPQPPTHREAIVNSCVFVHQ TLHQANAR AKRGGRT AITPRHYLDFINHYANLFHEKRSELEEQ QMHLNVGLRKIKETVDQVEE RRDLRIKSQELEVKNAAANDKLKK MVKDQQEAEKKKVMSQEIQEQ HKQQEVIADKQMSVKEDLDKVEP AVIEAQNAVKSIKKQHLVEVRSMANPPAAVKLALESICLLLGEST TDWKQIRSIIMRENFIPTIVNFSAEEISDAIREKMKKNYMSNPSY NYEIVNRASLACGPMVK AIAQLNYADMLKRVEPLRNELQKLEDD AKDNQQKANEVEQMIRDLEASIARYKEEYAVLISEAQAIKADLAA VEAKVNRSTALLKSLSAERERWEKTSETFKNQMSTIAGDCL SAA FIAYAGYFDQQMRQNLFTTWSHHLQQA IQFRTDIARTEYLSNAD ERLRWQASSLPADDLCTENAIMLKRFNRYPLIIDPSGQATEFIMN EYKDRKITRTSFLDDAFRKNLESALRFGNPLLVQDVESYDPVLNP VLNREVRRTGGRVLITLGDQDIDLSPSFVIFLSTRDPTVEFPPDL CSRVTFVNFTVTRSSLQSQCLNEVLKAΞRPDVDEKRSD LKLQGE FQLRLRQLEKSL QALNEVKGRILVDDTIITTLENLKREAAEVTR KVEETDIVMQEVETVSQQYLPLSTACSSIYFT ESLKQVHFLYQY SLQFFLDIYHNVLYENPNLKGATDHTQRLSVITKDLFQVAFNRVA RGMLHQDHITFAMLLARIKLKGTVGEPTYDAEFQHFLRGKEIVLS AGSTPKIQGLTVEQAEAVVRLSCLPAFKDLIAKVQADEQFGIWLD SSSPEQTVPYLWSEETPTTPIGQAIHRLLLIQAFRPDRLLAMAHM FVSTNLGESFMSIMEQPLDLTHIVGTEVKPNTPVLMCSVPGYDAS GHVEDLAAEQNTQITSIAIGSAEGFNQADKAINTAVKSGRWVMLK NVHLAPG L QLEKKLHSLQPHACFRLFLTMEINPKVPVNLLRAG RIFVFEPPPGVKANMLRTFSSIPVSRICKSPNERARLYFLLA FH AIIQERLRYAPLGWSKKYEFGESDLRSACDTVDT LDDTAKGRQN ISPDKIPWSALKTLMAQSIYGGRVDNEFDQR LNTFLERLFTTRS FDSEFKLACKVDGHKDIQMPDGIRREEFVQWVE LPDAQTPS LG LPNNAERVLLTTQGVDMISKM KMQ EDEDDLAYAETEKKARTD STSDGRPA MRT HTTASN LHLIPQTLSPLKRTVENIKDPLFRF FEREVKMGAKLLQDVRQDLADVVQVCEGKKKQTNYLRTLINELVK GILPRS SHYTVPAGMTVIQ VSDFSERIKQLQNISQAAASGGAK ELKNIHVCLGGLFVPEAYITATRQYVAQANS SLEELCLEVNVTA SQSATLDACSFGVTGLKLQGATCSNNK SLSNAISTV P TQLRW VKQTSAEKKASVVTLPVYLNFTRADLIFTVDFEIATKEDPRSFYE RGVAVLCTE
Table 6. Mutated murine cytoplasmic dynein heavy chainl amino acid sequence (SEQ ID NO.4)
MSEPGGGEDGSAGLEVSAVQNVADVAVLQKHLRKLVPLLLEDGGD APAALEAALEEKSALEQMRKFLSDPQVHTVLVERSTLKEDVGDEG EEEKEFISYNINIDIHYGVKSNSLAFIKRAPVIDADKPVSSQLRV LTLSEDSPYETLHSFISNAVAPFFKSYIRESGKADRDGDK APSV EKKIAE EMGLLHLQQNIEIPEISLPIHPIITNVAKQCYERGEKP KVTDFGDKVEDPTFLNQLQSGVNRWIREIQKVTKLDRDPASGTAL QEISFW NLERALYRIQEKRESPEVLLTLDILKHGKRFHATVSFD TDTGLKQALETVNDYNPLMKDFPLNDLLSATELDKIRQALVAIFT HLRKIRNTKYPIQRALRLVEAISRDLSSQLLKVLGTRKLMHVAYE EFEKVMVACFEVFQTWDDEYEKLQV LRDIVKRKREENLKMVWRI NPAHRKLQARLDQMRKFRRQHEQLRAVIVRVLRPQVTAVAQQNQG EAPEPQDMKVAEVLFDAADAN IEEVN AYENVKEVDGLDVSKEG TEA EAAMKRYDERIDRVETRITARLRDQLGTAKNANEMFRIFSR FNALFVRPHIRGAIREYQTQLIQRVKDDIESLHDKFKVQYPQSQA . CK SHVRDLPPVSGSIIWAKQIDRQLTAYMKRVEDV GKG ENHV EGQK KQDGDSFRMKLNTQEIFDDWARKVQQRN GVSGRIFTIES ARVRGRTGNV KLKVNFLPEIITLSKEVRNLKWLGFRVPLAIVNK AHQANQLYPFAISLIESVRTYERTCEKVEERNTISLLVAGLKKEV QALIAEGIALVWESYKLDPYVQRLAETVFNFQEKVDDL IIEEKI D EVRSLETCMYDHKTFSEILNRVQKAVDDLNLHSYSNLPIWVNK LDMEIERILGVRLQAGLRAWTQVLLGQAEDKAEVD DTDAPQVSH KPGGEPKIKNVVHELRITNQVIYLNPPIEECRYKLYQEMFAWKMV VLSLPRIQSQRYQVGVHYELTEEEKFYRNALTRMPDGPVALEESY SAV GIVTEVEQYVKVWLQgQCL D QAE IYNRLGED NKWQAL LVQIRKARGTFDNAETKKEFGPVVIDYGKVQSKVNLKYDS HKEV SKFGQMLGSNMTEFHSQISKSRQELEQHSVDTASTSDAVTFITY VQSLKRKIKQFEKQVELYRMGQRLLEKQRFQFPPS LYIDNIEGE WGAFNDIMRRKDSAIQQQVANLQMKIVQEDRAVESRTTDLLTDWE KTKPVTGNLRPEEALQALTIYEGKFGRLKDDREKCAKAKEA ELT DTGL SGSEERVQVALEELQDLKGVWSELSKVWEQIDQMKEQPWV SVQPRKLRQNLDGLLNQLKNFPARLRQYASYEFVQRLLKGYMKIN MLVIELKSEALKDRHWKQLMKRLHVNWVVSELTLGQIWDVDLQKN EAVVKDVLLVAQGEMALEEFLKQIREV NTYELDLVNYQNKCRLI RGWDDLFNKVKEHINSVSAMKLSPYYKVFEEDALS EDKLNRIMA LFDV IDVQRR VYLEGIFTGSADIKH LPVETQRFQSISTEFLA LMKKVSKSPLVMDVL IQGVQRSLERLADLLGKIQKALGEYLERE RSSFPRFYFVGDEDLLEIIGNSKNVAKLQKHFKKMFAGVSSIILN EDNSVVLGISSREGEEVMFKTPVSITEHPKINEWLTLVEKEMRVT LAKL AESVTEVEIFGKATS1DPNTYITWIDKYQAQLVVLSAQIA SENVENALSNVGGGGDVGPLQSVLSNVEVTLNVLADSVLMEQPP LRRRKLEHLITELVHQRDVTRSLIKSKIDNAKSFEWLSQMRFYFD PKQTDVLQQ SIQMANAKFNYGFEYLGVQDKLVQTPL DRCYLTM TQALEARLGGSPFGPAGTGKTESVKALGHQLGRFVLVFNCDETFD FQAMGRIFVGLCQVGA GCFDEFNR EER LSAVSQQVQCIQEAL REHSNPNYDKTSA ITCE LNKQVKVSPDMAIFITMNPGYAGRSN LPDNLKKLFRSLAMTKPDRQLIAQVMLYSQGFRTAEVLANKIVPF FKLCDEQLSSQSHYDFGLRALKSVLVSAGNVKRERIQKIKREKEE RGEAVDEGEIAENLPEQEI IQSVCETMVPKLVAEDIPLLFSLLS DVFPGVQYHRGEMTALREELKKVCQEMY TYGDGEEVGGM VEKV LQLYQITQINHGLMMVGPSGSGKSMAWRVLLKALERLEGVEGVAH IIDPKAISKDHLYGTLDPNTREWTDGLFTHVLRKIIDNVRGELQK RQWIVFDGDVDPE VENLNSVLDDNKLLTLPNGERLSLPPNVRIM FEVQDLKYATLATVSRCGMVWFSEDVLSTDMILNNFLARLRSIPL DEGEDEAQRRRKGKEDEGEEAASPMLQIQRDAATIMQPYFTSNGL VTKALEHAFKLEHIMDLTRLRCLGS FS LHQACRNVAQYNANHP DFPMQIEQLERYIQRYLVYAIL SLSGDSRLKMRAELGEYIRRIT TVPLPTAPNVPIIDYEVSISGEWSP QAKVPQIEVETHKVAAPDV VVPTLDTVRHEALLYTWLAEHKPLVLCGPPGSGKTMTLFSALRAL PDMEVVGLNFSSATTPELLLKTFDHYCEYRRTPNGVVLAPVQLGK WLVLFCDEINLPDMDKYGTQRVISFIRQMVEHGAFYRTSDQT VK LERIQFVGACNPPTDPGRKPLSHRFLRHVPVVYVDYPGPASLTQI YGTFNRAMLRLIPSLRTYAEPLTAAMVEFYTMSQERFTQDTQPHY IYSPREMTRWVRGIFEALRPLETLPVEGLIRIWAHEALRLFQDRL VEDEERRWTDENIDMVA KHFP IDKEKAMSRPILYSN LSKDYI PVDQEELRDYVKARLKVFYEEELDVPLV FNEVLDHVLRIDRIFR QPQGHLLLIGVSGAGKTTLSRFVAW NGLSVYQIKVHRKYTGEDF DEDLRTVLRRSGCKNEKIAFIMDESNVLDSGFLERMNTL ANGEV PGLFEGDEYATLMTQCKEGAQKEGLMLDSHEELYK FTSQVIRNL HVVFTMNPSSEGLKDRAATSPALFNRCVLNWFGDWSTEALYQVGK EFTSKMDLEKPNYIVPDYMPVVYDKLPQPPTHREAIVNSCVFVHQ TLHQANARLAKRGGRTMAITPRHYLDFINHYANLFHEKRSELEEQ QMHLNVGLRKIKETVDQVEELRRDLRIKSQELEVKNAAANDKLKK MVKDQQEAEKKKVMSQEIQEQLHKQQEVIADKQMSVKEDLDKVEP AVIEAQNAVKSIKKQHLVEVRSMANPPAAVKLALESICLLLGEST TDWKQIRSIIMRENFIPTIVNFSAEEISDAIREKMKKNYMS PSY NYEIVNRASLACGPMVKWAIAQLNYADMLKRVEPLRNELQKLEDD AKDNQQKANEVEQMIRDLEASIARYKEEYAVLISEAQAIKADLAA VEAKVNRSTALLKSLSAERERWEKTSETFKNQMSTIAGDCLLSAA FIAYAGYFDQQMRQNLFTTWSHHLQQANIQFRTDIARTEYLSNAD ERLRWQASSLPADDLCTENAIMLKRFNRYPLIIDPSGQATEFI N EYKDRKITRTSFLDDAFRKNLESALRFGNPLLVQDVESYDPVLNP VLNREVRRTGGRVLITLGDQDIDLSPSFVIFLSTRDPTVEFPPDL CSRVTFVNFTVTRSSLQSQCLNΞVLKAERPDVDEKRSDLLKLQGE FQLRLRQLEKSLLQALNEVKGRILVDDTIITTLENLKREAAEVTR KVEETDIVMQEVETVSQQYLPLSTACSSIYFTMESLKQVHFLYQY SLQFFLDIYHNVLYENPNLKGATDHTQRLSVITKDLFQVAFNRVA RGMLHQDHITFAMLLARIKLKGTVGEPTYDAEFQHFLRGKEIVLS AGSTPKIQGLTVEQAEAVVRLSCLPAFKDLIAKVQADEQFGI LD SSSPEQTVPYLWSEETPTTPIGQAIHRLLLIQAFRPDRLLAMAHM FVSTNLGESFMSI EQPLDLTHIVGTEVKPNTPVLMCSVPGYDAS GHVEDLAAEQNTQITSIAIGSAEGFNQADKAINTAVKSGRWVMLK NVHLAPG LMQLEKKLHSLQPHACFRLFLTMEINPKVPVNLLRAG RIFVFEPPPGVKANMLRTFSSIPVSRICKSPNERARLYFLLAWFH AIIQERLRYAPLGWSKKYEFGESDLRSACDTVDT LDDTAKGRQN ISPDKIP SALKTLMAQSIYGGRVDNEFDQRLLNTFLERLFTTRS FDSEFKLACKVDGHKDIQMPDGIRREEFVQWVΞLLPDAQTPSWLG LPNNAERVLLTTQGVDMISKML MQMLEDEDDLAYAETEKKARTD STSDGRPA MRTLHTTASNWLHLIPQTLSPLKRTVENIKDPLFRF FEREVKMGAKLLQDVRQDLADVVQVCEGKKKQTNYLRTLINELVK GILPRS SHYTVPAGMT¥IQ VSDFSERIKQLQNISQAAASGGAK ELKNIHVCLGGLFVPEAYITATRQY¥AQANSWSLEELCLEVNVTA SQSATLDACSFGVTGLKLQGATCSNNKLSLSNAISTVLPLTQLR ¥KQTSAEKKASVVTLPVYLNFTRADLIFTVDFEIATKEDPRSFYE RGVAVLCTE
Table 7. Mutated human cytoplasmic dynein heavy chainl amino acid sequence (SEQ ID NO:6)
MSEPGGGGGEDGSAG EVSAVQNVADVSVLQKHLRKLVPLLLEDGGEAP AALEAALEEKSALEQMRKFLSDPQVHTVLVERSTLKEDVGDEGEEEKEF ISYNI IDIHYGVKSNSLAFIKRTPVIDADKPVSSQLRVLTLSEDSPYE TLHSFISNAVAPFFKSYIRESGKADRDGDKMAPSVEKKIAELEMGLLHL QQNIEIPEISLP1HPMITNVAKQCYERGEKPKVTDFGDKVEDPTFLNQL QSGVNRWIREIQKVTKLDRDPASGTALQEISFWLNLERALYRIQEKRES PEVLL,TLDILKHGKRFH TVSFDTDTGLKQALETVNDYNP MKDFPLND LLSATELDKIRQALVAIFTHLRKIRNTKYPIQRALRLVEAISRDLSSQL LKVLGTRKLMHVAYEEFEKVMVACFEVFQT DDEYEKLQVLLRDIVKRK REENLKMVWRINPAHRKLQARLDQMRKFRRQHEQLRAVIVRVLRPQVT VAQQNQGEVPEPQDMKVAEVLFDAADANAIEEVNLAYENVKEVDGLDVS KEGTEA EAAMKRYDERIDRVETRITARLRDQLGTAKNANEMFRIFSRF NALFVRPHIRGAIREYQTQLIQRVKDDIESLHDKFKVQYPQSQACKMSH VRDLPPVSGSII AKQIDRQLTAYMKRVEDVLGKG ENHVEGQKLKQDG DSFRMKLNTQEIFDDWARKVQQRNLGVSGRIFTIESTRVRGRTGNVLKL KVNFLPEIITLSKEVRNLK LGFRVPLAIVNKAHQANQLYPFAISLIES VRTYERTCEKVEERNTISLLVAGLKKEVQALIAEGI LVWESYKLDPYV QRLAETVFNFQEKVDDLLIIEEKIDLEVRSLETCMYDHKTFSEILNRVQ KAVDDLNLHSYSNLPIWVNKLDMEIERILGVRLQAGLRA TQVLLGQAE DKAEVDMDTDAPQVSHKPGGEPKIKNVVHELRITNQVIYLNPPIEECRY KLYQEMFA KMVVLSLPRIQSQRYQVGVHYELTEEEKFYR ALTRMPDG PVALEESYSAVMGIVSEVEQYVKVWLQ&QCLWDMQAENIYNRLGEDLNK QALLVQIRKARGTFDNAETKKEFGPVVIDYGKVQSKVNLKYDS HKEV LSKFGQMLGSNMTEFHSQISKSRQELEQHSVDTASTSDAVTFITYVQSL KRKIKQFEKQVE YRNGQRLLEKQRFQFPPS LYID IEGE GAFNDIM RRKDSAIQQQVANLQMKIVQEDRAVESRTTDLLTDWEKTKPVTGNLRPE EALQALTIYEGKFGRLKDDREKCAKAKEALELTDTGLLSGSEERVQVAL EELQDLKGVWSELSKVWEQIDQMKEQPWVSVQPRKLRQNLDALLNQLKS FPARLRQYASYEFVQRLLKGYMKINM VIELKSEALKDRH KQLMKRLH VNWVVSELTLGQI DVDLQKNEAIVKDVLLVAQGEMALEEFLKQIREVW NTYELDLVNYQNKCRLIRGWDDLFNKVKEHINSVSAMKLSPYYKVFEED ALS EDKLNRIMALFDV IDVQRRWVYLEGIFTGS DIKHL PVETQRF QSISTEFLALMKKVSKSPLVMDVLNIQGVQRSLERLADLLGKIQKALGE YLERERSSFPRFYFVGDEDLLEIIGNSKNVAKLQKHFKKMFAGVSSIIL NEDNSVVLGISSREGEEVMFKTPVSITEHPKINEWLTLVEKEMRVTLAK LLAESVTEVEIFGKATSIDPNTYIT IDKYQAQLVVLSAQIA SENVET ALSSMGGGGDAAPLHSV SNVEVTLNVLADSVLMEQPPLRRRK EHLIT ELVHQRDVTRSLIKSKIDNAKSFEWLSQMRFYFDPKQTDVLQQLSIQMA NAKFNYGFEYLGVQDKLVQTPLTDRCYLTMTQALEARLGGSPFGPAGTG KTESVKALGHQLGRFVLVFNCDETFDFQAMGRIFVGLCQVGAWGCFDEF NRLEERMLSAVSQQVQCIQEALREHSNPNYDKTSAPITCELLNKQVKVS PDMAIFI MNPGYAGRSNLPDNLKKLFRSLAMTKPDRQLIAQVMLYSQG FRTAEVLANKIVPFFKLCDEQLSSQSHYDFGLRALKSVLVSAGNVKRER IQKIKREKEERGEAVDEGEIAENLPEQEILIQSVCETMVPKLVAEDIPL LFSLLSDVFPGVQYHRGEMTALREELKKVCQEMYLTYGDGEEVGGM VE KVL LYQITQINHGLMMVGPSGSGKSMA RVLLKALERLEGVEGVAHII DPKAISKDHLYGTLDPNTREWTDGLFTHVLRKIIDSVRGELQKRQWIVF DGDVDPEWVENLNSV DDNK LTLPNGERLSLPPNVRIMFEVQDLKYAT LATVSRCGMV FSEDVLSTDMIFNNFLARLRSIPLDEGEDEAQRRRKGK EDEGEEAASPMLQIQRDAATIMQPYFTSNGLVTKALEHAFQLEHIMDLT RLRCLGSLFSMLHQACRNVAQYNANHPDFPMQIEQLERYIQRYLVYAIL WSLSGDSRLKMRAELGEYIRRITTVPLPTAPNIPIIDYEVSISGE SPW QAKVPQIEVETHKVAAPDWVPT DTVRHEALLYT LAEHKPLVLCGPP GSGKTMTLFSALRALPDMEVVGLNFSSATTPELLLKTFDHYCEYRRTPN GVVLAPVQLGKWLVLFCDEINLPDMDKYGTQRVISFIRQMVEHGGFYRT SDQTWVKLERIQFVGACNPPTDPGRKPLSHRFLRHVPVVYVDYPGPASL TQIYGTFNRAMLRLIPSLRTYAEPLTAAMVEFYTMSQERFTQDTQPHYI YSPREMTRWVRGIFEALRPLETLPVEGLIRI AHEALRLFQDRLVEDEE RR TDENIDTVALKHFPNIDREKAMSRPILYSN LSKDYIPVDQEELRD YVKARLKVFYEEELDVPLVLFNEVLDHVLRIDRIFRQPQGHLLLIGVSG AGKTTLSRFVAWMNGLSVYQIKVHRKYTGEDFDEDLRTVLRRSGCKNEK IAFIMDESNVLDSGFLERMNTLLANGEVPGLFEGDEYATLMTQCKEGAQ KEGLMLDSHEELYK FTSQVIRNLHVVFTMNPSSEGLKDRAATSPALFN RCVLNWFGD STEALYQVGKEFTSKMDLEKPNYIVPDYMPVVYDKLPQP PSHREAIVNSCVFVHQTLHQANARLAKRGGRTMAITPRHYLDFINHYAN LFHEKRSELEEQQMHLNVGLRKIKETVDQVEELRRDLRIKSQELEVKNA AANDKLKKMVKDQQEAEKKKVMSQEIQEQLHKQQEVIADKQMSVKEDLD KVEPAVIEAQNAVKSIKKQHLVEVRSMANPPAAVKLALESICLLLGEST TD KQIRSIIMRENFIPTIVNFSAEEISDAIREKMKKNYMSNPSYNYEI VNRASLACGPMVK AIAQLNYADMLKRVEPLRNELQKLEDDAKDNQQKA NEVEQMIRDLEASIARYKEEYAVLISEAQAIKADLAAVEAKVNRSTALL KSLSAERERWEKTSETFKNQMSTIAGDCLLSAAFIAYAGYFD QMRQNL FTT SHHLQQA IQFRTDIARTEYLSNADERLR QASSLPADDLCTENA IMLKRFNRYPLIIDPSGQATEFIMNEYKDRKITRTSFLDDAFRKNLESA LRFGNPLLVQDVESYDPVLNPVLNREVRRTGGRVLITLGDQDIDLSPSF VIFLSTRDPTVEFPPDLCSRVTFVNFTVTRSSLQSQCLNEVLKAERPDV DEKRSDLLKLQGEFQLRLRQLEKSLLQALNEVKGRILDDDTIITTLENL KREAAEVTRKVEETDIVMQEVETVSQQYLPLSTACSSIYFTMESLKQIH FLYQYSLQFFLDIYHNVLYENPNLKGVTDHTQRLSIITKDLFQVAFNRV ARGMLHQDHITFAMLLARIKLKGTVGEPTYDAEFQHFLRGNEIVLSAGS TPRIQGLTVEQAEAVVRLSCLPAFKDLIAKVQADEQFGIWLDSSSPEQT VPYL SEETPATPIGQAIHRLL IQAFRPDRLLAMAHMFVSTNLGESFM SIMEQPLDLTHIVGTEVKPNTPVLMCSVPGYDASGHVEDLAAEQNTQIT SIAIGSAEGFNQADKAINTAVKSGR VMLKNVHLAPG LMQLEKKLHSL QPHACFRLFLTMEINPKVPVNLLRAGRIFVFEPPPGVKANMLRTFSSIP
VSRICKSPNERARLYFLLA FHAIIQERLRYAPLGWSKKYEFGESDLRS
ACDTVDTWLDDTAKGRQNISPDKIP SALKTLMAQSIYGGRVDNEFDQR
LLNTFLERLFTTRSFDSEFKLACKVDGHKDIQMPDGIRREEFVQWVELL
, PDTQTPS LGLPNNAERVLLTTQGVDMISKMLKMQMLEDEDDLAYAETE KKTRTDSTSDGRPA MRTLHTTASN LHLIPQTLSHLKRTVENIKDPLF RFFEREVKMGAKLLQDVRQDLADVVQVCEGKKKQTNYLRTLINELVKGI LPRSWSHYTVPAGMTVIQWVSDFSERIKQLQNISLAAASGGAKELKNIH VCLGGLFVPEAYITATRQYVAQANS SLEELCLEVNVTTSQGATLDACS FGVTGLKLQGATCNNNKLSLSNAISTALPLTQLRWVKQTNTEKKASVVT LPVYLNFTRADLIFTVDFEIATKEDPRSFYERGVAVLCTE
Table 8. Wild type human cytoplasmic dynein heavy chainl amino acid sequence (SEQ ID NO: 18) MSEPGGGGGEDGSAGLEVSAVQN¥ADVSVLQKHLRKLVPLLLEDG GEAPAALEAALEEKSALEQMRKFLSDPQVHTVLVERSTLKEDVGD EGEEEKEFISYNINIDIHYGVKSNSLAFI'KRTPVIDADKPVSSQL RVLTLSEDSPYETLHSFISNAVAPFFKSYIRESGKADRDGDKMAP SVEKKIAELE GLLHLQQNIEIPEISLPIHPMITNVAKQCYERGE KPK¥TDFGDKVEDPTFLNQLQSGVNRWIREIQKVTKLDRDPASGT ALQEISFWLNLERALYRIQEKRESPEVLLTLDILKHGKRFHATVS FDTDTGLKQALETVNDYNPLMKDFPLNDLLSATELDKIRQAL¥AI FTHLRKIRNTKYPIQRALRLVEAISRDLSSQLLKVLGTRKLMHVA YEEFEKVM¥ACFE¥FQT DDEYEKLQVLLRDIVKRKREENLK VW RINPAHRKLQARLDQMRKFRRQHEQLRA¥IVRVLRPQVTAVAQQN QGEVPEPQDMK¥AE¥LFDAADANAIEEVNLAYENVKEVDGLDVSK EGTEAWEAAMKRYDERIDRVETRITARLRDQLGTAKNANEMFRIF SRFNALF¥RPHIRGAIREYQTQLIQRVKDDIESLHDKFKVQYPQS QACK SHVRDLPP¥SGSIIWAKQIDRQLTAYMKRVEDVLGKG EN HVEGQKLKQDGDSFRMKLNTQEIFDD ARKVQQRNLGVSGRIFTI ESTR¥RGRTGN¥LKLKVNFLPEIITLSKEVRNLKWLGFRVPLAIV NKAHQANQLYPFAISLIESVRTYERTCEK¥EERNTISLLVAGLKK EVQALIAEGIALV ESYKLDPYVQRLAETVFNFQEKVDDLLIIEE KIDLEVRSLETCMYDHKTFSEILNR¥QKA¥DDLNLHSYSNLPIWV NKLDMEIERILGVRLQAGLRA TQVLLGQAEDKAEVDMDTDAPQV SHKPGGEPKIKNV¥HELRITNQVIYLNP IEECRYKLYQEMFAWK MVVLSLPRIQSQRYQVGVHYELTEEEKFYRNALTRMPDGPVALEE SYSAVMGIVSEVEQY¥KVWLQYQCL D QAENIYNRLGEDLNK Q ALLVQIRKARGTFDNAETKKEFGPVVIDYGKVQSKVNLKYDS HK EVLSKFGQMLGSNMTΞFHSQISKSRQELEQHSVDTASTSDAVTFI TYVQSLKRKIKQFEKQVELYRNGQRLLEKQRFQFPPS LYIDNIE GE GAFNDIMRRKDSAIQQQVANLQMKIVQEDRAVESRTTDLLTD WEKTKP¥TGNLRPEEALQALTIYEGKFGRLKDDREKCAKAKEALE LTDTGLLSGSEER¥QVALEELQDLKG¥WSELSKVWEQIDQMKEQP WVSVQPRKLRQNLDALLNQLKSFPARLRQYASYEFVQRLLKGYMK INMLVIELKSEALKDRHWKQLMKRLHVN ¥¥SELTLGQI DVDLQ KNEAI¥KDVLL¥AQGEMALEEFLKQIREV NTYELDLVNYQNKCR LIRGWDDLFNKVKEHINSVSAMKLSPYYKVFEEDALS EDKLNRI MALFDV IDVQRRW¥YLEGIFTGSADIKHLLP¥ETQRFQSISTEF LALMKKVSKSPLVMDVLNIQGVQRSLERLADLLGKIQKALGEYLE RERSSFPRFYFVGDEDLLEIIGNSKNVAKLQKHFKKMFAGVSSII LNEDNSV¥LGISSREGEEVMFKTPVSITEHPKINE LTLVEKEMR VTLAKLLAESVTE¥EIFGKATSIDPNTYIT IDKYQAQLVVLSAQ IA SENVETALSSMGGGGDAAPLHSVLSN¥EVTLNVLADSVLMEQ PPLRRRKLEHLITELVHQRDVTRSLIKSKIDNAKSFEWLSQMRFY FDPKQTDVLQQLSIQ ANAKFNYGFEYLGVQDKLVQTPLTDRCYL TMTQALEARLGGSPFGPAGTGKTESVKALGHQLGRFVLVFNCDET FDFQAMGRIFVGLCQVGAWGCFDEFNRLEERMLSA¥SQQ¥QCIQE ALREHSNPNYDKTSAPITCELLNKQ¥KVSPDMAIFITMNPGYAGR SNLPDNLKKLFRSLAMTKPDRQLIAQVMLYSQGFRTAEVLANKIV PFFKLCDEQLSSQSHYDFGLRALKSVLVSAGN¥KRERIQKIKREK EERGEAVDEGEIAENLPEQEILIQS¥CETMVPKLVAEDIPLLFSL LSDVFPGVQYHRGEMTALREELKKVCQE YLTYGDGEEVGGMWVΞ KVLQLYQI QINHGLMMVGPSGSGKSMAWR¥LLKALERLEGVEGV AHIIDPKAISKDHLYGTLDPNTREWTDGLFTHVLRKIIDSVRGEL QKRQWIVFDGDVDPE VENLNSVLDDNKLLTLPNGERLSLPPNVR IMFEVQDLKYATLATVSRCGMVWFSED¥LSTDMIFNNFLARLRSI PLDEGEDEAQRRRKGKEDEGEEAASPMLQIQRDAATIMQPYFTSN GLVTKALEHAFQLEHIMDLTRLRCLGSLFSMLHQACRNVAQYNAN HPDFPMQIEQLERYIQRYLVYAIL SLSGDSRLKMRAELGEYIRR ITT¥PLPTAPNIPIIDYEVSISGEWSPWQAKVPQIEVETHKVAAP DVV¥PTLDTVRHEALLYT LAEHKPL¥LCGPPGSGKTMTLFSALR ALPD EVVGLNFSSATTPELLLKTFDHYCEYRRTPNGVVLAPVQL GKWLVLFCDEI LPDMDKYGTQRVISFIRQMVEHGGFYRTSDQTW VKLERIQFVGACNPPTDPGRKPLSHRFLRH¥P¥¥Y¥DYPGPASLT QIYGTFNRA LRLIPSLRTYAEPLTAAMVEFYTMSQERFTQDTQP HYIYSPREMTRWVRGIFEALRPLETLPVEGLIRIWAHEALRLFQD RLVEDEERR TDENIDTVALKHFPNIDREKAMSRPI YSN LSKD YIPVDQEELRDYVKARLKVFYEEELDVPLVLFNEVLDHVLRIDRI FRQPQGHLLLIGVSGAGKTTLSRFVAWMNGLSVYQIK¥HRKYTGE DFDEDLRTVLRRSGCKNEKIAFIMDESNVLDSGFLERMNTLLANG EVPGLFEGDEYATLMTQCKEGAQKEGLMLDSHEELYK FTSQVIR NLHVVFTMNPSSEGLKDRAATSPALFNRCVLNWFGDWSTEALYQV GKEFTSKMDLEKPNYIVPDYMP¥VYDKLPQPPSHREAIVNSC¥FV HQTLHQANARLAKRGGRTMAITPRHYLDFINHYANLFHEKRSELE EQQMHLNVGLRKIKETVDQVEELRRDLRIKSQELEVKNAAANDKL KKMVKDQQEAEKKKVMSQEIQEQLHKQQEVIADKQMS¥KEDLDKV EPAVIEAQNAVKSIKKQHLVEVRSMANPPAAVKLALESICLLLGE STTDWKQIRSIIMRENFIPTIVNFSAEEISDAIREKMKKNYMSNP SY YEIVNRASLACGPMVKWAIAQLNYADMLKRVEPLRNELQKLE DDAKDNQQKANEVEQMIRDLEASIARYKEEYAVLISEAQAIKADL ' AAVEAKVNRSTALLKSLSAERER EKTSETFKNQMSTIAGDCLLS AAFIAYAGYFDQQMRQNLFTTWSHHLQQANIQFRTDIARTEYLSN ADERLRWQASSLPADDLCTENAIMLKRFNRYPLIIDPSGQATEFI NEYKDRKITRTSFLDDAFRKNLESALRFGNPLLVQDVESYDPVL NPVLNREVRRTGGR¥LITLGDQDIDLSPSFVIFLSTRDPTVEFPP DLCSRVTFVNFTVTRSSLQSQCLNEVLKAERPDVDEKRSDLLKLQ GEFQLRLRQLEKSLLQALNEVKGRILDDDTIITTLENLKREAAEV TRKVEETDI¥MQEVETVSQQYLPLSTACSSIYFTMESLKQIHFLY QYSLQFFLDIYHNVLYENPNLKGVTDHTQRLSIITKDLFQVAFNR VARGMLHQDHITFAMLLARIKLKGTVGEPTYDAEFQHFLRGNEIV LSAGSTPRIQGLTVEQAEAVVRLSCLPAFKDLIAK¥QADEQFGIW LDSSSPEQT¥PYL SEETPATPIGQAIHRLLLIQAFRPDRLLAMA HMFVSTNLGESFMSIMEQPLDLTHIVGTEVKPNTP¥LMCSVPGYD ASGHVEDLAAEQNTQITSIAIGSAEGFNQADKAINTA¥KSGRWVM LKNVHLAPGWLMQLEKKLHSLQPHACFRLFLTMEINPKVPVNLLR AGRIFVFEPPPGVKANMLRTFSSIPVSRICKSPNERARLYFLLA FHAIIQERLRYAPLGWSKKYEFGESDLRSACDT¥DT LDDTAKGR QNISPDKIP SALKTLMAQSIYGGRVDNEFDQRLLNTFLERLFTT RSFDSEFKLACKVDGHKDIQMPDGIRREEFVQWVELLPDTQTPSW LGLPNNAER¥LLTTQGVDMISKMLKMQMLEDEDDLAYAETEKKTR TDSTSDGRPAW RTLHTTASNWLHLIPQTLSHLKRTVE IKDPLF RFFEREVKMGAKLLQDVRQDLADVVQVCEGKKKQTNYLRTLINEL VKGILPRS SHYTVPAGMTVIQ VSDFSERIKQLQNISLAAASGG AKELK IHVCLGGLFVPEAYITATRQYVAQANSWSLEELCLEVNV TTSQGATLDACSFG¥TGLKLQGATCNNNKLSLSNAISTALPLTQL RWVKQTNTEKKAS¥¥TLP¥YLNFTRADLIFTVDFEIATKEDPRSF YERGVAVLCTE
Preferably, the wild type residue of the modified human cytoplasmic dynein heavy chainl protein is replaced by an amino acid with different size and/or polarity, e.g., a non-conservative amino acid substitution.
Preferably, residue 1055 of murine cytoplasmic dynein heavy chainl and residue 1057 of human cytoplasmic dynein heavy chainl according to the present invention is replaced by an amino acid other than Trp or Phe and preferably is replaced by an amino acid selected from Ala, Ser, Thr, Pro, Gly, Met, Leu, He, Nal, or Cys, more preferably by Met, Leu, He, Nal, or Cys, and most preferably by Cys.
In a most prefened embodiment the murine cytoplasmic dynein heavy chainl mutein of the present invention has the amino acid sequence shown in SEQ ID ΝO:4. In another prefened embodiment the human cytoplasmic dynein heavy chainl mutein ofthe present invention has the amino acid sequence shown in SEQ ID NO:6.
The present invention is not limited to muteins with a mutation of the residue at, e.g., position 1055 of the amino acid sequence shown in SEQ ID NO: 4, and it is not limited to the mutation of the residue at, e.g., position 1057 of the amino acid sequence shown in SEQ ID NO: 6 or at a conesponding position in other dynein heavy chain proteins (especially cytoplasmic dynein heavy chainl proteins from different species). Rather it encompasses additional muteins with modifications in the amino acid sequence of the mouse or human cytoplasmic dynein heavy chainl proteins as long as they impart a phenotype as described herein in connection with the animals. Such muteins, may comprise mutations, such as single or multiple further amino acid substitutions, deletions and insertions.
One embodiment of the invention relates to muteins wherein the amino acid residue affected by the mutation, e.g., a substimtion, deletion, or insertion, conesponds to a residue selected from the group of conserved amino acid residues between Leu302 (302L) and Phe 1140 (1140F) of the cytoplasmic dynein heavy chainl amino acid sequence, e.g., SEQ ID NO:2 (Mus musculus) specified in Table 19. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 302L.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 303K.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 305G.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 306K.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 307R. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 308F.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 309H. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 310A.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 31 IT.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 312N.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 314F.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 315D. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 317D.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 319G.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 320L.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 321K.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 322Q. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 324L.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 327N.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 329D.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 330 Y.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 33 IN. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 333L.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 334M. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 335K.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 337F.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 338P.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 342L.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 344S. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 345 A.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 346T.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 35 OK.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 354 A.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 3581. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 359F.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 361H.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 362L.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 363R.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 364K. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 366R.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 368T. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 369K.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 370Y.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 371P.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 373Q.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 374R. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 376L.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 378L.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 380E.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 381 A.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 3821. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 383S.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 384R.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 385D.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 386L.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 389Q. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 390L.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 39 IL. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 392K.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 393N.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 394L.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 399L.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 400M. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 406E.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 407F.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 41 IM.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 414C.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 418F. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 421W.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 422D.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 423D.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 424E.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 425Y. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 427K.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 43 IL. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 432L.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 433R.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 434D.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 4351.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 437K. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 439K.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 440R.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 445K.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 448W.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 454H. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 457L.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 460R.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 467F.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 468R.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 470Q. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 471H.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 472E. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 473 Q.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 475R.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 477N.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 4781.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 480R. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 48 IN.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 482L.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 483R.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 484P.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 519E. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 52 IN.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 524A.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 525 Y.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 526E.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 529K. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 531V.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 532D. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 534L.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 535D.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 543A.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 544W.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 545E. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 547A.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 549K.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 55 OR.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 551Y.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 5551. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 558N.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 559E.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 560T.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 5621.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 563T. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 566L.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 569Q. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 570L.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 575N.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 577N.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 578E.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 579M. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 580F.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 5821.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 583F.
A prefened mutein of the invention is one wherein the conserved amino acid . affected by said mutation is the amino acid 584S.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 585R. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 587N.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 588 A.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 589L.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 590F.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 592R. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 593P.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 5951. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 596R.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 597G.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 598 A.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 5991.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 60 IE. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 602Y.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 603 Q.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 604T.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 606L.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 6071. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 609R.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 6 ION.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 61 IK.
A prefened mutein of the invention is one wherein the conserved amino acid affected by saidmύtatioh ϊs the amino acid 613D.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 6141. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 617L.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 62 IF. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 639L.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 640P.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 641P.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 646W.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 655Q. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 656L.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 659Y.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 66 IK.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 662R.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 663N. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 664E.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 665D.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 666N.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 667L.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 668G. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 669K.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 671W. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 672E.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 674H.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 677G.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 680L.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 68 IK. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 683D.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 684G.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 685D.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 687F.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 690F. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 69 IL.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 697F.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 700W.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 704N.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 705Ν. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 7151.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 717T. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 73 IL.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 733L.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 736N.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 744L.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 746K. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 747E.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 748N.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 752K.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 755 G.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 756F. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 757R.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 758N.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 759P.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 760L.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 7621. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 763N.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 764Ν. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 766A.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 767H.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 768Q.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 769A.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 770N. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 771Q.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 774P.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 776A.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 778S.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 779L. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 7801.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 78 IE.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 784R.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 785T.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 802L. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 804 A.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 808K. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 816E.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 817G.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 820L.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 822 W.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 824S. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 825 Y.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 826K.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 828D.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 830Y.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 834L. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 836E.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 838N.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 842Q.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 843E.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 848L. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 849L.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 862L. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 865C.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 867Y.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 87 IT.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 876L.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 880Q. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 883N.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 884D.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 886L.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 888L.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 891 Y. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 892S.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 893Ν.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 894L.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 897W.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 898N. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 899N.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 90 IL. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 902D.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 906E.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 909L.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 912R.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 920W. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 92 IT.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 95 IP.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 955N.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 957V.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 963T. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 965Q.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 968Y.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 971P.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 975E.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 977R. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 987W.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1001R. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1003Q.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1017Y.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1019N.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1021L.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1025P. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1027G
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1031L.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1032E.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1035Y.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1048Y. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1052W.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1053L.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1055Y.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1056Q.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1058L. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1059W.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1062Q. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1063 A.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1070L.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1071 G.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1077W.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1081L. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 10841.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1088R.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1091F.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1092D.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1096T. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1102P.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1107Y.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1109K.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1111Q.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1113K. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1117K.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1118Y. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1119D.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1121 W.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1122H.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1123K.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1124E. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1126L.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1128K.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1129F
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1130G.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1134G. A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1137W.
A prefened mutein of the invention is one wherein the conserved amino acid affected by said mutation is the amino acid 1140F.
It will be understood that human muteins of the cytoplasmic dynein heavy chainl having mutations as described herein, e.g., canying a substitution, deletion, or insertion at a position within the human amino acid sequence conesponding to any of the above individualized conserved amino acids of the mouse amino acid sequence, are likewise within the scope of the invention. The conesponding human amino acids will, as they are conserved between, e.g. mouse and human, be identical while their relative position within the amino acid sequence may vary. The skilled person will be readily able to identify the conesponding human amino acids, e.g., within SEQ ID NO: 18, or from Figures 9 or 10.
In addition to the mutant proteins described by SEQ ID NO:4, and SEQ ID NO: 6, the skilled artisan will further appreciate that changes can be introduced by mutation into the nucleotide sequence encoding a dynein heavy chain polypeptide (e.g., the sequences of SEQ ID NO:3 and SEQ ID NO:5), thereby leading to changes in the amino acid sequence of the encoded dynein heavy chain proteins without altering properties of the mutant dynein heavy chain proteins. For example, nucleotide substitutions leading to amino acid substitutions at "non-essential" amino acid residues can be made in the sequence of SEQ ID NO: 3 and SEQ ID NO:5. A "non-essential" amino acid residue is a residue that can be altered from the wild-type sequence of a dynein heavy chain polypeptide without altering the biological activity, whereas an "essential" amino acid residue is required for biological activity. For example, amino acid residues that are conserved among the cytoplasmic dynein heavy chainl polypeptide or polypeptide fragments of the present invention are predicted to be particularly unamenable to alteration.
Preferably, such alterations replace an amino acid with one of similar size and polarity (e.g., conservative substitution). In one embodiment, the polypeptide has at least 75 %, preferably at least 80 %, more preferably at least 90 %, even more preferably 95% and most preferably at least 99 % sequence identity with the wild type cytoplasmic dynein heavy chainl sequence. In a particularly prefened embodiment, the polypeptide is identical with the wild type sequence except for a replacement of the Tyr residue at position 1055 ofthe amino acid sequence, as shown in SEQ ID NO: 4. In another particularly prefened embodiment, the polypeptide is identical to the wild type sequence except for a replacement ofthe Tyr residue at position 1057 ofthe amino acid sequence, as shown in SEQ ID NO: 6 or at the conesponding position in other cytoplasmic dynein heavy chainl sequences. Prefened modifications of the amino acid sequence, in addition to the replacement at, e.g., position 1055 of the amino acid sequence shown in SEQ ID NO: 4, and at, e.g., position 1057 ofthe amino acid sequence shown in SEQ ID NO: 6, or at a conesponding position in other dynein heavy chains are at any of the positions which are conserved among the vertebrate dynein heavy chains as described in individualized manner in connection with the prefened muteins above.
Prefened modifications of the amino acid sequence, in addition to the replacement at position 1055 of the amino acid sequence shown in SEQ ID NO: 4, and at position 1057 of the amino acid sequence shown in SEQ ID NO: 6, or at a conesponding position in other dynein heavy chains are at positions which are not conserved among the vertebrate dynein heavy chains.
Amino acids in the cytoplasmic dynein heavy chain 1 proteins of the present invention that are essential for function can be identified by methods known in the art, such as site-directed mutagenesis or alanine-scanning mutagenesis (Cunningham and Wells, Science 244:1081-1085, 1989). The latter procedure introduces single alanine mutations at every residue in the molecule. The resulting mutant molecules are then tested for biological activity such as receptor binding or in vitro proliferatϊve activity. Sites that are critical for ligand-receptor binding can also be determined by structural analysis such as crystallization, nuclear magnetic resonance or photoaffinity labeling (Smith et al., J. Mol. Biol. 224:899-904, 1992; de Nos et al., Science 255:306-312, 1992).
An "isolated" or "purified" polypeptide or protein or biologically-active portion thereof is substantially free of cellular material or other contaminating proteins from the cell or tissue source from which the polypeptide or protein is derived, or substantially free from chemical precursors or other chemicals when chemically synthesized. The language "substantially free of cellular material" includes preparations of dynein heavy chain protein in which the protein is separated from cellular components of the cells from which it the protein is isolated or in which it is recombinantly produced.
Further as used herein, a "mature" form of a polypeptide or protein may arise from a step of post-translational modification other than a proteolytic cleavage event. Such additional processes include, by way of non-limiting example, glycosylation, myristoylation or phosphorylation. In general, a mature polypeptide or protein may result from the operation of only one of these processes, or a combination of any of them.
To determine the percent homology of two amino acid sequences or of two nucleic acids, the sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in the sequence of a first amino acid or nucleic acid sequence for optimal alignment with a second comparison amino acid or nucleic acid sequence). The amino acid residues or nucleotides at conesponding amino acid positions or nucleotide positions are then compared. When a position in the first sequence is occupied by the same amino acid residue or nucleotide as the conesponding position in the second sequence, then the molecules are homologous at that position (e.g., as used herein amino acid or nucleic acid "homology" is equivalent to amino acid or nucleic acid "identity"). The nucleic acid sequence homology may be determined as the degree of identity between two sequences. The homology may be determined using computer programs known in the art, such as GAP software provided in the GCG program package. See, Needleman and Wunsch (1970) J Mol Biol 48, 443-453. Using GCG GAP software with the following settings for nucleic acid sequence comparison: GAP creation penalty of 5.0 and GAP extension penalty of 0.3, the coding region of the analogous nucleic acid sequences refened to above exhibits a degree of identity preferably of at least 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 99%, with the CDS (encoding) part ofthe DNA sequence shown in SEQ ID NOS:l, 3, 5, and 17.
The term "sequence identity" refers to the degree to which two polynucleotide or polypeptide sequences are identical on a residue-by-residue basis over a particular region of comparison. The term "percentage of sequence identity" is calculated by comparing two optimally aligned sequences over that region of comparison, determining the number of positions at which the identical nucleic acid base (e.g., A, T, C, G, U, or I, in the case of nucleic acids) occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the region of comparison (e.g., the window size), and multiplying the result by 100 to yield the percentage of sequence identity. The term "substantial identity" as used herein denotes a characteristic of a polynucleotide sequence, wherein the polynucleotide comprises a sequence that has at least 80 percent sequence identity, preferably at least 85 percent identity and often 90 to 95 percent sequence identity, more usually at least 99 percent sequence identity as compared to a reference sequence over a comparison region.
The phrases "percent identity" or "% identity" refer to the percentage of sequence similarity found in a comparison of two or more amino acid or nucleic acid sequences. Percent identity can be determined electronically, e.g., by using the MEGALIGN program (DNASTAR, Inc., Madison WI, USA). The MEGALIGN program can create alignments between two or more sequences according to different methods, e.g., the clustal method (see, for example, Higgins and Sharp (1988) Gene 73:237-244. The clustal algorithm groups sequences into clusters by examining the distances between all pairs. The clusters are aligned pairwise and then in groups. The percentage similarity between two amino acid sequences, e.g., sequence A and sequence B, is calculated by dividing the length of sequence A, minus the number of gap residues in sequence A, minus the number of gap residues in sequence B, into the sum of the residue matches between sequence A and sequence B, times one hundred. Gaps of low homology or of no homology between the two amino acid sequences are not included in determining percentage similarity. Percent identity between nucleic acid sequences can also be counted or calculated by other methods known in the art, e.g., the method described in Hein (1990) Methods Enzymol 183, 626-645. Identity between sequences can also be determined by other methods known in the art, e.g., by varying hybridization conditions.
The comparison of two or more amino acid or nucleic acid sequences to determine sequence identity can be performed between ortholog sequences, preferably between mouse and human, more preferably between mouse, rat, and human sequences. When a position of an amino acid or nucleotide in one ortholog sequence is occupied by the same amino acid or nucleotide in at least a second ortholog sequence, this amino acid or nucleotide is "evolutionary conserved" for the purpose of this invention. The term "evolutionary conserved" also comprises amino acid substitutions, where an amino acid is replaced by another (i.e., different) amino acid that represents a conservative substitution as defined below. When, e.g., residue 1055 of SEQ ID NO:2, or residue 1057 of SEQ ID NO:18 or any of the residues conesponding to the conserved residues described in individualized manner in connection with the prefened muteins ofthe invention above is replaced by an amino acid with different size and/or polarity (excluding the wild type residue at this position), this is termed a non-conservative amino acid substitution. Non-conservative substitutions are defined as exchanges of an amino acid by another amino acid listed in a different group of the five standard amino acid groups shown below:
1. small aliphatic, nonpolar or slightly polar residues: Ala, Ser, Thr, (Pro), (Gly);
2. negatively charged residues and their amides: Asn, Asp, Glu, Gin;
3. positively charged residues: His, Arg, Lys;
4. large aliphatic, nonpolar residues: Met, Leu, He, Nal, (Cys);
5. large aromatic residues: Phe, Tyr, Trp.
Conservative substitutions are defined as exchanges of an amino acid by another amino acid listed within the same group of the five standard amino acid groups shown above. Three residues are parenthesized because of their special role in protein architecture. Gly is the only residue without a sidechain and therefore imparts flexibility to the chain. Pro has an unusual geometry which tightly constrains the chain. Cys can participate in disulfide bonds.
In a prefened embodiment, the cytoplasmic dynein heavy chainl expressed in the animal model of the present invention canies a mutation, which affects the conserved amino acids of the muteins described in individualized manner in connection with the prefened muteins ofthe invention above.
In the most prefened embodiment, the cytoplasmic dynein heavy chainl expressed in the animal model of the present invention has the amino acid sequence shown in SEQ ID ΝO:4.
In another most prefened embodiment, the cytoplasmic dynein heavy chainl expressed in the animal model of the present invention has an amino acid sequence selected from the sequences shown in SEQ ID NO:6 and SEQ ID NO: 18. The invention also provides novel chimeric or fusion proteins as used herein, a novel "chimeric protein" or "fusion protein" comprises a novel cytoplasmic dynein heavy chainl polypeptide linked to a non-cytoplasmic dynein heavy chainl polypeptide (e.g., a polypeptide that does not comprise cytoplasmic dynein heavy chainl or a fragment therof).
In one embodiment, the fusion protein is a GST-cytoplasmic dynein heavy chainl fusion protein in which the cytoplasmic dynein heavy chainl sequences are fused to the C-terminus ofthe GST (glutathione S-transferase) sequences. Such fusion proteins can facilitate the purification of recombinant cytoplasmic dynein heavy chainl polypeptides.
In yet another embodiment, the fusion protein is a cytoplasmic dynein heavy chainl -immunoglobulin fusion protein in which the cytoplasmic dynein heavy chainl sequences are fused to sequences derived from a member of the immunoglobulin protein family, especially Fc region polypeptides. Also contemplated are fusions of cytoplasmic dynein heavy chainl sequences (mutant or wild type or functional fragments) fused to amino acid sequences that are commonly used to facilitate purification or labeling, e.g. polyhistidine tails (especially hexahistidine segments), FLAG tags, streptavidin.
The amino acid sequences of the present invention may be made by using peptide synthesis techniques well known in the art, such as solid phase peptide synthesis (see, for example, Fields et al. "Principles and Practice of Solid Phase Synthesis" in Synthetic Peptides, A Users Guide, Grant GA (ed.), (W.H. Freeman Co. New York NY, USA, 1992) at Chapter 3, pp. 77-183; Barlos K and Gatos D "Convergent Peptide Synthesis" in FMOC Solid Phase Peptide Synthesis, Chan WC and White PD (eds.), (Oxford University Press, New York NY, USA, 2000) at Chapter 9, pp. 215-228) or by recombinant DNA manipulations and recombinant expression. Techniques for making substitution mutations at predetermined sites in DNA having known sequence are well known and include, for example, Ml 3 mutagenesis. Manipulation of DNA sequences to produce variant proteins which manifest as substitution, insertion or deletion variants are conveniently described, for example, in Sambrook et al. (1989), supra.
Antibodies Also included in the invention are antibodies to fragments of cytoplasmic dynein heavy chainl polypeptides and muteins as described in individualized manner in connection with the prefened muteins of the invention above (including amino terminal fragments), as well as antibodies to fusion proteins containing cytoplasmic dynein heavy chainl polypeptides or fragments of cytoplasmic dynein heavy chainl polypeptides or muteins as described in individualized manner in connection with the prefened muteins of the invention above. The term "antibody" as used herein refers to immunoglobulin molecules and immunologically active portions of immunoglobulin (Ig) molecules, e.g., molecules that contain an antigen binding site that specifically binds (immunoreacts with) an antigen. Such antibodies include, e.g., polyclonal, monoclonal, chimeric, single chain, Fab, Fab- and F(ab')2 fragments, and an Fa expression library. In general, an antibody molecule obtained from humans relates to any of the classes IgG, IgM, IgA, IgE and IgD, which differ from one another by the nature ofthe heavy chain present in the molecule. Certain classes have subclasses as well, such as IgGi, IgG2, and others. Furthermore, in humans, the light chain may be a kappa chain or a lambda chain. Reference herein to antibodies includes a reference to all such classes, subclasses and types of human antibody species.
A cytoplasmic dynein heavy chainl polypeptide 1 of the invention may be intended to serve as an antigen, or a portion or fragment thereof, and additionally can be used as an immunogen to generate antibodies that immunospecifically bind the antigen, using standard techniques for polyclonal and monoclonal antibody preparation. Antigenic peptide fragments of the antigen for use as immunogens includes, e.g., at least 7 amino acid residues ofthe amino acid sequence ofthe mutated region such as an amino acid sequence shown in SEQ ID NO:4 or SEQ ID NO:6, and encompasses an epitope thereof such that an antibody raised against the peptide forms a specific immune complex with the full length protein or with any fragment that contains the epitope. Preferably, the antigenic peptide comprises at least 10 amino acid residues, or at least 15 afhino acid residues, or at least 20 amino acid residues, or at least 30 amino acid residues. Prefened epitopes encompassed by the antigenic peptide are regions of the protein that are located on its surface; commonly these are hydrophilic regions.
In certain embodiments of the invention, at least one epitope encompassed by the antigenic peptide is a region of cytoplasmic dynein heavy chainl polypeptide that is located on the surface of the protein, e.g., a hydrophilic region. A hydrophobicity analysis of a cytoplasmic dynein heavy chainl polypeptide will indicate which regions of a cytoplasmic dynein heavy chainl protein are particularly hydrophilic and, therefore, are likely to encode surface residues useful for targeting antibody production. As a means for targeting antibody production, hydropathy plots showing regions of hydrophilicity and hydrophobicity may be generated by any method well known in the art, including, for example, the Kyte Doolittle or the Hopp Woods methods, either with or without Fourier transformation. (See, for example, Hopp and Woods (1981) Proc Nat Acad Sci USA 78, 3824-3828; Kyte and Doolittle (1982) J Mol Biol 157, 105-142.) Antibodies that are specific for one or more domains within an antigenic protein, or derivatives, fragments, analogs or homologs thereof, are also provided herein.
A protein of the invention, or a derivative, fragment, analog, homolog or ortholog thereof, may be utilized as an immunogen in the generation of antibodies that immunospecifically bind these protein components.
Various procedures known within the art may be used for the production of polyclonal or monoclonal antibodies directed against a protein of the invention, or against derivatives, fragments, analogs homologs or orthologs thereof. (See, for example, Harlow and Lane Antibodies: A Laboratory Manual, (Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, USA, 1988).) Some of these antibodies are discussed below.
Polyclonal Antibodies
For the production of polyclonal antibodies, various suitable host animals (e.g., rabbit, goat, mouse or other mammal) may be immunized by one or more injections with the protein of the invention, a synthetic variant thereof, or a derivative of the foregoing. An appropriate immunogenic preparation can contain, for example, the naturally occuning immunogenic protein, a chemically synthesized polypeptide representing the immunogenic protein, or a recombinantly expressed immunogenic protein. Furthermore, the protein may be conjugated to a second protein known to be immunogenic in the mammal being immunized. Examples of such immunogenic proteins include but are not limited to keyhole limpet hemocyanin, serum albumin, bovine thyroglobulin and soybean trypsin inhibitor.
The preparation can further include an adjuvant. Various adjuvants used to increase the immunological response include, but are not limited to, Freund's (complete and incomplete), mineral gels (e.g., aluminum hydroxide), surface active substances (e.g., lysolecithin, pluronic polyols, polyanions, peptides, oil emulsions, dinitrophenol, etc.), adjuvants usable in humans such as Bacille Calmette-Guerin and Corynebacterium parvum, or similar immunostimulatory agents. Additional examples of adjuvants which can be employed include MPL-TDM adjuvant (monophosphoryl Lipid A, synthetic trehalose dicorynomycolate).
The polyclonal antibody molecules directed against the immunogenic protein can be isolated from the mammal (e.g., from the blood) and further purified by well known techniques, such as affinity chromatography using protein A or protein G, which provide primarily the IgG fraction of immune serum. Subsequently, or alternatively, the specific antigen which is the target ofthe immunoglobulin sought, or an epitope thereof, may be immobilized on a column to purify the immune specific antibody by immunoaffinity chromatography. Purification of immunoglobulins is discussed, for example, by Wilkinson (Wilkinson (2000) The Scientist, 14, 25-28).
Monoclonal Antibodies
The term "monoclonal antibody" (MAb) or "monoclonal antibody composition", as used herein, refers to a population of antibody molecules that contain only one molecular species of antibody molecule consisting of a unique light chain gene product and a unique heavy chain gene product. In particular, the complementarity determining regions (CDRs) of the monoclonal antibody are identical in all the molecules ofthe population. MAbs thus contain an antigen binding site capable of immunoreacting with a particular epitope of the antigen, the antigen binding site being characterized by its unique binding affinity for this epitope. Similarly, the epitope may be characterized by its binding affinity for antigen binding sites of one or more particular MAbs having binding sites directed towards that epitope.
Monoclonal antibodies can be prepared using hybridoma methods, such as those described by Kohler and Milstein (1975) Nature 256, 495. In a hybridoma method, a mouse, hamster, or other appropriate host animal, is typically immunized with an immunizing agent to elicit lymphocytes that produce or are capable of producing antibodies that will specifically bind to the immunizing agent. Alternatively, the lymphocytes can be immunized in vitro.
The immunizing agent will typically include the protein antigen, a fragment thereof or a fusion protein thereof. Generally, either peripheral blood lymphocytes are used if cells of human origin are desired, or spleen cells or lymph node cells are used if non-human mammalian sources are desired. The lymphocytes are then fused with an immortalized cell line using a suitable fusing agent, such as polyethylene glycol, to form a hybridoma cell (Goding, Monoclonal Antibodies: Principles and Practice (Academic Press / Elsevier Science Sidcup, Kent, UK, 1986) at pp. 59-103). Immortalized cell lines are usually transformed mammalian cells, particularly myeloma cells of rodent, bovine and human origin. Usually, rat or mouse myeloma cell lines are employed. The hybridoma cells can be cultured in a suitable culture medium that preferably contains one or more substances that inhibit the growth or survival ofthe unfused, immortalized cells. For example, if the parental cells lack the enzyme hypoxanthine guanine phosphoribosyl transferase (HGPRT or HPRT), the culture medium for the hybridomas typically will include hypoxanthine, aminopterin, and thymidine ("HAT medium"), which substances prevent the growth of HGPRT- deficient cells.
Prefened immortalized cell lines are those that fuse efficiently, support stable high level expression of antibody by the selected antibody-producing cells, and are sensitive to a medium such as HAT medium. More prefened immortalized cell lines are murine myeloma lines, which can be obtained, for instance, from the Salk Institute Cell Distribution Center, San Diego, California and the American Type Culture Collection, Manassas, Virginia. Human myeloma and mouse-human heteromyeloma cell lines also have been described for the production of human monoclonal antibodies (Kozbor (1984) J Immunol, 133, 3001; Brodeur et al., Monoclonal Antibody Production Techniques and Applications (Marcel Dekker, Inc., New York NY, USA, 1987) at pp. 51-63).
The culture medium in which the hybridoma cells are cultured can then be assayed for the presence of monoclonal antibodies directed against the antigen. Preferably, the binding specificity of monoclonal antibodies produced by the hybridoma cells is determined by immunoprecipitation or by an in vitro binding assay, such as radioimmunoassay (RIA) or enzyme-linked immunoabsorbent assay (ELISA). Such techniques and assays are known in the art. The binding affinity of the monoclonal antibody can, for example, be determined by the Scatchard analysis of Munson and Pollard (1980) Anal. Biochem., 107:220. Preferably, antibodies having a high degree of specificity and a high binding affinity for the target antigen are isolated.
After the desired hybridoma cells are identified, the clones can be subcloned by limiting dilution procedures and grown by standard methods. Suitable culture media for this purpose include, for example, Dulbecco's Modified Eagle's Medium and RPMI- 1640 medium. Alternatively, the hybridoma cells can be grown in vivo as ascites in a mammal.
The monoclonal antibodies secreted by the subclones can be isolated or purified from the culture medium or ascites fluid by conventional immunoglobulin purification procedures such as, for example, protein A-Sepharose, hydroxylapatite chromatography, gel electrophoresis, dialysis, or affinity chromatography.
The monoclonal antibodies can also be made by recombinant DNA methods, such as those described in U.S. Patent No. 4,816,567. DNA encoding the monoclonal antibodies of the invention can be readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of murine antibodies). The hybridoma cells of the invention serve as a prefened source of such DNA. Once isolated, the DNA can be placed into expression vectors, which are then transfected into host cells such as simian COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not otherwise produce immunoglobulin protein, to obtain the synthesis of monoclonal antibodies in the recombinant host cells. The DNA also can be modified, for example, by substituting the coding sequence for human heavy and light chain constant domains in place of the homologous murine sequences (U.S. Patent No. 4,816,567; Morrison (1994) Nature 368, 812-13) or by covalently joining to the immunoglobulin coding sequence all or part of the coding sequence for a non- immunoglobulin polypeptide. Such a non-immunoglobulin polypeptide can be substituted for the constant domains of an antibody of the invention, or can be substituted for the variable domains of one antigen-combining site of an antibody of the invention to create a chimeric bivalent antibody.
Humanized Antibodies
The antibodies directed against the protein antigens of the mvention can further comprise humanized antibodies or human antibodies. These antibodies are suitable for administration to humans without engendering an immune response by the human against the administered immunoglobulin. Humanized forms of antibodies are chimeric immunoglobulins, immunoglobulin chains or fragments thereof (such as Fv, Fab, Fab', F(ab') or other antigen-binding subsequences of antibodies) that are principally comprised of the sequence of a human immunoglobulin and contain minimal sequence derived from a non-human immunoglobulin. Humanization can be performed following the method of Winter and co-workers (Jones et al. (1986) Nature 321, 522-525; Riechmann et al. (1988) Nature 332, 323-327; Verhoeyen et al. (1988) Science 239, 1534-1536), by substituting rodent CDRs or CDR sequences for the conesponding sequences of a human antibody. (See also U.S. Patent No. 5,225,539.) In some instances, Fv framework residues ofthe human immunoglobulin are replaced by conesponding non-human residues. Humanized antibodies can also comprise residues which are found neither in the recipient antibody nor in the imported CDR or framework sequences. In general, the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDR regions conespond to those of a non-human immunoglobulin and all or substantially all of the framework regions are those of a human immunoglobulin consensus sequence. The humanized antibody optimally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin (Jones et al. (1986) Nature 321, 522-525; Riechmann et al. (1988) Nature 332, 323-327; and Presta (1992) Cun Op Struct Biol 2, 593-596).
Human Antibodies
Fully human antibodies relate to antibody molecules in which essentially the entire sequences of both the light chain and the heavy chain, including the CDRs, arise from human genes. Such antibodies are termed "human antibodies", or "fully human antibodies" herein. Human monoclonal antibodies can be prepared by the trioma technique; the human B-cell hybridoma technique (see Kozbor et al. (1983) Immunol Today 4, 72) and the EBV hybridoma technique to produce human monoclonal antibodies (see Cole et al. in: Monoclonal Antibodies and Cancer Therapy (Alan R. Liss, Inc., New York NY, USA, 1985) at pp. 77-96). Human monoclonal antibodies may be utilized in the practice of the present invention and may be produced by using human hybridomas (see Cote et al. (1983) Proc Natl Acad Sci USA 80, 2026-2030) or by transforming human B-cells with Epstein Ban Virus in vitro (see Cole et α/.in: Monoclonal Antibodies and Cancer Therapy (Alan R. Liss, Inc., New York NY, USA, 1985) at pp. 77-96).
In addition, human antibodies can also be produced using additional techniques, including phage display libraries (Hoogenboom and Winter (1992) J Mol Biol 227, 381-388; Marks et al. (1991) J Mol Biol 222, 581-597). Similarly, human antibodies can be made by introducing human immunoglobulin loci into transgenic animals, e.g., mice in which the endogenous immunoglobulin genes have been partially or completely inactivated. Upon challenge, human antibody production is observed, which closely resembles that seen in humans in all respects, including gene reanangement, assembly, and antibody repertoire. This approach is described, for example, in U.S. Patents No. 5,545,807; 5,545,806; 5,569,825; 5,625,126 5,633,425; 5,661,016, and in Marks et al. (1992) Bio/Technology 10, 779-783 Lonberg et al. (1994) Nature 368, 856-859; Monison (1994) Nature 368, 812-13 Fishwild et al. (1996) Nature Biotechnology 14, 845-51; Neuberger (1996) Nature Biotechnology 14, 826; and Lonberg and Huszar (1995) Intern Rev Immunol 13, 65- 93.
Human antibodies may additionally be produced using transgenic nonhuman animals which are modified so as to produce fully human antibodies rather than the animal's endogenous antibodies in response to challenge by an antigen (see PCT publication WO94/02602). The endogenous genes encoding the heavy and light immunoglobulin chains in the nonhuman host have been incapacitated, and active loci encoding human heavy and light chain immunoglobulins are inserted into the host's genome. The human genes are incorporated, for example, using yeast artificial chromosomes containing the requisite human DNA segments. An animal which provides all the desired modifications is then obtained as progeny by crossbreeding intermediate transgenic animals containing fewer than the full complement of the modifications. The prefened embodiment of such a nonhuman animal is a mouse, and is termed the Xenomouse™ as disclosed in PCT publications WO-A-96/33735 and WO-A-96/34096. This animal produces B cells which secrete fully human immunoglobulins. The antibodies can be obtained directly from the animal after immunization with an immunogen of interest, as, for example, a preparation of a polyclonal antibody, or alternatively from immortalized B cells derived from the animal, such as hybridomas producing monoclonal antibodies. Additionally, the genes encoding the immunoglobulins with human variable regions can be recovered and expressed to obtain the antibodies directly, or can be further modified to obtain analogs of antibodies such as, for example, single chain Fv molecules.
An example of a method of producing a nonhuman host, exemplified as a mouse, lacking expression of an endogenous immunoglobulin heavy chain is disclosed in U.S. Patent No. 5,939,598. Such a host can be obtained by a method including deleting the J segment genes from at least one endogenous heavy chain locus in an embryonic stem cell to prevent reanangement of the locus and to prevent formation of a transcript of a reananged immunoglobulin heavy chain locus, the deletion being effected by a targeting vector containing a gene encoding a selectable marker; and producing from the embryonic stem cell a transgenic mouse whose somatic and germ cells contain the gene encoding the selectable marker. A method for producing an antibody of interest, such as a human antibody, is disclosed in U.S. Patent No. 5,916,771. The method includes introducing an expression vector that contains a nucleotide sequence encoding a heavy chain into one mammalian host cell in culture, introducing an expression vector containing a nucleotide sequence encoding a light chain into another mammalian host cell, and fusing the two cells to form a hybrid cell. The hybrid cell expresses an antibody containing the heavy chain and the light chain.
In a further improvement on this procedure, a method for identifying a clinically relevant epitope on an immunogen, and a conelative method for selecting an antibody that binds immunospecifically to the relevant epitope with high affinity, are disclosed in PCT publication WO-A-99/53049.
Fgh Fragments and Single Chain Antibodies According to the invention, techniques can be adapted for the production of single-chain antibodies specific to an antigenic protein of the invention (see for example U.S. Patent No. 4,946,778). In addition, methods can be adapted for the construction of Fab expression libraries (see for example Huse et al. (1989) Science 246, 1275-1281) to allow rapid and effective identification of monoclonal Fab fragments with the desired specificity for a protein or derivatives, fragments, analogs or homologs thereof. Antibody fragments that contain the idiotypes to a protein antigen may be produced by techniques known in the art including, but not limited to: (i) an F(ab')2 fragment produced by pepsin digestion of an antibody molecule; (ii) an Fab fragment generated by reducing the disulfide bridges of an F(ab')2 fragment;
(iii) an Fab fragment generated by the treatment of the antibody molecule with papain and a reducing agent; and (iv) Fv fragments.
Bispecific Antibodies
Bispecific antibodies are monoclonal, preferably human or humanized, antibodies that have binding specificities for at least two different antigens. In the present case, one of the binding specificities is for an antigenic protein of the invention. The second binding target is any other antigen, and advantageously is a cell-surface protein or receptor or receptor subunit.
Methods for making bispecific antibodies are known in the art. Traditionally, the recombinant production of bispecific antibodies is based on the co-expression of two immunoglobulin heavy-chain/light-chain pairs, where the two heavy chains have different specificities (Milstein and Cuello (1983) Nature 305, 537-539). Because of the random assortment of immunoglobulin heavy and light chains, these hybridomas (quadromas) produce a potential mixture often different antibody molecules, of which only one has the conect bispecific structure. The purification of the conect molecule is usually accomplished by affinity chromatography steps. Similar procedures are disclosed in WO-A-93/08829 and in Traunecker et al. (1991) EMBO J 10, 3655- 3659.
Antibody variable domains with the desired binding specificities (antibody- antigen combining sites) can be fused to immunoglobulin constant domain sequences. The fusion preferably is with an immunoglobulin heavy-chain constant domain, comprising at least part of the hinge, CH2, and CH3 regions. It is prefened to have the first heavy chain constant region (CHI) containing the site necessary for light- chain binding present in at least one of the fusions. DNAs encoding the immimoglobulin heavy-chain fusions and, if desired, the immunoglobulin light chain are inserted into separate expression vectors and are co-transfected into a suitable host organism. For further details of generating bispecific antibodies see, for example, Suresh et al. (1986) Methods in Enzymology 121, 210.
In accordance with another approach described in WO-A-96/27011, the interface between a pair of antibody molecules can be engineered to maximize the percentage of heterodimers which are recovered from recombinant cell culture. The prefened interface comprises at least a part ofthe CH3 region of an antibody constant domain. In this method, one or more small amino acid side chains from the interface of the first antibody molecule are replaced with larger side chains (e.g. tyrosine or tryptophan). Compensatory "cavities" of identical or similar size to the large side chain(s) are created on the interface of the second antibody molecule by replacing large amino acid side chains with smaller ones (e.g. alanine or threonine). This provides a mechanism for increasing the yield ofthe heterodimer over other unwanted end-products such as homodimers.
Bispecific antibodies can be prepared as full length antibodies or antibody fragments (e.g. F(ab')2 bispecific antibodies). Techniques for generating bispecific antibodies from antibody fragments have been described in the literature. For example, bispecific antibodies can be prepared using chemical linkage. Brennan et al. ((1985) Science 229, 81) describe a procedure wherein intact antibodies are proteolytically cleaved to generate F(ab')2 fragments. These fragments are reduced in the presence of the dithiol complexing agent sodium arsenite to stabilize vicinal dithiols and prevent intermolecular disulfide formation. The Fab' fragments generated are then converted to thionitrobenzoate (TNB) derivatives. One of the Fab'-TNB derivatives is then reconverted to the Fab'-thiol by reduction with mercaptoethylamine and is mixed with an equimolar amount of the other Fab'-TNB derivative to form the bispecific antibody. The bispecific antibodies produced can be used as agents for the selective immobilization of enzymes.
Additionally, Fab' fragments can be recovered directly from E. coli and chemically coupled to form bispecific antibodies. Shalaby et al. ((1992) J Exp Med 175, 217-225) describe the production of a fully humanized bispecific antibody F(ab')2 molecule. Each Fab' fragment was secreted separately from E. coli and subjected to directed chemical coupling in vitro to form the bispecific antibody. The bispecific antibody thus formed was able to bind to cells overexpressing the ErbB2 receptor and normal human T cells, as well as trigger the lytic activity of human cytotoxic lymphocytes against human breast tumor targets.
Various techniques for making and isolating bispecific antibody fragments directly from recombinant cell culture have also been described. For example, bispecific antibodies have been produced using leucine zippers. Kostelny et al. (1992) J Immunol 148, 1547-1553. The leucine zipper peptides from the Fos and Jun proteins were linked to the Fab' portions of two different antibodies by gene fusion. The antibody homodimers were reduced at the hinge region to form monomers and then re-oxidized to form the antibody heterodimers. This method can also be utilized for the production of antibody homodimers. The "diabody" technology described by Hollinger et al. ((1993) Proc Natl Acad Sci USA 90, 6444-6448) has provided an alternative mechanism for making bispecific antibody fragments. The fragments comprise a heavy-chain variable domain (VH) connected to a light-chain variable domain (V ) by a linker which is too short to allow pairing between the two domains on the same chain. Accordingly, the VH and VL domains of one fragment are forced to pair with the complementary V and VH domains of another fragment, thereby forming two antigen-binding sites. Another strategy for making bispecific antibody fragments by the use of single-chain Fv (sFv) dimers has also been reported (see Gruber et al. (1994) J Immunol 152, 5368-74.
Antibodies with more than two valencies are contemplated. For example, trispecific antibodies can be prepared (Tutt et al. (1991) J Immunol 147, 60-69).
Exemplary bispecific antibodies can bind to two different epitopes, at least one of which originates in the protein antigen of the invention. Alternatively, an anti-antigenic arm of an immunoglobulin molecule can be combined with an arm which binds to a triggering molecule on a leukocyte such as a T-cell receptor molecule (e.g. CDl, CD3, CD28, or B7), or Fc receptors for IgG (Fc R), such as Fc RI (CD64), Fc RII (CD32) and Fc RIII (CD 16) so as to focus cellular defense mechanisms to the cell expressing the particular antigen. Bispecific antibodies can also be used to direct cytotoxic agents to cells which express a particular antigen. These antibodies possess an antigen-binding arm and an arm which binds a cytotoxic agent or a radionuclide chelator, such as EOTUBE, DPTA, DOTA, or TETA. Another bispecific antibody of interest binds the protein antigen described herein and further binds tissue factor (TF).
Heteroconjugate Antibodies
Heteroconjugate antibodies are also within the scope of the present invention. Heteroconjugate antibodies are composed of two covalently joined antibodies. Such antibodies have, for example, been proposed to target immune system cells to unwanted cells (U.S. Patent No. 4,676,980), and for treatment of HIV infection (WO- A-91/00360; WO-A-92/20373; EP-A3-0308936). It is contemplated that the antibodies can be prepared in vitro using known methods in synthetic protein chemistry, including those involving crosslinking agents. For example, immunotoxins can be constructed using a disulfide exchange reaction or by forming a thioether bond. Examples of suitable reagents for this purpose include iminothiolate and methyl-4- mercaptobutyrimidate and those disclosed, for example, in U.S. Patent No. 4,676,980.
Effector Function Engineering
It can be desirable to modify the antibody of the invention with respect to effector function, so as to enhance, e.g., the effectiveness of the antibody. For example, cysteine residue(s) can be introduced into the Fc region, thereby allowing interchain disulfide bond formation in this region. The homodimeric antibody thus generated can have improved internalization capability and/or increased complement- mediated cell killing and antibody-dependent cellular cytotoxicity (ADCC) (see Caron et al. (1992) J Exp Med 176; 1191-1195 and Shopes (1992) J Immunol 148, 2918- 2922). Homodimeric antibodies with enhanced anti-tumor activity can also be prepared using heterobifunctional cross-linkers as described in Wolff et al. (1993) Cancer Res 53, 2560-2565. Alternatively, an antibody can be engineered that has dual Fc regions and can thereby have enhanced complement lysis and ADCC capabilities (see Stevenson et al. (1989) Anti-Cancer Drug Design 3, 219-230).
Immunoconjugates
The invention also pertains to immunoconjugates comprising an antibody conjugated to a cytotoxic agent such as a chemotherapeutic agent, toxin (e.g., an enzymatically active toxin of bacterial, fungal, plant, or animal origin, or fragments thereof), or a radioactive isotope (e.g., a radioconjugate).
Enzymatically active toxins and fragments thereof that can be used include diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain (from Pseudomonas aeruginosa), ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins, dianthin proteins, Phytolaca americana proteins (PAPI, PAPII, and PAP-S), momordica charantia inhibitor, curcin, crotin, sapaonaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, enomycin, and the tricothecenes. A variety of radionuclides are available for the production of radioconjugated antibodies. Examples include 212Bi, 1311, 131In, 90Y, and 186Re. Conjugates of the antibody and cytotoxic agent are made using a variety of bifunctional protein-coupling agents such as N-succinimidyl-3-(2-pyridyldithiol) propionate (SPDP), iminothiolane (IT), bifunctional derivatives of imidoesters (such as dimethyl adipimidate HCL), active esters (such as disuccinimidyl suberate), aldehydes (such as glutareldehyde), bis-azido compounds (such as bis (p- azidobenzoyl) hexanediamine), bis-diazonium derivatives (such as bis-(p- diazoniumbenzoyl)-ethylenediamine), diisocyanates (such as tolyene 2,6- diisocyanate), and bis-active fluorine compounds (such as l,5-difiuoro-2,4- dinitrobenzene). For example, a ricin immunotoxin can be prepared as described in Vitetta et al. (1987) Science 238, 1098-1104. Carbon- 14-labeled 1- isothiocyanatobenzyl-3-methyldiethylene triaminepentaacetic acid (MX-DTPA) is an exemplary chelating agent for conjugation of radionucleotide to the antibody (see WO-A-94/11026).
In another embodiment, the antibody can be conjugated to a "receptor" (such streptavidin) for utilization in tumor pretargeting wherein die antibody-receptor conjugate is administered to the patient, followed by removal of unbound conjugate from the circulation using a clearing agent and then administration of a "ligand" (e.g., avidin) that is in turn conjugated to a cytotoxic agent.
Vectors and Cells Expressing cytoplasmic dynein heavy chainl
Another aspect of the invention pertains to vectors, preferably expression vectors, containing a nucleic acid encoding a cytoplasmic dynein heavy chainl protein or a mutein as described in individualized manner in connection with the prefened muteins of the invention above, or derivatives, fragments, analogs or homologs thereof. As used herein, the term "vector" refers to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked. One type of vector is a "plasmid", which refers to a circular double stranded circular DNA molecule into which additional DNA segments can be ligated. Another type of vector is a viral vector, wherein additional DNA segments can be ligated into the viral genome. Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g. bacterial vectors having a bacterial origin of replication and episomal mammalian vectors). Other vectors (e.g., non-episomal mammalian vectors) are integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome. Moreover, certain vectors are capable of directing the expression of genes to which they are operatively-linked. Such vectors are refened to herein as "expression vectors".
A host cell of the invention, such as a prokaryotic or eukaryotic host cell in culture, can be used to produce (e.g., express) cytoplasmic dynein heavy chainl protein or mutein as described in individualized manner in connection with the prefened muteins ofthe invention above. Accordingly, the invention further provides methods for producing cytoplasmic dynein heavy chainl protein or mutein using the host cells of the invention. In one embodiment, the method comprises culturing the host cell of invention (into which a recombinant expression vector encoding cytoplasmic dynein heavy chainl protein has been introduced) in a suitable medium such that cytoplasmic dynein heavy chainl protein or mutein is produced. In another embodiment, the method further comprises isolating cytoplasmic dynein heavy chainl protein or mutein from the medium or the host cell.
The host cells of the invention can also be used to produce non-human transgenic animals. For example, in one embodiment, a host cell ofthe invention is a fertilized oocyte or an embryonic stem cell into which cytoplasmic dynein heavy chainl protein- or cytoplasmic dynein heavy chainl mutein-coding sequences have been introduced. Such host cells can then be used to create non-human transgenic animals in which exogenous cytoplasmic dynein heavy chainl sequences have been introduced into their genome or homologous recombinant animals in which endogenous cytoplasmic dynein . heavy chainl sequences have been altered. Such animals are useful for studying the function and/or activity of cytoplasmic dynein heavy chainl protein and for identifying and/or evaluating modulators of cytoplasmic dynein heavy chainl protein activity. As used herein, a "transgenic animal" is a non-human animal, preferably a mammal, more preferably a rodent such as a rat or mouse, which contains one or more cells bearing genetic information (a transgene), received, directly or indirectly, by deliberate genetic manipulation at the subcellular level, such as by microinjection or transfection with recombinant DNA, or infection with a recombinant virus. Other examples of transgenic animals include non-human primates; ungulates such as cows, horses, goats, sheep; dogs, cats, and also chickens, amphibians, etc. Standard methods are known in the art that may be used in conjunction with the polynucleotides and of the invention and methods described herein to produce a transgenic animal expressing a modified cytoplasmic dynein e heavy chainl ofthe invention.
As used herein, a "transgene" is a foreign gene that has been artificially introduced into the genome of of an non human organism. A transgene present in germ cells is inherited by offspring. If such offspring in fact possesses the transgene, they too are transgenic animal.s A transgene present only in somatic cells is nor passed on to the gametes.
As used herein, the term "transgenic" describes an organism whose genome incorporates and expresses genes from another species.
Animal Models The present invention provides a non-human animal model which expresses a cytoplasmic dynein heavy chainl protein modified as described herein, e.g. for the muteins described in individualized manner in connection with the prefened muteins above, as compared to the amino acid sequence of the wild type protein. The cytoplasmic dynein heavy chainl expressed may have similarity in sequence and secondary structure to a vertebrate dynein heavy chain, including, but not limited to mammalian dynein heavy chain proteins, preferably of bovine, rat, and preferably mouse origin. The animal is preferably from a genus selected from the group consisting of Mus (e.g., mice), Rattus (e.g., rats), Oryctologus (e.g., rabbits) and Mesocricetus (e.g., hamsters). In a particularly prefened embodiment the animal is a mouse.
Animals canying a mutated cytoplasmic dynein heavy chainl allele expressing the modified cytoplasmic dynein heavy chainl proteins ofthe invention, e.g. a mutein as described in individualized manner in connection with the prefened muteins above, exhibit a variety of phenotypical features including: myoclonic cramps (which are especially pronounced in the hindlimbs), movement hyperactivity, reduced muscle endurance, excitatory neuronal damage ("dark neurons") in the hippocampus (gyrus dentatus, CA4, CA3) as well as in the upper layer ofthe cortex and in the Purkinje cell layer ofthe cerebellum.
Compared with heterozygous animals, homozygous individuals exhibit an elevated incidence of perinatal lethality (100% in homozygous animals, versus approximately 20% amongst heterozygous animals), accelerated neurondegeneration in the anterior horns of the spinal cord, and accelerated neurodegeneration in the dorsal root ganglia. Neurodegeneration in heterozygous animals is apparent at a much later stage, i.e. late adulthood.
The term "phenotype" according to the invention refers to a collection of morphological, physiological, behavioral and biochemical traits possessed by a cell or organism that results from the interaction ofthe genotype and the environment. Thus, the animal model of the present invention displays readily observable abnormalities. In a prefened embodiment the animal of the invention shows at least 2, preferably at least 4, more preferably 6 and most preferably all of the above listed phenotypical features.
In the present invention, mice were generated carrying a point mutation in the thirteenth exon (exon 13) ofthe mouse cytoplasmic dynein heavy chainl gene, which is illustrated in SEQ ID NO:l, thereby replacing the tyrosine residue at position 1055 in the N-terminal domain of the protein. This modification results in the above mentioned phenotypical features. Amino acid position 1055 according to the present invention refers to the non-mature cytoplasmic dynein heavy chainl protein, as numbered in SEQ ID NO:4. However, it will be appreciated by the person skilled in art that also the mature protein is encompassed by the present invention and may be expressed in the animal model of the present invention. A mature protein may result from a cleavage of several amino acids, and therefore may alter the numbering of the amino acids in the mature protein relative to the numbering of an unprocessed protein. The tyrosine residue conesponding to the Tyr located at position 1055 in the amino acid sequence of SEQ ID NO:2 is conserved among the cytoplasmic dynein heavy chain proteins of different species as can be seen in the alignment in Table 9. Table 9. Clustal W comparison of wild-type Dynein Heavy Chains
1050 * 1060 1070 1080 1090 2000 gi 1 97172451 MODSE
SEQ ID NO 7
SEQ ID NO 8 gi I 7025519 I HUMAN SEQ ID NO 9 gi 1 17647333 I DROSOPHILA _^S^RN^DEH_^SJ^ ^DM gG|3Jg3^ §IKCJ^DBKQsSTBB3TS-)HRRA^
SEQ ID NO 10 gx I 987229 | PARAMECIUM LI,ED-^^^QT^^sHELDI Q EQl2QI^-;E^EQMΪTD-lκQGi_lftSHsτiεEHS
SEQ ID NO 11 gι | 2494203 | C .ELEGANΞ
SEQ ID NO 12
Thus, the non-human animal model of the present invention canies, e.g., a nucleic acid sequence encoding cytoplasmic dynein heavy chainl, whereby the codon for the amino acid at position 1055 of the amino acid sequence shown in SEQ ID NO:2 or the codon conesponding to said position in other dynein heavy chain proteins (especially cytoplasmic dynein heavy chainl proteins), like position 1057 of the amino acid sequence shown in SEQ ID NO: 18, which encodes a Tyr in the wild type, is mutated to encode a different amino acid. In a prefened embodiment, the animal model of the present invention expresses the amino acid sequence shown in SEQ ID NO:4.
In a prefened embodiment the animal model of the invention canies a modified cytoplasmic dynein heavy chainl nucleic acid sequence derived from a vertebrate, preferably from a mammal, in particular from mouse, for example, a cytoplasmic dynein heavy chainl nucleic acid sequence encoding a cytoplasmic dynein heavy chainl mutein as described in individualized manner in connection with the prefened muteins of the invention above. In a particularly prefened embodiment the nucleic acid sequence is derived from the nucleic acid sequence of SEQ ID NO:l, 3, 5, or 17.
The animal model of the invention preferably expresses a modified cytoplasmic dynein heavy chainl protein of the invention (e.g. as shown in SEQ ID NO:4, or SEQ ID NO:6 or a mutein as described in individualized manner in connection with the prefened muteins above) in all of its cells, and particularly in the brain and spinal cord. However, animals which express the modified cytoplasmic dynein heavy chainl protein in some, but not all cells, which are termed cellular mosaic animals, are also contemplated.
The present invention further provides for inbred successive lines of animals carrying the mutant cytoplasmic dynein heavy chainl nucleic acid of the present invention that offer the advantage of providing a virtually homogenous genetic background. A genetically homogenous line of animals provides a functionally reproducible model system for disorders or symptoms associated with movement hyperactivity, hyperexcitability disorders (e.g. myoclonic cramping, epilepsy), excitotoxicity disorders and neurodegeneration; over-activity or undesirable activity of endogenous cytoplasmic dynein heavy chainl ; over-expression, over-production or undesirable production of endogenous cytoplasmic dynein heavy chainl; excessive or undesirable condition shown to be modulated by endogenous cytoplasmic dynein heavy chainl .
The animal model of the present invention may use any of the cytoplasmic dynein heavy chainl muteins described herein, e.g., those described in an individualized manner in connection with the prefened muteins of the invention above, and is not limited to the modification of the residue at position 1055 of the amino acid sequence shown in SEQ ID NO:4 or at a conesponding position in other dynein heavy chain orthologs (e.g. position 1057 ofthe amino acid sequence shown in SEQ ID NO:6) so long as the mutein used imparts the desired mutant dynein phenotype to the animal ofthe present invention. Suitable muteins include those with modifications in the amino acid sequence of the mouse or human cytoplasmic dynein heavy chainl proteins so long as they impart a phenotype as described herein in connection with the animals ofthe invention. Such muteins may comprise mutations, such as single or multiple further amino acid substitutions, deletions and insertions, particularly mutations that affect the conserved amino acids of mouse or human cytoplasmic dynein heavy chainl, as described, e.g., in an individualized manner in connection with the prefened muteins ofthe invention above. Amino acid insertional derivatives ofthe present invention include amino and or carboxyl terminal fusions as well as intra-sequence insertions of single or multiple amino acids. Insertional amino acid sequence variants are those in which one or more amino acid residues are introduced into a predetermined site in the protein although random insertion is also possible with suitable screening of the resulting product. Deletional variants are characterized by the removal of one or more amino acids from the sequence. Substitutional amino acid variants are those in which at least one residue in the sequence has been removed and a different residue inserted in its place. Preferably, the cytoplasmic dynein heavy chainl expressed in the animal model of the invention has a degree of identity preferably of at least 70%, 75%, 80%, 85%, 90%, 95%, 98%, or most preferably 99%, with the wild type cytoplasmic dynein heavy chainl sequence from vertebrate, preferably from mammals, most preferably from bovine, and from rat and even most preferably from mouse (SEQ ID NO:2), excluding the wild type mouse cytoplasmic dynein heavy chainl sequence itself. In another prefened embodiment, the cytoplasmic dynein heavy chainl expressed in the animal model of the invention is human cytoplasmic dynein heavy chainl (SEQ ID NO: 18) or has a degree of identity preferably of at least 70%, 75%, 80%, 85%, 90%, 95%, 98%, or most preferably 99%, with the human cytoplasmic dynein heavy chainl sequence in SEQ ID NO: 18 (e.g. SEQ ID NO:6). The human wild type cytoplasmic dynein heavy chainl sequence is a further embodiment ofthe invention.
In a particularly prefened embodiment the animal model expresses a polypeptide as shown in SEQ ID NO:4. Further prefened embodiments include the animal model ofthe invention, that expresses a polypeptide selected from those shown in SEQ ID NO:6 and SEQ ID NO: 18. Prefened modifications of the cytoplasmic dynein heavy chainl amino acid sequence in the animal models of the present invention, in addition to the modification at, e.g, position 1055 of the amino acid sequence shown in SEQ ID NO:4, (or in addition to the modification in the equivalent position 1057 of the amino acid sequence shown in SEQ ID NO:6) are at positions which are conserved among the vertebrate dynein heavy chain proteins (especially those conserved among vertebrate cytoplasmic dynein heavy chainl proteins), as described in individualized manner in connection with the prefened muteins above.
Another prefened modification ofthe cytoplasmic dynein heavy chainl amino acid sequence in the animal models of the present invention, in addition to the modification at position 1055 ofthe amino acid sequence shown in SEQ ID NO:4, (or in addition to the modification in the equivalent position 1057 of the amino acid sequence shown in SEQ ID NO: 6) are at positions which are not conserved among the vertebrate dynein heavy chain proteins (especially those not conserved among vertebrate cytoplasmic dynein heavy chainl proteins), as described above.
It will be appreciated that the animal model of the invention may carry a mutated cytoplasmic dynein heavy chainl nucleic acid according to the present invention derived from the same species or from a different species. Preferably, the mutated cytoplasmic dynein heavy chainl nucleic acid of the present invention is homozygous in the animals of the present invention. Preferably, transcription of the mutated cytoplasmic dynein heavy chainl gene of the present invention is under the control of the promoter sequence controlling transcription of the endogenous wild type cytoplasmic dynein heavy chainl sequence of the animal, although a different promoter may be used.
The animals of the invention can be produced by using any technique known to the person skilled in the art; including but not limited to micro-injection, electroporation, cell gun, cell fusion, micro-injection into embryos of teratocarcinoma stem cells or functionally equivalent embryonic stem cells. The animals ofthe present invention may be produced by the application of procedures which result in an animal with a genome that incorporates and/or integrates exogenous genetic material in such a manner as to modify or disrupt the function ofthe normal cytoplasmic dynein heavy chainl gene or protein. The prefened procedure for generating animal models of this invention as described in Example 1.
Alternatively, the procedure may involve obtaining genetic material, or a portion thereof, which encodes a cytoplasmic dynein heavy chainl. The isolated native sequence is then genetically manipulated by the insertion of a mutation appropriate to replace the residue at position 1055 of the amino acid sequence shown in SEQ ID NO:2. The manipulated construct may then be inserted into embryonic stem cells, e.g. by electroporation. The cells subjected to said procedure are screened to find positive cells, e.g. cells which have integrated into their genome the desired construct encoding an altered cytoplasmic dynein heavy chainl . The positive cells may be isolated, cloned (or expanded) and injected into blastocysts obtained from a host animal ofthe same species or a different species. For example, positive cells are injected into blastocysts from mice, the blastocysts are then transfened into a female host animal and allowed to grow to term, following which the offspring of the female are tested to determine which animals are transgenic, e.g. which animals have an inserted exogenous mutated DNA sequence. One method involves the introduction of the recombinant gene at the fertilized oocyte stage ensuring that the gene sequence will be present in all ofthe germ cells and somatic cells ofthe "founder" animal. The term "founder animal" as used herein means the animal into which the recombinant gene was introduced at the one cell embryo stage.
The animals ofthe invention can also be used as a source of primary cells from a variety of tissues, for cell culture experiment, including but not restricted to, the production of immortalized cell lines by any methods known in the art, such as retroviral transformation. Cells from the animals may advantageously exhibit desirable properties of both normal and transformed cultured cells, e.g. they will be normal or nearly normal morphologically and physiologically, but can be cultured for long, and perhaps indefinite periods of time. The present invention provides such primary cells and cell lines derived therefrom, obtained from the animals of the present invention. These primary cells or cell lines derived thereof may be used for the construction of an animal model ofthe present invention.
In other embodiments cell lines may be prepared by the insertion of a nucleic acid construct comprising the nucleic acid sequence of the invention or a fragment thereof comprising the codon imparting the above-described phenotype to the animal model of the invention (vide infra). Suitable cells for the insertion include primary cells harvested from an animal as well as cells which are members of an immortalized cell line. Recombinant nucleic acid constructs ofthe invention, described below, may be introduced into the cells by any method known in the art, including but not limited to, transfection, retroviral infection, micro-injection, electroporation, transduction or DEAE-dextran. Cells which express the recombinant construct may be identified by, for example, using a second recombinant nucleic acid construct comprising a reporter gene which is used to produce selective expression. Cells that express the nucleic acid sequence of the invention or a fragment thereof may be identified indirectly by the detection of reporter gene expression.
Pharmaceutical Compositions The invention also includes pharmaceutical compositions containing mutein nucleic acids or proteins of the invention, e.g. those muteins as described in individualized manner in connection with the prefened muteins of the invention above, as well as pharmaceutical compositions containing antibodies to them. The compositions are preferably suitable for internal use and include an effective amount of a pharmacologically active compound of the invention, alone or in combination, with one or more pharmaceutically acceptable earners. The compounds are especially useful in that they have very low, if any toxicity.
The mutated nucleic acid sequences and muteins of this invention, and antibodies thereto, may be used in pharmaceutical compositions, when combined with a pharmaceutically acceptable canier. As used herein, "pharmaceutically acceptable canier" is intended to include any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like, compatible with pharmaceutical administration. Suitable earners are described in the most recent edition of Remington's Pharmaceutical Sciences (e.g. currently the 18th edition), Alfonso R. Gennaro, ed. (Mack Publishing Co., Easton PA, USA, 1990), a standard reference text in the field, which is incorporated herein by reference. Prefened examples of such carriers or diluents include, but are not limited to, water, saline, finger's solutions, dextrose solution, and 5% human serum albumin. Liposomes and non-aqueous vehicles such as fixed oils may also be used. The use of such media and agents for pharmaceutically active substances is well known in the art. Except insofar as any conventional media or agent is incompatible with the active compound, use thereof in the compositions is contemplated. Supplementary active compounds can also be incorporated into the compositions.
A pharmaceutical composition ofthe invention is formulated to be compatible with its intended route of administration. Examples of routes of administration include parenteral, e.g. intravenous, intradermal, subcutaneous, oral (e.g. inhalation), transdermal (e.g. topical), transmucosal, and rectal administration. Solutions or suspensions used for parenteral, intradermal, or subcutaneous application can include the following components: a sterile diluent such as water for injection, saline solution, fixed oils, polyethylene glycols, glycerine, propylene glycol or other synthetic solvents; antibacterial agents such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as ethylenediaminetetraacetic acid (EDTA); buffers such as acetates, citrates or phosphates, and agents for the adjustment of tonicity such as sodium chloride or dextrose. The pH can be adjusted with acids or bases, such as hydrochloric acid or sodium hydroxide. The parenteral preparation can be enclosed in ampoules, disposable syringes or multiple dose vials made of glass or plastic.
Pharmaceutical compositions suitable for injectable use include sterile aqueous solutions (where water soluble) or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion. For intravenous administration, suitable carriers include physiological saline, bacteriostatic water, Cremophor EL™ (BASF, Parsippany, NJ, U.S.A.) or phosphate buffered saline (PBS). In all cases, the composition must be sterile and should be fluid to the extent that easy syringeability exists. It must be stable under the conditions of manufacture and storage and must be preserved against the contaminating action of microorganisms such as bacteria and fungi. The carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), and suitable mixtures thereof. The proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance ofthe required particle size in the case of dispersion and by the use of surfactants. Prevention of the action of microorganisms can be achieved by various antibacterial and antifiingal agents, for example, parabens, chlorobutanol, phenol, ascorbic acid, thimerosal, and the like. In many cases, it will be preferable to include isotonic agents, for example, sugars, polyalcohols such as manitol, sorbitol, sodium chloride in the composition. Prolonged absorption of the injectable compositions can be brought about by including in the composition an agent which delays absorption, for example, aluminum monostearate and gelatin. For instance, for oral administration in the form of a tablet or capsule (e.g. a gelatin capsule), the active drug component can be combined with an oral, non-toxic pharmaceutically acceptable inert carrier such as ethanol, glycerol, water and the like. Moreover, when desired or necessary, suitable binders, lubricants, disintegrating agents and coloring agents can also be incorporated into the mixture. Suitable binders include starch, magnesium aluminum silicate, starch paste, gelatin, methylcellulose, sodium carboxymethylceUulose and/or polyvinylpynolidone, natural sugars such as glucose or beta-lactose, corn sweeteners, natural and synthetic gums such as acacia, tragacanth or sodium alginate, polyethylene glycol, waxes and the like. Lubricants used in these dosage forms include sodium oleate, sodium stearate, magnesium stearate, sodium benzoate, sodium acetate, sodium chloride, silica, talcum, stearic acid, its magnesium or calcium salt and/or polyethyleneglycol and the like. Disintegrators include, without limitation, starch, methyl cellulose, agar, bentonite, xanthan gum starches, agar, alginic acid or its sodium salt, or effervescent mixtures, and the like. Examples of diluents include, without limitation, lactose, dextrose, sucrose, mannitol, sorbitol, cellulose and/or glycine.
Injectable compositions are preferably aqueous isotonic solutions or suspensions, and suppositories are advantageously prepared from fatty emulsions or suspensions. The compositions may be sterilized and/or contain adjuvants, such as preserving, stabilizing, wetting or emulsifying agents, solution promoters, salts for regulating the osmotic pressure and/or buffers. In addition, they may also contain other therapeutically valuable substances. The compositions are prepared according to conventional mixing, granulating or coating methods, respectively, and contain about 0.1 to 75%, preferably about 1 to 50%, ofthe active ingredient.
The compounds ofthe invention can also be administered in such oral dosage forms as timed release and sustained release tablets or capsules, pills, powders, granules, elixers, tinctures, suspensions, syrups and emulsions.
Liquid, particularly injectable compositions can, for example, be prepared by dissolving, dispersing, etc. The active compound is dissolved in or mixed with a pharmaceutically pure solvent such as, for example, water, saline, aqueous dextrose, glycerol, ethanol, and the like, to thereby form the injectable solution or suspension. Additionally, solid forms suitable for dissolving in liquid prior to injection can be formulated. Injectable compositions are preferably aqueous isotonic solutions or suspensions. The compositions may be sterilized and or contain adjuvants, such as preserving, stabilizing, wetting or emulsifying agents, solution promoters, salts for regulating the osmotic pressure and/or buffers. In addition, they may also contain other therapeutically valuable substances.
The compounds of the present invention can be administered in intravenous
(both bolus and infusion), intraperitoneal, subcutaneous or intramuscular form, all using forms well known to those of ordinary skill in the pharmaceutical arts.
Injectables can be prepared in conventional forms, either * as liquid solutions or suspensions.
Parental injectable administration is generally used for subcutaneous, intramuscular or intravenous injections and infusions. Additionally, one approach for parenteral administration employs the implantation of a slow-release or sustained- released systems, which assures that a constant level of dosage is maintained, according to U.S. Pat. No. 3,710,795, incorporated herein by reference.
Furthermore, prefened compounds for the present invention can be administered in intranasal form via topical use of suitable intranasal vehicles, or via transdermal routes, using those forms of transdermal skin patches well known to those of ordinary skill in that art. To be administered in the form of a transdermal delivery system, the dosage administration will, of course, be continuous rather than intermittent throughout the dosage regimen. Other prefened topical preparations include creams, ointments, lotions, aerosol sprays and gels, wherein the concentration of active ingredient would range from 0.1 % to 15 %, w/w or w/v.
For solid compositions, excipients include pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharin, talcum, cellulose, glucose, sucrose, magnesium carbonate, and the like may be used. The active compound defined above, may be also formulated as suppositories using for example, polyalkylene glycols, for example, propylene glycol, as the canier. In some -I l l- embodiments, suppositories are advantageously prepared from fatty emulsions or suspensions.
The compounds of the present invention can also be administered in the form of liposome delivery systems, such as small unilamellar vesicles, large unilamellar vesicles and multilamellar vesicles. Liposomes can be formed from a variety of phospholipids, containing cholesterol, stearylamine or phosphatidylcholines. In some embodiments, a film of lipid components is hydrated with an aqueous solution of drug to a form lipid layer encapsulating the drug, as described in U.S. Pat. No. 5,262,564.
Compounds of the present invention may also be delivered by the use of monoclonal antibodies as individual earners to which the compound molecules are coupled. The compounds of the present invention may also be coupled with soluble polymers as targetable drug earners. Such polymers can include polyvinylpynolidone, pyran copolymer, polyhydroxypropyl-methacrylamide-phenol, polyhydroxyethylaspanamidephenol, or polyethyleneoxidepolylysine substituted with palmitoyl residues. Furthermore, the compounds of the present invention may be coupled to a class of biodegradable polymers useful in achieving controlled release of a drug, for example, polylactic acid, polyepsilon caprolactone, polyhydroxy butyric acid, polyorthoesters, polyacetals, polydihydropyrans, polycyanoacrylates and cross- linked or amphipathic block copolymers of hydrogels.
If desired, the pharmaceutical composition to be administered may also contain minor amounts of non-toxic auxiliary substances such as wetting or emulsifying agents, pH buffering agents, and other substances such as for example, sodium acetate, triethanolamine oleate, etc.
The dosage regimen utilizing the compounds is selected in accordance with a variety of factors including type, species, age, weight, sex and medical condition of the patient; the severity ofthe condition to be treated; the route of administration; the renal and hepatic function of the patient; and the particular compound or salt thereof employed. An ordinarily skilled physician or veterinarian can readily determine and prescribe the effective amount of the drug required to prevent, counter or anest the progress ofthe condition. Oral dosages of the present invention, when used for the indicated effects, will range between about 0.05 to 1000 mg/day orally. The compositions are preferably provided in the fonn of scored tablets containing 0.5, 1.0, 2.5, 5.0, 10.0, 15.0, 25.0, 50.0, 100.0, 250.0, 500.0 and 1000.0 mg of active ingredient. Effective plasma levels of the compounds of the present invention range from 0.002 mg to 50 mg per kg of body weight per day.
Compounds of the present invention may be administered in a single daily dose, or the total daily dosage may be administered in divided doses of two, three or four times daily.
Any of the above pharmaceutical compositions may contain 0.1-99%, preferably 1-70% ofthe cytoplasmic dynein heavy chainl polypeptide.
If desired, the pharmaceutical compositions can be provided with an adjuvant. Adjuvants are discussed above. In some embodiments, adjuvants can be used to increase the immunological response, depending on the host species, include Freund's (complete and incomplete), mineral gels such as aluminum hydroxide, surface active substances such as lysolecithin, pluronic polyols, polyanions, peptides, oil emulsions, keyhole limpet hemocyanin, dinitrophenol, and potentially useful human adjuvants such as BCG (bacille Calmette-Guerin) and Corynebacterium parvum. Generally, animals are injected with antigen using several injections in a series, preferably including at least three booster injections.
Assays and Diagnostics
The animals ofthe present invention present a phenotype whose characteristics are representative of many symptoms associated with disorders associated with dynein heavy chain deficiency (especially cytoplasmic dynein heavy chainl deficiency), therefore making the animal model of the present invention a particularly suitable model for the study of these diseases including movement hyperactivity, hyperexcitability disorders (e.g. myoclonic cramping, epilepsy), excitotoxicity disorders and neurodegeneration; over-activity or undesirable activity of endogenous cytoplasmic dynein heavy chainl; over-expression, over-production or undesirable production of endogenous cytoplasmic dynein heavy chainl; excessive or undesirable condition shown to be modulated by endogenous cytoplasmic dynein heavy chainl . In particular the animal model of the invention presents a phenotype characterized by cramping,movement hyperactivity; excitatory neuronal damage in the CA3 and CA4 sector of the hippocampus, as well as in the upper layer of the cortex and in the Purkinje cell layer ofthe cerebellum and neurondegeneration. These are all phenotypical characteristics of human diseases related to hyperexcitability and neurodegeneration, such as epilepsy, Alzheimer's disease, Huntington's disease, and Parkinson's disease. Therefore, the animals of the invention can be used to study diseases or symptoms associated with movement hyperactivity and impairment, hyperexcitability disorders (e.g. myoclonic cramping, epilepsy), excitotoxicity disorders, cognitive disorders and neurodegeneration in general.
The animals of the present invention can also be used to identify early diagnostic markers for diseases associated with cytoplasmic dynein heavy chainl deficiency. Sunogate markers, including but not limited to ribonucleic acids or proteins, can be identified by performing procedures of proteomics or gene expression analysis known in the art. For example procedures of proteomics analysis include, but are not restricted to, ELISA, 2D-gel, protein microanays or mass spectrophotometric analysis of any organ or tissue samples, such as blood samples, or derivatives thereof, preferably plasma, at different age or stage of cytoplasmic dynein heavy chainl activity deficiency associated disease development, or symptom thereof. As a further example, gene expression analysis procedures include, but are not restricted to, differential display, cD A microanays, analysis of quality and quantity of ribonucleic acids species from any organ or tissue samples, such as blood samples, or derivatives thereof, at different age or stage of development of cytoplasmic dynein heavy chainl. activity deficiency associated disease, or symptom thereof.
The animal model of the present invention can be used to monitor the activity of agents useful in the prevention or treatment of the above-mentioned diseases and disorders. The agent to be tested can be administered to an animal of the present invention and various phenotypic parameters can be measured or monitored. In a further embodiment the animals of the invention may be used to test therapeutics against any disorders or symptoms that have been shown to be associated with cytoplasmic dynein heavy chainl deficiency or overexpression.
The animals ofthe present invention can also be used as test model systems for materials, including but not restricted to chemicals and peptides, particularly medical drugs, suspected of promoting or aggravating the above-described diseases associated with cytoplasmic dynein heavy chainl deficiency. For example, the material can be tested by exposing the animal of the present invention to different time, doses and/or combinations of such materials and by monitoring the effects on the phenotype of the animal of the present invention, including but not restricted to movement activity; latency to fall in a hanging wire assay, motor coordination test assays, such as rotarod, stationary beam and coat hanger motor performance, excitatory neuronal damage in the hippocampus (CA3, CA4 and gyrus dentatus) and in the pyramidal area of the cortex, histopathological and biochemical parameters of motor neuron degeneration and spinal muscular atrophy, as well as tracer experiments to determine the functionality ofthe retrograd axonal transport.
Furthermore, the animals of the present invention may be used for the dissection of the molecular mechanisms of the cytoplasmic dynein heavy chainl pathway, that is for the identification of downstream genes or proteins thereof regulated by cytoplasmic dynein heavy chainl activity and deregulated in cytoplasmic dynein heavy chainl activity deficiency associated disorders. For example, this can be done by performing differential proteomics analysis, using techniques including but not restricted to 2D gel analysis, protein chip microanays or mass spectrophotometry, on tissues of the animal of the present invention which express cytoplasmic dynein heavy chainl and which respond to cytoplasmic dynein heavy chainl stimuli.
The animal model of the present invention can be used to identify and clone so-called modifier genes which are able to modify, aggravate, reduce or inhibit the phenotype associated with a cytoplasmic dynein heavy chainl activity deficiency. Particularly, for this purpose, the animal model ofthe present invention can be mated to mice of different strains canying a different genetic background, which gives the possibility to map the genes modifying the phenotype. For example, the animal model of the present invention, when produced in an C3HeB/FeJ inbred strain background can be bred to C57Bl/6Jico inbred mice. The hybrid animals of this progeny, are then further bred, either in back-cross strategy with C57Bl/6Jico inbred mice again, or in an intercross strategy between each other. The modifier gene can be then mapped and cloned by using microsattelites or a single nucleotide polymorphism (SNP) strategy on the mice resulting from the backcross or intercross breeding that have been grouped with respect to their phenotype intensity.
An exemplary method for detecting the presence or absence of cytoplasmic dynein heavy chainl in a biological sample, e.g. a mutein of the present invention, e.g., those described in individualized manner in connection with the prefened muteins of the invention above, involves obtaining a biological sample from a test subject and contacting the biological sample with a compound or an agent capable of detecting cytoplasmic dynein heavy chainl protein, mutein, or nucleic acid (e.g. mRNA, genomic DNA) that encodes cytoplasmic dynein heavy chainl protein or mutein such that the presence of cytoplasmic dynein heavy chainl is detected in the biological sample. An agent for detecting cytoplasmic dynein heavy chainl mRNA or genomic DNA is a labeled nucleic acid probe capable of hybridizing to cytoplasmic dynein heavy chainl mRNA or genomic DNA.
The diagnostic methods described herein can furthermore be utilized to identify subjects having or at risk of developing a disease or disorder associated with abenant cytoplasmic dynein heavy chainl expression or activity. For example, the assays described herein, such as the preceding diagnostic assays or the following assays, can be utilized to identify a subject having or at risk of developing a disorder associated with cytoplasmic dynein heavy chainl protein, nucleic acid expression or activity. Alternatively, the prognostic assays can be utilized to identify a subject having or at risk for developing a disease or disorder. Thus, the invention provides a method for identifying a disease or disorder associated with abenant cytoplasmic dynein heavy chainl expression or activity in which a test sample is obtained from a subject and cytoplasmic dynein heavy chainl protein or nucleic acid (e.g. mRNA, genomic DNA) is detected, wherein the presence of cytoplasmic dynein heavy chainl protein or nucleic acid is diagnostic for a subject having or at risk of developing a disease or disorder associated with abenant cytoplasmic dynein heavy chainl expression or activity. As used herein, a "test sample" refers to a biological sample obtained from a subject of interest. For example, a test sample can be a biological fluid (e.g., blood, plasma, serum), cell sample, or tissue.
Furthermore, the prognostic assays described herein can be used to determine whether a subject can be administered an agent (e.g. an agonist, antagonist, peptidomimetic, protein, peptide, nucleic acid, small molecule, or other drug candidate) to treat a disease or disorder associated with abenant cytoplasmic dynein heavy chainl expression or activity. For example, such methods can be used to determine whether a subject can be effectively treated with an agent for a disorder.
Agents, or modulators that have a stimulatory or inhibitory effect on cytoplasmic dynein heavy chainl activity (e.g. cytoplasmic dynein heavy chainl gene expression), as identified by a screening assay described herein can be administered to individuals to treat (prophylactically or therapeutically) cytoplasmic dynein heavy chainl -mediated disorders. Differences in metabolism of therapeutics can lead to severe toxicity or therapeutic failure by altering the relation between dose and blood concentration of the pharmacologically active drug. Thus, the pharmacogenomics of the individual permits the selection of effective agents (e.g. drugs) for prophylactic or therapeutic treatments based on a consideration of the individual's genotype. Such pharmacogenomics can further be used to determine appropriate dosages and therapeutic regimens. Accordingly, the activity of cytoplasmic dynein heavy chainl protein, expression of cytoplasmic dynein heavy chainl nucleic acid, or mutation content of cytoplasmic dynein heavy chainl genes in an individual can be determined to thereby select one or more appropriate agents for therapeutic or prophylactic treatment ofthe individual.
The present invention also provides a diagnostic method for cytoplasmic dynein heavy chainl activity deficiency. Patients' peptide material, particularly that in or from blood, serum or plasma, is subjected to analysis for one or more of the amino acid sequences ofthe present invention. The peptide material may be analyzed directly or after extraction, isolation and/or purification by standard methods.
In one embodiment of the invention, the diagnostic method comprises the identification of the modified cytoplasmic dynein heavy chainl, e.g., modified as described in individualized manner in connection with the prefened muteins of the invention above, whereby the modification is, e.g., associated with the replacement of an amino acid at a position conesponding to position 1055 in the amino acid sequence shown in SEQ ID NO:2. In another embodiment of the invention, the diagnostic method comprises the identification of the modified cytoplasmic dynein heavy chainl , e.g., the mutein as described in individualized manner in connection with the prefened muteins of the invention above, whereby the modification is, e.g., associated with the replacement of an amino acid at a position conesponding to position 1057 in the amino acid sequence shown in SEQ ID NO: 18. In yet another embodiment of the invention, the diagnostic method comprises the identification of the modified cytoplasmic dynein heavy chainl,. e.g., modified as described in individualized manner in connection with the prefened muteins of the invention above, wherein the modification is, e.g., associated with the replacement of an amino acid at a position that is conserved between the vertebrate cytoplasmic dynein heavy chainl proteins. Such diagnostic methods include those employing detection of the modified cytoplasmic dynein heavy chainl by its failure to activate a biological pathway. The diagnostic methods of the invention also include those employing detection of the modified cytoplasmic dynein heavy chainl by its activity in competing with and blocking the action of native dynein heavy chain. Methods of identifying the modified cytoplasmic dynein heavy chainl include any methods known in the art which are able to identify altered conformational properties of the amino acid sequence of the present invention compared to those of the wild type cytoplasmic dynein heavy chainl. These include, without limitation, the specific recognition of the modified protein by other proteins, particularly antibodies; individual or combined patterns of amino acid sequence digestion by known proteases or chemicals. In an additional, similar embodiment, the method exploits the failure of another protein to recognize the modified protein, examples being antibodies directed to an epitope of wild type cytoplasmic dynein heavy chainl that incorporates residue 1055 of SEQ ID NO:2, or SEQ ID NO: 18, and cytoplasmic dynein heavy chainl receptors in which this portion ofthe molecular surface of wild type cytoplasmic dynein heavy chainl is recognized or involved in cytoplasmic dynein heavy chainl activation.
In a further embodiment of the present invention, the principle of the diagnostic method is the detection of a nucleic acid sequence encoding the modified cytoplasmic dynein heavy chainl ofthe invention. This includes, but is not restricted to any methods known in the art using nucleic acid hybridizing properties, such as Northern blot, Southern blot, nucleic acid (genomic DNA, cDNA, mRNA, synthetic oligonucleotides) standard methods employing microanays, and patterns of nucleic acid digestion by known restriction enzymes.
Subunits of the Dynactin/Dynein Complex
As explained above, the present invention is not only concerned with the identification of neurodegenerative disease relevant mutations in the dynein heavy chain 1 gene, but is also based on the recognition that other components (hereinafter also refened to as "subunits") of the dynactin/dynein complex may likewise be subject to mutations that are involved in, or affect, the pathogenesis of such diseases. When reference is made in the present specification to subunits ofthe dynactin/dynein complex, these subunits include in particular the cytoplasmic dynein heavy chain 1, cytoplasmic dynein intermediate chain 1, cytoplasmic dynein intermediate chain 2, cytoplasmic dynein light intermediate chain 1, cytoplasmic dynein light intermediate chain 2; cytoplasmic dynein 10 kDa light chain, cytoplasmic dynein light chain Tctex 1, cytoplasmic dynein light chain 2B, DCTN 1, DCTN 2, DCTN 3, DCTN 4, DCTN 5, DCTN 6, ARP1, ARP11, HAPl, and CLIP-170, preferably encoded by the genomic nucleic acid sequences identified in Table 25, or defined by the amino acid sequences identified in Tables 26, 27, and 29-35.
Table 25. Subunits of the Dynein Complex and their genomic sequences assigned as NCBI contig Accession Numbers (Gen Bank Ace. No., except where otherwise indicated) (NCBI contigs are derived from genomic sequence data assembled by NCBI staff)
* Mouse Genome Informatics Tool ofthe Jackson Laboratory Accession No.
Table 26. Cytoplasmic dynein intermediate chainl amino acid sequence (SEQ ID NO.: 61)
GenBankAccessionNo.: NP_034193.1(mouse)
MSDKSDLKAELERKKQRLAQIREEKKRKEEERKKKEADMQQKKEPVQDDSDLDRKRRETEALLQSIGIS PEPPLVPTPMSPSSKSVSTPSDAGSQDSGDLGPLTRTLQ DTDPSVLQLQSDSELGRRLHKLGVSKVTQ VDFLPREVVSYSKETQTPLATHQSEEDEEDEEMVEPKIGHDSELENQEKKQETKEAPPRELTEEEKQQI LHSEEFLIFFDRTIRVIERALAEDSDIFFDYSGRELEEKDGDVQAGANLSFNRQFYDEHWSKHRVVTCM D SLQYPE MVASYSNNEDAPHEPDGVALV NMKFKKTTPEYVFHCQSSVMSVCFARFHPNLVVGGTYS GQIVL DNRSHRRTPVQRTPLS-AAHTHPVYCVNVVGTHNARNLITVSTDGKMCSWSLDMLSTPQES E LVYNKSKPVAVTGMAFPTGDVNNFWGSEEGTVYTACRHGSKAGIGEVFEGHQGPVTGINCHMAVGPID FSHLFVTSSFDWTVKL TTKHNKPVYSSEDNADYVYDVM SPVHPALFACVDGMGRLDL NLNSDTEVP TASVAIEGASA NRVRWAQGGKEVAVGDSEGRIWIYDVGELAVPHNDEWTRFARTLVEIRANRADSEEE
GAVELAA
Table 27. Cytoplasmic dynein intermediate chainl amino acid sequence (SEQ ID NO.: 62)
Gen Bank Accession No.: NP_004402.1 (human) MSDKSDLKAELERKKQRLAQIREEKKRKEEERKKKEADMQQKKEPVQDDSDLDRKRRETEALLQSIGIS PEPPLVQPLHFLT DTCYFHYLVPTPMSPSSKSVSTPSEAGSQDSGDLGPLTRTLQ DTDPSVLQLQSD SELGRRLHKLGVSKVTQVDFLPREVVSYSKETQTPLATHQSEEDEEDEE VESKVGQDSELENQDKKQE VKEAPPRELTEEEKQQILHSEEFLIFFDRTIRVIERALAEDSDIFFDYSGRELEEKDGDVQAGANLSFN RQFYDEH SKHRVVTCMDWSLQYPELMVASYNNNEDAPHEPDGVALVWNMKFKKTTPEYVFHCQSSVMS VCFARFHPNLVVGGTYSGQIV DNRSHRRTPVQRTP SAAAHTHPVYCVNVVGTQNAHNLITVSTDGK MCSWSLDMLSTPQESMELVYNKSKPVAVTGMAFPTGDVNNFWGSEEGTVYTACRHGSKAGIGEVFEGH QGPVTGINCHMAVGPIDFSHLFVTSSFDWTVKL TTKHNKPLYSFEDNADYVYDV SPVHPALFACVD GMGRLDL NLNNDTEVPTASVAIEGASALNRVR AQAGKEVAVGDSEGRI VYDVGELAVPHNDE TRF ARTLVEIRANRADSEEEGTVELSA
Table 29. Cytoplasmic dynein intermediate chainl amino acid sequence (SEQ ID NO.: 63)
Gen Bank Accession No. : NP_062107.1 (rat)
MSDKSDLKAELERKKQRLAQIREEKKRKEEERKKKEADMQQKKEPVPDDSDLDRKRRETEALLQSIGIS PEPPLVQPLHFLTWDTCYFHYLVPTPMSPSSKSVSTPSEAGSQDDLGPLTRTLQ DTDPSVLQLQSDSE LGRRLNKLGVSKVTQVDFLPREWSYSKETQTPLATHQSEEDEEDEEMVEPKVGHDSELENQDKKQETK EAPPRELTEEEKQQILHSEEFLIFFDRTIRVIERALAEDSDIFFDYSGRELEEKDGDVQAGANLSFNRQ FYDEH SKHRWTCMD SLQYPELMVASYSNNEDAPHEPDGVALV NMKFKKTTPEYVFHCQSSVMSVC FARFHPNLWGGTYSGQIVL DNRSHRRTPVQRTPLSAAAHTHPVYCVNWGTQNAHNLITVSTDGKMC SWSLDMLSTPQESMELVYNKSKPVAVTGMAFPTGDVNNFWGSEEGTVYTACRHGSKAGIGEVFEGHQG PVTGINCHMAVGPIDFSHLFVTSSFDWTVKL TTKHNKPLYSFEDNADYVYDVM SPVHPALFACVDGM GR DL NLNSDTEVPTASVAIEGAYALNRVRWAQGGKEVAVGDSEGRIWIYDVGELAVPHNDEWTRFAR TLVEIRANRADSEEEGAVELAA
Table 30. Cytoplasmic dynein intermediate chain 2 amino acid sequence (SEQ ID NO.: 64)
Gen Bank Accession No.: NP_034194.1(mouse)
MSDKSDLKAELERKKQRLAQIREEKKRKEEERKKKETDQKKEAAVSVQEESDLEKKRREAEALLQSMGL TTDSPIVPPPMSPSSKSVSTPSEAGSQDSGDGAVGSRRGPIKLGMAKITQVDFPPREIVTYTKETQTPV TAQPKEDEEEEDDVATPKPPVEPEEEKTLKKDEENDSKAPPHELTEEEKQQILHSEEFLSFFDHSTRIV ERALSEQINIFFDYSGRDLEDKEGEIQAGAKLSLNRQFFDERWSKHRVVSCLD SSQYPELLVASYNNN EEAPHEPDGVALVWNMKYKKTTPEYVFHCQSAV sATFAKFHPNLVVGGTYSGQIVL DNRSNKRTPVQ RTPLSAAAHTHPVYCVNWGTQNAHNLISISTDGKICS SLDMLSHPQDSMELVHKQSKAVAVTSMSFP VGDVNNFVVGSEEGSVYTACRHGSKAGISEMFEGHQGPITGIHCHAAVGAVDFSHLFVTSSFD TVKLW TTKNNKPLYSFEDNSDYVYDV SPTHPALFACVDGMGRLDLWNLNNDTEVPTASISVEGNPALNRVR THSGREIAVGDSEGQIVIYDVGEQIAVPRNDE ARFGRTLAEINANRADAEEEAATRIPA
Table 31. Cytoplasmic dynein intermediate chain 2 amino acid sequence (SEQ ID NO.: 65)
Gen Bank Accession No.: NP_001369.l(human)
SDKSELKAELER KQRLAQIREEKKRKEEERKKKETDQKKEAVAPVQEESDLEKKRREAEALLQSMGL TPESPIVFSEYWVPPPMSPSSKSVSTPSEAGSQDSGDGAVGSRTLHWDTDPSVLQ HSDSDLGRGPIKL GMAKITQVDFPPREIVTYTKETQTPVMAQPKEDEEEDDDVVAPKPPIEPEEEKTLKKDEENDSKAPPHE LTEEEKQQILHSEEFLSFFDHSTRIVERALSEQINIFFDYSGRDLEDKEGEIQAGAKLSLNRQFFDER SKHRVVSCLDWSSQYPEL VASYNNNEDAPHEPDGVALV NMKYKKTTPEYVFHCQSAVMSATFAKFHP NLWGGTYSGQIVL DNRSNKRTPVQRTPLSAAAHTHPVYCVNWGTQNAHNLISISTDGKICSWSLDM LSHPQDSMELVHKQSKAVAVTSMSFPVGDVNNFWGSEEGSVYTACRHGSKAGISEMFEGHQGPITGIH CHAAVGAVDFSHLFVTSSFD TVKLWTTKNNKPLYSFEDNADYVYDVMWSPTHPALFACVDGMGRLDLW N NNDTEVPTASISVEGNPALNRVRWTHSGREIAVGDSEGQIVIYDVGEQIAVPRNDEWARFGRT AEI NANRADAEEEAATRIPA
Table 32. Cytoplasmic dynein intermediate chain 2 amino acid sequence (SEQ ID NO.: 66)
Gen Bank Accession No.: NP_446332.1(rat)
MSDKSELKAELERKKQRLAQIREEKKRKEEERKKKETDQKKEAAVSVQEESDLEKKRREAEALLQSMGL TTDSPIVFSEH VPPPMSPSSKSVSTPSEAGSQDSGDGAVGSRTLH DTDPSALQLHSDSDLGRGPIKL GMAKITQVDFPPREIVTYTKETQTPVTAQPKEDEEEEDDVAAPKPPVEPEEEKILKKDEENDSKAPPHE LTEEEKQQILHSEEFLSFFDHSTRIVERALSEQINIFFDYSGRDLEDKEGEIQAGAKLSLNRQFFDER SKHRVVSCLD SSQYPELLVASYNNNEEAPHEPDGVALV NMKYKKTTPEYVFHCQSAVMSATFAKFHP NLWGGTYSGQIVLWDNRSNKRTPVQRTPLS7^AAHTHPVYCVNWGTQNAHNLISISTDGKICSWSLDM LSHPQDSME VHKQSKAVAVTSMSFPVGDVNNFVVGSEEGSVYTACRHGSKAGISEMFEGHQGPITGIH CHAAVGAVDFSHLFVTSSFDWTVKL STKNNKPLYSFEDNSDYVYDVIGSPTHPALFACVDGMGRLDL NLNNDTEVPTASISVEGNPALNRVR THSGREIAVGDSEGQIVIYDVGEQIAVPRNDE ARFGRTLAEI NASRADAEEEAATRIPA
Table 33. DCTNl; Dynactin subunit pl50 amino acid sequence (SEQ ID NO.: 67)
Gen Bank Accession No.: NPJ)31861.1 pl50 (mouse) AQSRRHMSSRTPSGSRMSTEASARPLRVGSRVEVIGKGHRGTVAYVGATLFATGKVGVILDEAKGKN DGTVQGRKYFTCDEGHGIFVRQSQIQVFEDGADTTSPETPDSSASKVLKREGADAAAKTSKLRGLKPKK APTARKTTTRRPKPTRPASTGVAGPSSSLGPSGSASAGELSSSEPSTPAQTPLAAPIIPTPALTSPGAA PPLPSPSKEEEGLRAQVRDLEEKLETLRLKRSEDKAKLKELEKHKIQLEQVQE KSKMQEQQADLQRRL KEARKEAKEALEAKERYMEEMADTADAIEMATLDKEMAEERAESLQQEVEALKERVDELTTDLEILKAE IEEKGSDGAASSYQLKQLEEQNARLKDALVRMRDLSSSEKQEHVKLQKLMEKKNQELEVVRQQRERLQE ELSQAESTIDELKEQVDAALGAEEMVEMLTDRNLNLEEKVRELRETVGDLEAMNEMNDXLQENARETEL ELREQLDMAGARVREAQKRVEAAQETVADYQQTIKKYRQLTAHLQDVNRELTNQQEASVERQQQPPPET FDFKIKFAETKAHAKAIEMELRQMEVAQANRH S LTAFMPDSFLRPGGDHDCVLVL LMPRLICKAEL IRKQAQEKFDLSENCSERPGLRGAAGEQLSFAAGLVYSLSLLQAT HRYEHALSQCSVDVYKKVGSLYP EMSAHERSLDFLIELLHKDQLDETVNVEPLNKGIKYYQHLYRIHLAEQPEDST QLADHIKFTQSALDC MGVEVGRLRAFLQGGQEATDIALLLRD ETSCSDTRQFCKKIRRRMPGTDAPGIPAALAFGSQVSDTLL DCRKHLT VVAVLQEVAAAAAQLIAPLAENEGLPVAALEELAFKASEQIYGSPSSSPYEC RQSCTILI STMNKLATAMQEGEYDAERPPSKPPPVELRAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEEL SEANVRXSLLEKKLDSAAKDADERIEKVQTRLDETQTLLRKKEKDFEETMDALQADIDQLEAEKAELKQ RLNSQSKRTIEGLRGPPPSGIATLVSGIAGEEPQRGGAPGQAPGALPGPGLVKDSPLLLQQISAMRLHI SQLQHENSILRGAQMKASLAA PPLHVAKLSLPPHEGPGGNLVAGALYRKTSQLLEKLNQLSTHTHWD ITRSSPAAKSPSAQLMEQVAQLKS SDTIEKLKDEVLKETVTQRPGATVPTDFATFPSSAF RAKEEQQ DDTVYMGKVTFSCAAGLGQRHRLVLTQEQLHQLHSRLIS
Table 34. DCTNl; Dynactin subunit pl50 amino acid sequence (SEQ ID NO.: 68)
Gen Bank Accession No.: AAD55811.1 (human)
MAQSKRHVYSRTPSGSRMSAEASARPLRVGSRVEVIGKGHRGTVAYVGATLFATGK VGVILDEAKGKN DGTVQGRKYFTCDEGHGIFVRQSQIQVFEDGADTTSPETPDSSASKVLKREGTDTTAKTSKLRGLKPKK APTARKTTTRRPKPTRPASTGVAGASSSLGPSGSASAGELSSSEPSTPAQTP AAPIIPTPVLTSPGAV PPLPSPSKEEEGLRAQVRDLEEKLET RLKRAEDKAKLKELEKHKIQLEQVQE KSKMQEQQADLQRRL KEARKEAKEALEAKERYMEEMADTADAIEMATLDKEMAEERAESLQQEVEA KERVDE TTDLEI KAE IEEKGSDGAASSYQLKQLEEQNARLKDALVRMRDLSSSEKQEHVKLQKLMEKKNQELEWRQQRERLQE ELSQAESTIDELKEQVDAALGAEEMVEMLTDRNLNLEEKVRELRETVGDLEAMNEMNDELQENARETEL ELREQLDMAGARVREAQKRVEAAQETVADYQQTIKKYRQLTAHLQDVNRELTNQQEASVERQQQPPPET FDFKIKFAETKZVHAKAIEMELRQMEVAQANRHMSLLTAFMPDSFLRPGGDHDCVLVLLLMPRLICKAEL IRKQAQEKFELSENCSERPGLRGAAGEQLSFAAGLVYSLSL QATLHRYEHALSQCSVDVYKKVGSLYP EMSAHERS DFLIELLHKDQLDETVNVEPLTKAIKYYQHLYSIHLAEQPEDCTMQLADHIKFTQSALDC MSVEVGRLRAFLQGGQEATDIALLLRDLETSCSDIRQFCKKIRRRMPGTDAPGIPAALAFGPQVSDTLL DCRKHLT VVAVLQEVAAAAAQ IAPLAENEGLLVAALEELAFKASEQIYGTPSSSPYECLRQSCNILI STMNKLATAMQEGEYDAERPPSKPPPVELRAAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEEL SEANVRLSLLEKKLDSAAKDADERIEKVQTRLEETQALLRKKEKEFEETMDALQADIDQLEAEKAELKQ RLNSQSKRTIEGLRGPPPSGIATLVSGIAGEEQQRGAIPGQAPGSVPGPGLVKDSPLLLQQISAMRLHI SQLQHENSILKGAQMKASLASLPPLHVAKLSHEGPGSELPAGALYRKTSQLLETLNQLSTHTHWDITR TSPAAKSPSAQLMEQVAQLKSLSDTVEKLKDEVLKETVSQRPGATVPTDFATFPSSAFLRAKEEQQDDT VYMGKVTFSCAAGFGQRHRLVLTQEQLHQLHSRLIS
Table 35. DCTNl; Dynactin subunit pl50 amino acid sequence (SEQ ID NO.: 69)
Gen Bank Accession No.: NP_077044.1 (rat)
MAQSKRHMYNRTPSGSRMSTEASARPLRVGSRVEVIGKGHRGTVAYVGATLFATGK VGVILDEAKGKN DGTVQGRKYFTCDEGHGIFVRQSQIQVFEDGADTTSPETPDSSASKILKREGADAAAKTSKLRGLKPKK APTARKTTTRRPKPTRPASTGVAGPSSSLGPSGSASAGELSSSEPSTPAQTPLAAPIIPTPALTSPGAA PPLPSPSKEEEGLRDQVRDLEEKLETLRLKRSEDKAKLKELEKHKIQLEQVQE KSKMQEQQADLQRRL KEAKEAKEALEAKERYMEEMADTADAIEMATLDKEMAEERAESLQQEVEALKERVDELTTDLEILKAEI EEKGSDGAASSYQLKQLEEQNARLKDALVRMRDLSSSEKQEHVKLQKLMEKKNQE EVVRQQRERLQEE LSQAESTIDELKEQVDAALGAEE VEMLTDRNLNLEEKVRELRETVGDLEA NEMNDELQENARETELE LREQLDMAGARVREAQKRVEAAQETVADYQQTIKKYRQLTAHLQDVNRELTNQQEASVERQQQPPPETF DFKIKFAETKAHAKAIEMELRQMEVAQANRHMSLLTAFMPDSFLRPGGDHDCVLVLLLMPRLICKAELI RKQAQEKFDLSENCSERPGLRGAAGEQLSFAAGLVYSLSLLQATLHRYEHALSQCSVDVYKKVGSLYPE MSAHERSLDFLIE LHKDQLDETVNVEPLTKAIKYYQHLYSIHLAEQPEESTMQLADHIKFTQSALDCM SVEVGRLRAFLQGGQEATDIALLLRDLETSCSDIRQFCKKIRRRMPGTDAPGIPAALAFGSQVSDTLLD CRKHLT VVAVLQEVAAAAAQLIAPLAENEGLPVAALEELAFKASEQIYGSPSSSPYECLRQSCSILIS TMNKLATA QEGEYDAERPPSKPPPVEPWPAALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELS EANVRLSLLEKKLDSAAKDADERIEKVQTRLEETQTLLRKKEKEFEETMDALQADIDQLEAEKTELKQR LNSQSKRTIEGLRGPPPSGIATLVSGIAGEEQQRGGTPGQAPGALPGPGPVKDSPLLLQQISAMRLHIS QLQHENSILRGAQMKASLAALPPLHVAKFSLPPHEGPGGNLLSGALYRKTSQLLEKLNQLSTYTHVVDI TRSSPACKSPSAQLMEQVAQLKSLSDTIEKLKDEVLKETVTQRPGATVPTDFATFPSSAFLRAKEEQQD DTVYMGKVTFSCAAGLGQRHRLVLTQEQLHQLHGRLIS
Methods of Screening for Disease-Relevant Mutations in Proteins, which are a Subunit of he Dynactin/Dynein Complex
The invention ter alia relates to the identification of a protein or a nucleic acid marker indicative of an increased risk of a mammalian subject, particularly a human subject, of developing a neurodegenerative disease or of an association of a neurodegenerative disease in a mammalian subject, particularly a human subject, with a mutation which leads to a neurodegenerative disease. Preferably the above-mentioned neurodegenerative diseases are Alzheimer's Disease, Parkinson's Disease, or Huntington's Disease. In a prefened embodiment the neurodegenerative disease is a motomeuron degenerative disease. In an even more prefened embodiment, the motomeuron degenerative disease is Amyotrophic Lateral Sclerosis, Spinal Muscular Atrophy, Bulbo-Spinal Muscular Atrophy, Progressive Bulbar Palsy, Progressive Muscular Atrophy, and Primary Lateral Sclerosis.
In a prefened embodiment, the mutation selectively affects cell types associated with or suspected to be involved in neurodegenerative diseases. In a more prefened embodiment, these cell types are motomeurons. In an even more prefened embodiment, the motomeurons are α-motorneurons. In another prefened embodiment, the mutation affects cellular processes, e.g., neuronal axonal transport, cellular transport, proliferation, differentiation, or apoptosis. In another prefened embodiment, the mutation leads to a deficiency or malfunction, e.g. an alteration in the functional interaction or a disruption of the dynactin/dynein complex in neurons, preferably in motomeurons.
On a molecular basis, said mutation results in a deletion of an amino acid or an insertion of an additional amino acid not normally present in the amino acid sequence of the protein encoded by said allele or in a substimtion by another amino acid of an amino acid encoded by said allele. In a prefened embodiment, said deletion, substitution, or insertion is encoded by both alleles ofthe gene coding for said protein and/or occurs in an evolutionary conserved region of said protein. In another prefened embodiment, the substitution of an amino acid which is identical between the conesponding mouse and human, preferably between the conesponding mouse, rat, and human protein encoded by said allele, by another amino acid, preferably by a non- conservative amino acid and/or the substitution of the amino acid occurs by a naturally occuning amino acid.
In another embodiment of the invention, the amino acid affected by the mutation is encoded by a codon within the open reading frame of a nucleic acid sequence, preferably by an exon, as set forth in the following tables. Table 36. Mouse cytoplasmic dynein intermediate chainl (GenBank Ace. No.: NM_0100631(SEQ ID NO.: 70)
Exonl (nucleotide) ATGTCTGACAAGAGCGACCTAAAGGCCGAGCTGGAGCGCAAAAAGCAGCGCTTAGCACAGATAAGAGAG GAGAAGAAACGGAAGGAAGAGGAGAGGAAGAAGAAAGAG
Table 37. Mouse cytoplasmic dynein intermediate chainl (GenBank Ace. No.: NM 010063) (SEQ ID NO.: 71)
Exon2 (nucleotide)
GCAGATATGCAGCAAAAGAAAGAGCCCGTTCAAGATGACTCCGATCTGGATCGCAAACGACGGGAGACA GAAGCTTTGCTTCAGAGCATTGGCATATCACCGGAGCCCCCTCTAG
Table 38. Mouse cytoplasmic dynein intermediate chainl (GenBank Ace. No.: NM 010063) (SEQ ID NO.: 72)
Exon3 (nucleotide)
TCCCAACCCCTATGTCTCCCTCTTCGAAATCAGTGAGCACTCCCAGTGATGCTGGAAGCCAAGACTCGG GCGATCTGGGGCCATTAACAAG
Table 39. Mouse cytoplasmic dynein intermediate chainl (GenBank Ace. No.: NM 010063) (SEQ ID NO.: 73)
Exon4 (nucleotide)
GACCCTGCAGTGGGACACAGACCCCTCAGTGCTCCAGCTGCAGTCAGACTCAGAACTTGG
Table 40. Mouse cytoplasmic dynein intermediate chainl (GenBank Ace. No.: NM 010063) (SEQ ID NO.: 74)
Exonl to 4 (nucleotide)
ATGTCTGACAΆGAGCGACCTAAAGGCCGAGCTGGAGCGCAAAAAGCAGCGCTTAGCACAGAT AGAGAG GAGAAGAAACGGAAGGAAGAGGAGAGGAAGAAGAAAGAGGCAGΆTATGCAGCARAAGAAAGAGCCCGTT CAAGATGACTCCGATCTGGATCGCAAACGACGGGAGACAGΆAGCTTTGCTTCAGAGCATTGGCATATCA CCGGΆGCCCCCTCTAGTCCCAACCCCTATGTCTCCCTCTTCGAAATCAGTGAGCACTCCCAGTGATGCT GGAAGCCAAGACTCGGGCGATCTGGGGCCATTAACAAGGACCCTGCAGTGGGACACAGACCCCTCAGTG CTCCAGCTGCAGTCAGACTCAGAACTTGG Table 41. Mouse cytoplasmic dynein intermediate chainl (GenBank Ace. No.: NM 010063) (SEQ ID NO.:75)
Exon5 (nucleotide) GAGACGACTGCACAAGCTGGGCGTGTCAAAGGTGACCCAGGTGGATTTCCTGCCTAGGGAAGTAGTATC CTACTCCAAGGAGACACAGACTCCTCTTGCAACACATCAGTCTGAAG
Table 42. Mouse cytoplasmic dynein intermediate chainl (GenBank Ace. No.: NM 010063) (SEQ ID NO.: 76)
Exon7 (nucleotide)
CCCCTCCAAGAGAGTTGACGGAGGAAGAAAAACAGCAGATCCTGCACTCAGAAGAATTCCTCATCTTCT TTGACCGGACAATCCGAGTAATTGAAAGAGCTCTTGCAGAGGACTCGGACATCTTTTTTGACTACAGCG GTCGAGAGCTGGAGGAGAAΆGATGG
Table 43. Mouse cytoplasmic dynein intermediate chainl (GenBank Ace. No.: NM 010063) (SEQ ID NO.: 77)
Exon8 (nucleotide) GGATGTGCAGGCTGGAGCCAACCTGTCTTTCAACCGTCAGTTCTACGATGAACATTGGTCTAAGCATCG GGTGGTCACATGTATGGACTGGTCTCTCCAG G
Table 44. Mouse cytoplasmic dynein intermediate chainl (GenBank Ace. No.: NM 010063) (SEQ ID NO.: 78)
Exon9 (nucleotide)
TACCCTGAGCTGATGGTTGCTTCTTATAGCAACAΆCGAAGATGCTCCCCACGAGCCAGATGGAGTGGCC TTGGTTTGGAACATGAAGTTCAAGAAAACCACACCAGAATATGTCTTCCACTGTCAG
Table 45. Mouse cytoplasmic dynein intermediate chainl (GenBank Ace. No.: NM 010063) (SEQ ID NO.: 79)
Exon7 to 9 (nucleotide)
CCCCTCCAAGAGAGTTGACGGAGGAAGAAAAACAGCAGATCCTGCACTCAGAAGAATTCCTCATCTTCT TTGACCGGACAATCCGAGTAATTGAAAGAGCTCTTGCAGAGGACTCGGACATCTTTTTTGACTACAGCG GTCGAGAGCTGGAGGAGAAAGATGGGGATGTGCAGGCTGGAGCCAACCTGTCTTTCAACCGTCAGTTCT ACGATGAACATTGGTCTAAGCATCGGGTGGTCACATGTATGGACTGGTCTCTCCAGGTACCCTGAGCTG ATGGTTGCTTCTTATAGCAACAACGAAGATGCTCCCCACGAGCCAGATGGAGTGGCCTTGGTTTGGAAC ATGAAGTTCAAGAAAACCACACCAGAATATGTCTTCCACTGTCAG Table 46. Human cytoplasmic dynein intermediate chainl (GenBank NM_004411) (SEQ ID NO.: 80)
Exonl (nucleotide)
TCCAAGGAAACCAACATGTCTGACAAAAGTGACTTAΆAAGCTGAGCTAGAGCGCAAAAAGCAGCGCTTA GCACAGATAAGAGAAGAGAAGAAACGGAAGGAAGAGGAGAGGAAAAAGAAAGAG
Table 47. Human cytoplasmic dynein intermediate chainl (GenBank NM_004411) (SEQ ID NO.: 81)
Exon2 (nucleotide)
GCTGATATGCAGCAGAAGAAAGAACCCGTTCAGGACGACTCTGATCTGGATCGCAAACGACGAGAGACA GAGGCTTTGCTGCAAAGCATTGGTATCTCACCGGAGCCGCCTCTAG
Table 48. Human cytoplasmic dynein intermediate chainl (GenBank NM_004411) (SEQ ID NO.: 82)
Exon3 (nucleotide) TGCAGCCGCTGCATTTTTTAACATGGGATACCTGTTATTTTCATTATTTAGTCCCAACCCCTATGTCTC CCTCCTCGAAATCAGTGAGCACTCCCAGTGAAGCTGGAAGCCAAGACTCAGGCGATCTGGGGCCATTAA
CAAG
Table 49. Human cytoplasmic dynein intermediate chainl (GenBank NM_004411) (SEQ ID NO.: 83)
Exon4 (nucleotide)
GACCCTGCAGTGGGACACAGACCCCTCAGTGCTCCAGCTGCAGTCAGACTCAGAACTTGG
Table 50. Human cytoplasmic dynein intermediate chainl (GenBank NM_004411) (SEQ ID NO.: 84)
Exon 1 to4 (nucleotide)
TCCAAGGAAACCAACATGTCTGACAAAAGTGACTTAAAAGCTGAGCTAGAGCGCAAAAAGCAGCGCTTA GCACAGATAAGAGAAGAGAAGAAACGGAAGGAAGAGGAGAGGAAAAAGAAAGAGGCTGATATGCAGCAG AAGAAAGAACCCGTTCAGGACGACTCTGATCTGGATCGCAAACGACGAGAGACAGAGGCTTTGCTGCAA AGCATTGGTATCTCACCGGAGCCGCCTCTAGTGCAGCCGCTGCATTTTTTAACATGGGATACCTGTTAT TTTCATTATTTAGTCCCAACCCCTATGTCTCCCTCCTCGAAATCAGTGAGCACTCCCAGTGAAGCTGGA AGCCAAGACTCAGGCGATCTGGGGCCATTAACAAGGACCCTGCAGTGGGACACAGACCCCTCAGTGCTC CAGCTGCAGTCAGACTCAGAACTTGG
Table 51. Human cytoplasmic dynein intermediate chainl (GenBank NM_004411) (SEQ ID NO.: 85)
Exon5 (nucleotide)
AAGAAGACTGCATAAACTGGGCGTGTCAAAGGTCACCCAAGTGGATTTCCTGCCAAGGGAAGTAGTGTC CTACTCAAAGGAGACCCAGACTCCTCTTGCCACGCATCAGTCTGAAG
Table 52. Human cytoplasmic dynein intermediate chainl (GenBank NM_004411) (SEQ ID NO.: 86)
Exon7 (nucleotide)
CCCCTCCAAGAGAGTTGACAGAGGAAGAAAAACAGCAGATCCTTCATTCAGAGGAATTTCTCATCTTTT TTGACCGGACAATACGGGTAATTGAAAGAGCCCTGGCTGAAGATTCCGACATCTTTTTTGACTACAGCG GCCGAGAGTTAGAGGAAAAAGATGG
Table 53. Human cytoplasmic dynein intermediate chainl (GenBank NM_004411) (SEQ ID NO.: 87)
Exon8 (nucleotide)
GGATGTTCAGGCTGGAGCCAATCTTTCTTTCAATCGTCAGTTCTATGATGAACATTGGTCCAAGCATCG AGTGGTCACTTGTATGGACTGGTCCCTCCAG
Table 54. Human cytoplasmic dynein intermediate chainl (GenBank NM_004411) (SEQ ID NO.: 88)
Exon9 (nucleotide)
TACCCTGAGCTGATGGTGGCTTCTTACAACAACAATGAAGATGCTCCCCATGAACCAGATGGAGTGGCC TTGGTTTGGAACATGAAGTTTAAGAAAACCACACCAGAATACGTCTTCCACTGTCAG
Table 55. Human cytoplasmic dynein intermediate chainl (GenBank NM_004411) (SEQ ID NO.: 89)
Exon7 to 9 (nucleotide)
CCCCTCCAAGAGAGTTGACAGAGGAAGAAAAACAGCAGATCCTTCATTCAGAGGAATTTCTCATCTTTT TTGACCGGACAATACGGGTAATTGAAAGAGCCCTGGCTGAAGATTCCGACATCTTTTTTGACTACAGCG GCCGAGAGTTAGAGGAAAAAGATGGGGATGTTCAGGCTGGAGCCAATCTTTCTTTCAATCGTCAGTTCT ATGATGAACATTGGTCCAAGCATCGAGTGGTCACTTGTATGGACTGGTCCCTCCAGTACCCTGAGCTGA TGGTGGCTTCTTACAACAACAATGAAGATGCTCCCCATGAACCAGATGGAGTGGCCTTGGTTTGGAACA TGAAGTTTAAGAAAACCACACCAGAATACGTCTTCCACTGTCAG
Table 56. Mouse cytoplasmic dynein intermediate chain2 (GenBank Ace. No.
NM 010064) (SEQ ID NO.: 90)
Exon2 (nucleotide) GTCACAACCATGTCGGACAAAAGTGATTTAAAAGCTGAGTTGGAACGTAAGAAGCAACGGTTGGCCCAA ATCAGAGAAGAAAAGAAGAGGAAAGAAGAGGAAAGGAAAAAAAAGGAA
Table 57. Mouse cytoplasmic dynein intermediate chain2 (GenBank Ace. No.
NM 010064) (SEQ ID NO.: 91)
Exon3 (nucleotide)
ACTGATCAGAAGAAGGAAGCTGCTGTTTCTGTACAAGAAGAGTCTGATCTTGAAAAAAAAAGAAGAGAA GCTGAGGCATTGCTTCAAAGCATGGGACTAACTACGGACTCCCCTATTG
Table 58. Mouse cytoplasmic dynein intermediate chain2 (GenBank Ace. No. NM 010064) (SEQ ID NO.: 92)
Exon4 (nucleotide)
TCCCTCCTCCTATGTCTCCATCCTCCAAGTCGGTGAGCACGCCAAGTGAAGCTGGAAGCCAGGATTCTG GAGATGGCGCCGTGGGATCTAG
Table 59. Mouse cytoplasmic dvnein intermediate chain2 (GenBank Ace. No. NM 010064) (SEQ ID NO.: 93)
Exon5 (nucleotide)
ACGAGGACCTATTAAACTTGGAATGGCCAAAATTACTCAAGTTGACTTTCCCCCTCGAGAAATCGTCAC ATACACAAAGGAAACTCAGACCCCGGTTACAGCTCAACCCAAAGAAG
Table 60. Mouse cytoplasmic dvnein intermediate chain2 (GenBank Ace. No. NM 010064) (SEQ ID NO.: 94)
Exon2 to 5 (nucleotide)
GTCACAACCATGTCGGACAAAAGTGATTTAAAAGCTGAGTTGGAACGTAAGAAGCAACGGTTGGCCCAA ATCAGAGAAGAAAAGAAGAGGAAAGAAGAGGAAAGGAAAAAAAAGGAAACTGATCAGAAGAAGGAAGCT GCTGTTTCTGTACAAGAAGAGTCTGATCTTGAAAAAAAAAGAAGAGAAGCTGAGGCATTGCTTCAAAGC ATGGGACTAACTACGGACTCCCCTATTGTCCCTCCTCCTATGTCTCCATCCTCCAAGTCGGTGAGCACG CCAAGTGAAGCTGGAAGCCAGGATTCTGGAGATGGCGCCGTGGGATCTAGACGAGGACCTATTAAACTT GGAATGGCCAAAATTACTCAAGTTGACTTTCCCCCTCGAGAAATCGTCACATACACAAAGGAAACTCAG ACCCCGGTTACAGCTCAACCCAAAGAAG
Table 61. Mouse cytoplasmic dynein intermediate chain2 (GenBank Ace. No. NM 010064) (SEQ ID NO.: 95)
Exon7 (nucleotide)
CTCCACCTCATGAACTAACTGAAGAAGAAAAGCAACAGATTTTACACTCAGAAGAATTTTTAAGTTTCT TTGACCATTCTACGAGAATTGTAGAAAGAGCCCTTTCTGAGCAGATTAACATCTTCTTTGACTACAGTG GGAGAGACTTGGAAGACAAAGAAGG
Table 62. Mouse cytoplasmic dynein intermediate chain2 (GenBank Ace. No. NM 010064) (SEQ ID NO.: 96)
Exonδ (nucleotide)
GGAGATTCAAGCAGGTGCTAAGCTGTCATTAAATCGACAGTTCTTTGATGAGCGTTGGTCAAAGCATCG AGTTGTTAGTTGTTTGGATTGGTCATCCCAG
Table 63. Mouse cytoplasmic dynein intermediate chain2 (GenBank Ace. No. NM 010064) (SEQ ID NO.: 97)
Exon9 (nucleotide)
TATCCAGAATTACTTGTGGCTTCCTATAATAACAATGAAGAGGCTCCTCATGAGCCTGATGGTGTGGCC CTCGTGTGGAATATGAAGTACAAAAAAACTACCCCAGAGTATGTGTTCCACTGCCAG
Table 64. Mouse cytoplasmic dvnein intermediate chain2 (GenBank Ace. No. NM 010064) (SEQ ID NO.: 98)
Exon7 to 9 (nucleotide)
CTCCACCTCATGAACTAACTGAAGAAGAAAAGCAACAGATTTTACACTCAGAAGAATTTTTAAGTTTCT TTGACCATTCTACGAGAATTGTAGAAAGAGCCCTTTCTGAGCAGATTAACATCTTCTTTGACTACAGTG GGAGAGACTTGGAAGACAAAGAAGGGGAGATTCAAGCAGGTGCTAAGCTGTCATTAAATCGACAGTTCT TTGATGAGCGTTGGTCAAAGCATCGAGTTGTTAGTTGTTTGGATTGGTCATCCCAGTATCCAGAATTAC TTGTGGCTTCCTATAATAACAATGAAGAGGCTCCTCATGAGCCTGATGGTGTGGCCCTCGTGTGGAATA TGAAGTACAAAAAAACTACCCCAGAGTATGTGTTCCACTGCCAG Table 65. Human cytoplasmic dvnein intermediate chain2. transcript 2 (GenBank Ace. No. NM 001378) (SEQ ID NO.: 99)
Exonl (nucleotide) ATGTCAGACAAAAGTGAATTAAAGGCTGAGTTGGAACGTAAGAAGCAGCGACTGGCCCAAATCAGAGAG GAAAΆGAAGAGAΆΆAGAAGAAGAAΆGGAAAAAAAAAGAAACAG
Table 66. Human cytoplasmic dvnein intermediate chain2, transcript 2
(GenBankAce. No. NM 001378) (SEQ ID NO.: 100)
Exon2 (nucleotide)
ACCAGAAGAAGGAAGCTGTTGCTCCTGTGCAAGAAGAATCAGATCTTGAAAAAAAAAGGAGAGAAGCTG AAGCATTGCTTCAAΆGCATGGGGCTAACTCCAGAATCCCCCATTG
Table 67. Human cytoplasmic dynein intermediate chain2 (GenBank Ace. No. NM 001378) (SEQ ID NO.: 101)
Exon3 (nucleotide)
TCCCTCCTCCTATGTCTCCATCCTCCAΆATCTGTGAGCACTCCAAGTGAAGCTGGAAGCCAAGACTCTG GAGATGGCGCCGTGGGATCTAG
Table 68. Human cytoplasmic dynein intermediate chain2 (GenBank Ace. No. NM 001378) (SEQ ID NO.: 102)
Exon4 (nucleotide)
ACGAGGACCTATTAAACTTGGAATGGCTAAAATCACGCAAGTCGACTTTCCTCCTCGAGAAATTGTCAC ■ GTATACAAAGGAAACTCAGACTCCAGTTATGGCTCAACCCAAAGAAG
Table 69. Human cytoplasmic dynein intermediate chain2 (GenBank Ace. No. NM 001378) (SEQ ID NO.: 103)
Exonl to 4 (nucleotide)
ATGTCAGACAAAAGTGAATTAAAGGCTGAGTTGGAACGTAAGAAGCAGCGACTGGCCCAAATCAGAGAG GAAAAGAAGAGAAAAGAΆGAAGAAAGGAAAAAAΆAAGAAACAGACCAGAAGAAGGAAGCTGTTGCTCCT GTGCAAGAAGAATCAGATCTTGAAAAAAAAAGGAGAGAAGCTGAAGCATTGCTTCAAΆGCATGGGGCTA ACTCCAGAATCCCCCATTGTCCCTCCTCCTATGTCTCCATCCTCCAAATCTGTGAGCACTCCAAGTGAA GCTGGAAGCCAAGACTCTGGAGATGGCGCCGTGGGATCTAGACGAGGACCTATTAAACTTGGAATGGCT AAAATCACGCAAGTCGACTTTCCTCCTCGAGAAATTGTCACGTATACAΆAGGAAACTCAGACTCCAGTT ATGGCTCAACCCAAAGAAG Table 70. Human cytoplasmic dvnein intermediate chain2 (GenBank Ace. No. NM 001378) (SEQ ID NO.: 104)
Exon6 (nucleotide)
CTCCCCCTCATGAGCTGACTGAAGAAGAAAΆGCAACAAATCCTGCACTCTGAGGAATTTTTAAGTTTCT TTGACCATTCTACAAGAΆTTGTAGAAAGAGCTCTTTCTGAGCAGATTAACATCTTCTTTGACTATAGTG GGAGAGATTTGGAAGACAAAGAAGG
Table 71. Human cytoplasmic dynein intermediate chain2 (GenBank Ace. No. NM 001378) (SEQ ID NO.: 105)
Exon7 (nucleotide) GAGATTCAAGCAGGTGCTAAACTGTCATTAAATCGACAATTTTTTGACGAACGTTGGTCAAAGCATCG GGTGGTTAGTTGTTTGGATTGGTCATCTCAG
Table 72. Human cytopasmic dvnein intermediate chain2 (GenBank Ace. No. NM 001378) (SEQ ID NO.: 106)
Exon8 (nucleotide)
TATCCGGAGTTACTCGTGGCTTCCTATAACAACAATGAAGATGCCCCTCATGAGCCTGATGGTGTGGCC CTTGTATGGAATATGAAATACAAAAAAACTACCCCAGAGTATGTGTTTCACTGCCAG
Table 73. Human cytoplasmic dynein intermediate chain2 (GenBank Ace. No. NM 001378) (SEQ ID NO.: 107)
Exon6 to 8 (nucleotide)
CTCCCCCTCATGAGCTGACTGAAGAAGAAAAGCAACAAATCCTGCACTCTGAGGAATTTTTAAGTTTCT TTGACCATTCTACAAGΆATTGTAGAAAGAGCTCTTTCTGAGCAGATTAACATCTTCTTTGACTATAGTG GGAGAGATTTGGAAGACAAAGAAGGAGAGATTCAAGCAGGTGCTAAACTGTCATTAAATCGACAATTTT TTGACGAACGTTGGTCAAAGCATCGGGTGGTTAGTTGTTTGGATTGGTCATCTCAGTATCCGGAGTTAC TCGTGGCTTCCTATAACAACAΆTGAAGATGCCCCTCATGAGCCTGATGGTGTGGCCCTTGTATGGAATA TGAAATACAAAAAAΆCTACCCCAGAGTATGTGTTTCACTGCCAG
Table 74. Mouse Dctnl (P150) nrotein (SEQ ID NO.: 108)
Exonl (nucleotide) ATGGCCCAGAGCAGGAGGCACATGTCCAGTCGGACGCCGAGTGGCAGCAGGATGAGTACGGAGGCAAGC GCCCGGCCCCTGCGGGTTGGCTCCCGCGTGGAGGTGATTGGGAAGGGCCACCGAGGCACTGTGGCCTAT GTTGGAGCCACACTCTTTGCCACTGGCAAATGGGTGGGCGTGATTCTGGATGAAGCAAAAGGCAAAAAT GATGGCACTGTCCAGGGAAGGAAGTATTTCACATGTGATGAAGGCCACGGCATCTTTGTACGCCAGTCC CAG
Table 75. Mouse Dctnl (P150) protein (SEQ ID NO.: 109)
Exon2 (nucleotide) ATCCAAGTATTTGAAGATGGAGCAGATACTACTTCCCCAGAGACTCCTGATTCTTCTGCTTCAAAGGTC CTCAAGAGAG
Table 76. Mouse Dctnl (P150) protein (SEQ ID NO.: 110)
Exon3 (nucleotide)
AGGGAGCCGATGCAGCTGCAAAGACCAGCAAACTG
Table 77. Mouse Dctnl (P150) protein (SEQ ID NO.: Ill)
Exon4 (nucleotide)
ACCACAACTCGACGGCCCAAG
Table 78. Mouse Dctnl (P150) protein (SEQ ID NO.: 112)
Exonl to 4 (nucleotide)
ATGGCCCAGAGCAGGAGGCACATGTCCAGTCGGACGCCGAGTGGCAGCAGGATGAGTACGGAGGCAAGC GCCCGGCCCCTGCGGGTTGGCTCCCGCGTGGAGGTGATTGGGAAGGGCCACCGAGGCACTGTGGCCTAT GTTGGAGCCACACTCTTTGCCACTGGCAAATGGGTGGGCGTGATTCTGGATGAAGCAAAAGGCAAAAAT GATGGCACTGTCCAGGGAAGGAAGTATTTCACATGTGATGAAGGCCACGGCATCTTTGTACGCCAGTCC CAGATCCAAGTATTTGAAGATGGAGCAGATACTACTTCCCCAGAGACTCCTGATTCTTCTGCTTCAAAG GTCCTCAAGAGAGAGGGAGCCGATGCAGCTGCAAAGACCAGCAAACTGCGGGGACTGAAGCCTAAGAAG GCACCGACAGCCCGAAAGACCACAACTCGACGGCCCAAG
Table 80. Mouse Dctnl (T150) protein (SEQ ID NO.: 114)
Exon5 (nucleotide)
CCTACTCGCCCAGCCAGCACTGGGGTGGCTGGGCCCAGTAGCTCCCTTGGCCCCTCTGGCTCAGCGTCA GCCGGGGAACTAAGCAGCAGTGAGCCCAGCACCCCAGCTCAGACTCCGCTGGCAGCACCCATCATCCCC ACACCGGCCCTCACCTCTCCTGGAGCAGCACCCCCACTTCCATCTCCCTCTAAG Table 81. Mouse Dctnl (P150) protein (SEQ ID NO.: 115)
Exon6 (nucleotide)
GAAGAGGAAGGGCTGAGGGCTCAGGTACGGGACCTGGAGGAGAAGCTGGAGACCCTGCGCCTAAAACGC TCAGAAGACAAAGCAAAGCTGAAAGAGCTGGAGAAGCACAAGATCCAGCTGGAGCAGGTGCAGGAATGG AAGAGCAAAATGCAGGAGCAGCAGGCAGACCTGCAGCGGCGCCTCAAGGAGGCTCGGAAG
Table 82. Mouse Dctnl (P150) protein (SEQ ID NO.: 116)
Exon7 (nucleotide)
GAAGCCAAGGAGGCGCTAGAGGCAAAGGAACGCTACATGGAGGAGATGGCCGACACAGCCGACGCTATC GAGATGGCCACTCTGGACAAGGAGATGGCTGAAGAGCGCGCTGAGTCTCTGCAGCAAGAGGTGGAGGCA CTGAAGGAACGGGTAGACGAGCTCACCACAGACCTGGAGATTCTCAAGGCTGAAATCGAAGAGAAAG
Table 83. Mouse Dctnl (P150) protein (SEQ ID NO.: 117)
Exon8 (nucleotide)
GCTCTGATGGGGCCGCATCAAGCTACCAGCTCAAGCAGCTGGAGGAGCAGAATGCCCGCCTGAAGGATG CCCTGGTGAG
Table 84. Mouse Dctnl (P150) protein (SEQ ID NO.: 118)
Exon9 (nucleotide)
GATGCGAGACCTCTCTTCCTCAGAGAAGCAGGAGCACGTGAAGCTGCAGAAACTCATGGAAAAGAAAAA CCAGGAGCTGGAGGTCGTGCGGCAGCAGCGCGAGCGTCTTCAGGAGGAGCTGAGCCAGGCTGAGAGCAC CATCGATGAGCTCAAAGAGCAG
Table 85. Mouse Dctnl (P150) protein (SEQ ID NO.: 119)
Exonl 0 (nucleotide)
GTGGACGCCGCTCTGGGAGCCGAGGAGATGGTGGAGATGCTGACCGACCGGAACCTGAATCTAGAGGAG AAAGTGCGGGAGTTACGGGAGACTGTGGGGGACTTG
Table 86. Mouse Dctnl (P150) protein (SEQ ID NO.: 120)
Exonl 1 (nucleotide)
GAAGCCATGAACGAGATGAACGATGAGCTGCAGGAGAACGCACGGGAGACGGAGCTGGAACTCCGAGAG CAGCTGGACATGGCGGGCGCCCGAGTGAGGGAAGCGCAGAAGCGAGTGGAAGCCGCCCAGGAGACAGTC GCCGACTACCAGCAGACCATCAAGAAGTACCGCCAGTTGACTGCCCACCTACAG Table 87. Mouse Dctnl (P150) protein (SEQ ID NO.: 121)
Exonl2 (nucleotide) GATGTCAATCGGGAGCTGACAAACCAGCAGGAAGCGTCTGTAGAGAGGCAGCAGCAGCCGCCGCCAGAG ACTTTTGATTTCAAAATCAAGTTTGCTGAGACCAAGGCTCATGCCAAG
Table 88. Mouse Dctnl (P150) protein (SEQ ID NO.: 122)
Exonl3(nucleotide)
GCCATTGAGATGGAGTTGAGACAGATGGAAGTTGCCCAGGCCAACCGGCACATGTCCCTGCTGACAGCC TTTATGCCTGACAGCTTCCTTCGGCCAGGTGGAGACCACGACTGTGTCCTGGTGCTGCTGCTCATGCCC CGACTCATTTGCAAG
Table 89. Mouse Dctnl (P150) protein (SEQ ID NO.: 123)
Exonl4 (nucleotide)
GCAGAGCTCATCCGGAAGCAGGCCCAGGAGAAGTTTGACCTGAGCGAGAACTGTTCGGAGCGGCCCGGG CTGCGGGGAGCTGCCGGGGAGCAGCTGAGCTTTGCTGCTGGACTGGTGTACTCGCTGAGTCTGCTGCAG GCCACGCTGCACCGCTATGAGCA
Table 90. Mouse Dctnl (P150) protein (SEQ ID NO.: 124)
Exonl 5 (nucleotide) TGCCCTCTCTCAGTGCAGTGTGGACGTGTATAAGAAGGTCGGCAGCCTGTACCCCGAGATGAGCGCCCA CGAGCGCTCCTTAGATTTCCTCATTGAGCTGCTGCACAAGGATCAGCTGGATGAGACTGTCAACGTGGA GCCCCTCACCAAGGCCATCAAGTATTACCAG
Table 91. Mouse Dctnl (P150) protein (SEQ ID NO.: 125)
Exonl 6 (nucleotide)
TGCCCTCTCTCAGTGCAGTGTGGACGTGTATAAGAAGGTCGGCAGCCTGTACCCCGAGATGAGCGCCCA CGAGCGCTCCTTAGATTTCCTCATTGAGCTGCTGCACAAGGATCAGCTGGATGAGACTGTCAACGTGGA GCCCCTCACCAAGGCCATCAAGTATTACCAG
Table 92. Mouse Dctnl (P150) protein (SEQ ID NO.: 126)
Exonl7 (nucleotide) TGCCCTCTCTCAGTGCAGTGTGGACGTGTATAAGAAGGTCGGCAGCCTGTACCCCGAGATGAGCGCCCA CGAGCGCTCCTTAGATTTCCTCATTGAGCTGCTGCACAAGGATCAGCTGGATGAGACTGTCAACGTGGA GCCCCTCACCAAGGCCATCAAGTATTACCAG
Table 93. Mouse Dctnl (P150) protein (SEQ ID NO.: 127)
Exonl 8 (nucleotide)
GGTGGGCAGGAGGCAACAGATATTGCCCTTCTTCTCCGAGACCTGGAAACATCATGTAGTGACACCCGT CAGTTCTGCAAGAAGATCCGAAGGCGGATGCCGGGGACGGATGCTCCTGGGATCCCAGCAGCGCTGGCC TTTGGCTCACAG
Table 94. Mouse Dctnl (P150) protein (SEQ ID NO.: 128)
Exonl9 (nucleotide) GTATCCGACACACTCCTGGACTGCAGGAAGCACTTGACGTGGGTGGTAGCTGTTCTGCAGGAGGTGGCA GCTGCAGCCGCCCAGCTTATTGCCCCCTTGGCAGAGAACGAGGGGCTGCCTGTGGCTGCACTGGAGGAG' CTGGCCTTCAAAGCAAGCGAGCAG
Table 95. Mouse Dctnl (P150) protein (SEQ ID NO.: 129)
Exon20 (nucleotide)
ATCTACGGGAGCCCCTCCAGCAGCCCCTATGAGTGTCTACGCCAGTCATGCACCATCCTCATCAGCACG ATGAACAAGCTGGCCACAGCCATGCAAGAAGGCGAGTATGACGCAGAGCGACCCCCGAGCAAG
Table 96. Mouse Dctnl (P150) protein (SEQ ID NO.: 130)
Exon3 to 20 (nucleotide)
AGGGAGCCGATGCAGCTGCAAAGACCAGCAAACTGCGGGGACTGAAGCCTAAGAAGGCACCGACAGCCC GAAAGACCACAACTCGACGGCCCAAGCCTACTCGCCCAGCCAGCACTGGGGTGGCTGGGCCCAGTAGCT CCCTTGGCCCCTCTGGCTCAGCGTCAGCCGGGGAACTAAGCAGCAGTGAGCCCAGCACCCCAGCTCAGA CTCCGCTGGCAGCACCCATCATCCCCACACCGGCCCTCACCTCTCCTGGAGCAGCACCCCCACTTCCAT CTCCCTCTAAGGAAGAGGAAGGGCTGAGGGCTCAGGTACGGGACCTGGAGGAGAAGCTGGAGACCCTGC GCCTAAAACGCTCAGAAGACAAAGCAAAGCTGAAAGAGCTGGAGAAGCACAAGATCCAGCTGGAGCAGG TGCAGGAATGGAAGAGCAAAATGCAGGAGCAGCAGGCAGACCTGCAGCGGCGCCTCAAGGAGGCTCGGA AGGAAGCCAAGGAGGCGCTAGAGGCAAAGGAACGCTACATGGAGGAGATGGCCGACACAGCCGACGCTA TCGAGATGGCCACTCTGGACAAGGAGATGGCTGAAGAGCGCGCTGAGTCTCTGCAGCAAGAGGTGGAGG CACTGAAGGAACGGGTAGACGAGCTCACCACAGACCTGGAGATTCTCAAGGCTGAAATCGAAGAGAAAG GCTCTGATGGGGCCGCATCAAGCTACCAGCTCAAGCAGCTGGAGGAGCAGAATGCCCGCCTGAAGGATG CCCTGGTGAGGATGCGAGACCTCTCTTCCTCAGAGAAGCAGGAGCACGTGAAGCTGCAGAAACTCATGG AAAAGAAAAACCAGGAGCTGGAGGTCGTGCGGCAGCAGCGCGAGCGTCTTCAGGAGGAGCTGAGCCAGG CTGAGAGCACCATCGATGAGCTCAAAGAGCAGGTGGACGCCGCTCTGGGAGCCGAGGAGATGGTGGAGA TGCTGACCGACCGGAACCTGAATCTAGAGGAGAAAGTGCGGGAGTTACGGGAGACTGTGGGGGACTTGG AAGCCATGAACGAGATGAACGATGAGCTGCAGGAGAACGCACGGGAGACGGAGCTGGAACTCCGAGAGC AGCTGGACATGGCGGGCGCCCGAGTGAGGGAAGCGCAGAAGCGAGTGGAAGCCGCCCAGGAGACAGTCG CCGACTACCAGCAGACCATCAAGAAGTACCGCCAGTTGACTGCCCACCTACAGGATGTCAATCGGGAGC TGACAAACCAGCAGGAAGCGTCTGTAGAGAGGCAGCAGCAGCCGCCGCCAGAGACTTTTGATTTCAAAA TCAAGTTTGCTGAGACCAAGGCTCATGCCAAGGCCATTGAGATGGAGTTGAGACAGATGGAAGTTGCCC AGGCCAACCGGCACATGTCCCTGCTGACAGCCTTTATGCCTGACAGCTTCCTTCGGCCAGGTGGAGACC ACGACTGTGTCCTGGTGCTGCTGCTCATGCCCCGACTCATTTGCAAGGCAGAGCTCATCCGGAAGCAGG CCCAGGAGAAGTTTGACCTGAGCGAGAACTGTTCGGAGCGGCCCGGGCTGCGGGGAGCTGCCGGGGAGC AGCTGAGCTTTGCTGCTGGACTGGTGTACTCGCTGAGTCTGCTGCAGGCCACGCTGCACCGCTATGAGC ATGCCCTCTCTCAGTGCAGTGTGGACGTGTATAAGAAGGTCGGCAGCCTGTACCCCGAGATGAGCGCCC ACGAGCGCTCCTTAGATTTCCTCATTGAGCTGCTGCACAAGGATCAGCTGGATGAGACTGTCAACGTGG AGCCCCTCAMCAAGGSCATCAAGTATTACCAGCATCTGTACAGSATCCACCTCGCTGAACAACCCGAGG ACTCCACCATGCAGCTGGCTGACCACATCAAGTTCACCCAGAGTGCCCTGGACTGCATGGGCGTGGAGG TGGGGCGGCTGCGTGCCTTCTTGCAGGGTGGGCAGGAGGCAACAGATATTGCCCTTCTTCTCCGAGACC TGGAAACATCATGTAGTGACACCCGTCAGTTCTGCAAGAAGATCCGAAGGCGGATGCCGGGGACGGATG CTCCTGGGATCCCAGCAGCGCTGGCCTTTGGCTCACAGGTATCCGACACACTCCTGGACTGCAGGAAGC ACTTGACGTGGGTGGTAGCTGTTCTGCAGGAGGTGGCAGCTGCAGCCGCCCAGCTTATTGCCCCCTTGG CAGAGAACGAGGGGCTGCCTGTGGCTGCACTGGAGGAGCTGGCCTTCAAAGCAAGCGAGCAGATCTACG GGAGCCCCTCCAGCAGCCCCTATGAGTGTCTACGCCAGTCATGCACCATCCTCATCAGCACGATGAACA AGCTGGCCACAGCCATGCAAGAAGGCGAGTATGACGCAGAGCGACCCCCGAGCAAG
Table 97. Mouse Dctnl (P150) protein (SEQ ID NO.: 131)
Exon22 (nucleotide)
GGAGAGGAGCTGAGTGAGGCCAACGTGCGGCTCAGCCTCCTGGAGAAGAAGTTGGACAGCGCTGCCAAG GATGCAGACGAGCGAATCGAGAAAGTTCAGACACGGCTGGACGAGACTCAGACCCTGCTGCGGAAGAAG GAGAA
Table 98. Mouse Dctnl (P150) protein(SEQ ID NO.: 132)
Exon23 (nucleotide)
AGACTTTGAGGAGACAATGGACGCACTCCAGGCTGACATCGACCAGCTGGAGGCAGAGAAGGCAGAGCT CAAGCAGCGCCTGAACAGCCAGTCCAAGCGCACAATCGAGGGGCTCCGGGGCCCCCCTCCGTCAGGCAT CGCTACCCTGGTCTCTGGCATCGCTGGTG
Table 99. Mouse Dctnl (P150) protein (SEQ ID NO.: 133)
Exon 22 to 23 (nucleotide) GGAGAGGAGCTGAGTGAGGCCAACGTGCGGCTCAGCCTCCTGGAGAAGAAGTTGGACAGCGCTGCCAAG GATGCAGACGAGCGAATCGAGAAAGTTCAGACACGGCTGGACGAGACTCAGACCCTGCTGCGGAAGAAG GAGAAAGACTTTGAGGAGACAATGGACGCACTCCAGGCTGACATCGACCAGCTGGAGGCAGAGAAGGCA GAGCTCAAGCAGCGCCTGAACAGCCAGTCCAAGCGCACAATCGAGGGGCTCCGGGGCCCCCCTCCGTCA GGCATCGCTACCCTGGTCTCTGGCATCGCTGGTG
Table 100. Human DCTN 1 (P150) protein (SEQ ID NO.: 134)
Exon 2 (nucleotide) ACGCCCAGCGGCAGCAGGATGAGTGCGGAGGCAAGCGCCCGGCCTCTGCGGGTGGGCTCCCGTGTAGAG GTGATTGGAAAAGGCCACCGAGGCACTGTGGCCTATGTTGGAGCCACACTGTTTGCCACTGGCAAATGG GTAGGCGTGATTCTGGATGAAGCAAAGGGCAAAAATGATGGAACTGTTCAAGGCAGGAAGTACTTCACT TGTGATGAAGGGCATGGCATCTTTGTGCGCCAGTCCCAG
Table 101. Human DCTN 1 (P150) protein (SEQ ID NO.: 135)
Exon3 (nucleotide)
ATCCAGGTATTTGAAGATGGAGCAGATACTACTTCCCCAGAGACACCTGATTCTTCTGCTTCAAAAGTC CTCAAAAGAG
Table 102. Human DCTN 1 (P150) protein (SEQ ID NO.: 136)
Exon4 (nucleotide) AGGGAACTGATACAACTGCAAAGACTAGCAAACTG
Table 103. Human DCTN 1 (P150) protein (SEQ ID NO.: 137)
Exon5 (nucleotide) ACCACAACTCGGCGACCCAAG
Table 104. Human DCTN 1 (P150) protein (SEQ ID NO.: 138)
Exon2 to 5 (nucleotide) ACGCCCAGCGGCAGCAGGATGAGTGCGGAGGCAAGCGCCCGGCCTCTGCGGGTGGGCTCCCGTGTAGAG GTGATTGGAAAAGGCCACCGAGGCACTGTGGCCTATGTTGGAGCCACACTGTTTGCCACTGGCAAATGG GTAGGCGTGATTCTGGATGAAGCAAAGGGCAAAAATGATGGAACTGTTCAAGGCAGGAAGTACTTCACT TGTGATGAAGGGCATGGCATCTTTGTGCGCCAGTCCCAGATCCAGGTATTTGAAGATGGAGCAGATACT ACTTCCCCAGAGACACCTGATTCTTCTGCTTCAAAAGTCCTCAAAAGAGAGGGAACTGATACAACTGCA AAGACTAGCAAACTGCGGGGACTGAAGCCTAAGAAGGCACCGACAGCCCGAAAGACCACAACTCGGCGA CCCAAG
Table 105. Human DCTN 1 (P150) protein (SEQ ID NO.: 139)
Exonβ (nucleotide)
CCCACGCGCCCAGCCAGTACTGGGGTGGCTGGGGCCAGTAGCTCCCTGGGCCCCTCTGGCTCAGCGTCA GCAGGTGAGCTGAGCAGCAGTGAGCCCAGCACCCCGGCTCAGACTCCGCTGGCAGCACCCATCATCCCC ACGCCGGTCCTCACCTCTCCTGGAGCAGTCCCCCCGCTTCCTTCCCCATCCAAG
Table 106. Human DCTN 1 (P150) protein (SEQ ID NO.: 140)
Exon7 (nucleotide)
GAGGAGGAGGGACTAAGGGCTCAGGTGCGGGACCTGGAGGAGAAACTAGAGACCCTGAGACTGAAACGG GCAGAAGACAAAGCAAAGCTAAAAGAGCTGGAGAAACACAAAATCCAGCTGGAGCAGGTGCAGGAATGG AAGAGCAAAATGCAGGAGCAGCAGGCCGACCTGCAGCGGCGCCTCAAGGAGGCGAGAAAG
Table 107. Human DCTN 1 (P150) protein (SEQ ID NO.: 141)
Exon8 (nucleotide)
GAAGCCAAGGAGGCGCTGGAGGCAAAGGAACGCTATATGGAGGAGATGGCTGATACTGCTGATGCCATT GAGATGGCCACTTTGGACAAGGAGATGGCTGAAGAGCGGGCTGAGTCCCTGCAGCAGGAGGTGGAGGCA CTGAAGGAGCGGGTGGACGAGCTCACTACTGACTTAGAGATCCTCAAGGCTGAGATTGAAGAGAAGG
Table 108. Human DCTN 1 (P150) protein (SEQ ID NO.: 142)
Exon9 (nucleotide)
GCTCAGATGGCGCTGCATCCAGTTATCAGCTCAAGCAGCTTGAGGAGCAGAATGCCCGCCTGAAGGATG CCCTGGTGAG
Table 109. Human DCTN 1 (P150) protein (SEQ ID NO.: 143)
Exonl 0 (nucleotide)
GATGCGGGATCTTTCTTCCTCAGAGAAGCAGGAGCATGTGAAGCTCCAGAAGCTCATGGAAAAGAAGAA CCAAGAGCTGGAAGTTGTGAGGCAACAGCGGGAGCGTCTGCAGGAGGAGCTAAGCCAGGCAGAGAGCAC CATTGATGAGCTCAAGGAGCAG
Table 110. Human DCTN 1 (P150) protein (SEQ ID NO.: 144) Exonl 1 (nucleotide)
GTGGATGCTGCTCTGGGTGCTGAGGAGATGGTGGAGATGCTGACAGATCGGAACCTGAATCTGGAAGAG AAAGTGCGCGAGTTGAGGGAGACTGTGGGAGACTTG
Table 112. Human DCTN 1 (P150) protein (SEQ ID NO.: 145)
Exonl2 (nucleotide)
GAAGCGATGAATGAGATGAACGATGAGCTGCAGGAGAATGCACGTGAGACAGAACTGGAGCTGCGGGAG CAGCTGGACATGGCAGGCGCGCGGGTTCGTGAGGCCCAGAAGCGTGTGGAGGCAGCCCAGGAGACGGTT GCAGACTACCAGCAGACCATCAAGAAGTACCGCCAGCTGACCGCCCATCTACAG
Table 113. Human DCTN 1 (P150) protein (SEQ ID NO.: 146)
Exonl3(nucleotide) GATGTGAATCGGGAACTGACAAACCAGCAGGAAGCATCTGTGGAGAGGCAACAGCAGCCACCTCCAGAG ACCTTTGACTTCAAAATCAAGTTTGCTGAGACTAAGGCCCATGCCAAG
Table 114. Human DCTN 1 (P150) protein (SEQ ID NO.: 147)
Exonl4 (nucleotide)
GCAATTGAGATGGAATTGAGGCAGATGGAGGTGGCCCAGGCCAATCGACACATGTCCCTGCTGACAGCC TTCATGCCTGACAGCTTCCTTCGGCCAGGTGGGGACCATGACTGCGTTCTGGTGCTGTTGCTCATGCCT CGTCTCATTTGCAAG
Table 115. Human DCTN 1 (P150) protein (SEQ ID NO.: 148)
Exonl 5 (nucleotide)
GCAGAGCTGATCCGGAAGCAGGCCCAGGAGAAGTTTGAACTAAGTGAGAACTGTTCAGAGCGGCCTGGG CTGCGAGGAGCTGCTGGGGAGCAACTCAGCTTTGCTGCTGGACTGGTGTACTCGCTGAGCCTGCTGCAG GCCACGCTAC CCGCTATGAGCA
Table 116. Human DCTN 1 (P150) protein (SEQ ID NO.: 149)
Exonl 6 (nucleotide) TGCCCTCTCTCAGTGCAGTGTGGATGTGTATAAGAAAGTGGGCAGCCTGTACCCTGAGATGAGTGCCCA TGAGCGCTCCTTGGATTTCCTCATTGAACTGCTGCACAAGGATCAGCTGGATGAGACTGTCAATGTGGA GCCTCTCACCAAGGCCATCAAGTACTATCAG
Table 117. Human DCTN 1 (P150) protein (SEQ ID NO.: 150) Exonl7 (nucleotide)
CATCTGTACAGCATCCACCTTGCCGAACAGCCTGAGGACTGTACTATGCAGCTGGCTGACCACATTAAG
Table 118. Human DCTN 1 (P150) protein (SEQ ID NO.: 151)
Exonl 8 (nucleotide)
TTCACGCAGAGTGCTCTGGACTGCATGAGTGTGGAGGTAGGACGGCTGCGTGCCTTCTTGCAG
Table 119. Human DCTN 1 (P150) protein (SEQ ID NO.: 152)
Exonl9 (nucleotide)
GGTGGGCAGGAGGCTACAGATATTGCCCTCCTGCTCCGGGATCTGGAAACTTCATGCAGTGACATCCGC CAGTTCTGCAAGAAGATCCGAAGGCGAATGCCAGGGACAGATGCTCCTGGGATCCCAGCTGCACTGGCC TTTGGACCACAG
Table 120. Human DCTN 1 (P150) protein (SEQ ID NO.: 153)
Exon20 (nucleotide) GTATCTGACACGCTCCTAGACTGCAGGAAACACTTGACGTGGGTCGTGGCTGTGCTGCAGGAGGTGGCA GCTGCTGCTGCCCAGCTCATTGCCCCACTGGCAGAGAATGAGGGGCTACTTGTGGCTGCTCTGGAGGAA CTGGCTTTCAAAGCAAGCGAGCAG
Table 121. Human DCTN 1 (P150) protein (SEQ ID NO.:154)
Exon21 (nucleotide)
ATCTATGGGACCCCCTCCAGCAGCCCCTATGAGTGTCTGCGCCAGTCATGCAACATCCTCATCAGTACC ATGAACAAGCTGGCCACAGCCATGCAGGAGGGGGAGTATGATGCAGAGCGGCCCCCCAGCAAG
Table 122. Human DCTN 1 (P150) protein (SEQ ID NO.: 155)
Exon4 to 21 (nucleotide)
AGGGAACTGATACAACTGCAAAGACTAGCAAACTGCGGGGACTGAAGCCTAAGAAGGCACCGACAGCCC GAAAGACCACAACTCGGCGACCCAAGCCCACGCGCCCAGCCAGTACTGGGGTGGCTGGGGCCAGTAGCT CCCTGGGCCCCTCTGGCTCAGCGTCAGCAGGTGAGCTGAGCAGCAGTGAGCCCAGCACCCCGGCTCAGA CTCCGCTGGCAGCACCCATCATCCCCACGCCGGTCCTCACCTCTCCTGGAGCAGTCCCCCCGCTTCCTT CCCCATCCAAGGAGGAGGAGGGACTAAGGGCTCAGGTGCGGGACCTGGAGGAGAAACTAGAGACCCTGA GACTGAAACGGGCAGAAGACAAAGCAAAGCTAAAAGAGCTGGAGAAACACAAAATCCAGCTGGAGCAGG TGCAGGAATGGAAGAGCAAAATGCAGGAGCAGCAGGCCGACCTGCAGCGGCGCCTCAAGGAGGCGAGAA AGGAAGCCAAGGAGGCGCTGGAGGCAAAGGAACGCTATATGGAGGAGATGGCTGATACTGCTGATGCCA TTGAGATGGCCACTTTGGACAAGGAGATGGCTGAAGAGCGGGCTGAGTCCCTGCAGCAGGAGGTGGAGG CACTGAAGGAGCGGGTGGACGAGCTCACTACTGACTTAGAGATCCTCAAGGCTGAGATTGAAGAGAAGG GCTCAGATGGCGCTGCATCCAGTTATCAGCTCAAGCAGCTTGAGGAGCAGAATGCCCGCCTGAAGGATG CCCTGGTGAGGATGCGGGATCTTTCTTCCTCAGAGAAGCAGGAGCATGTGAAGCTCCAGAAGCTCATGG AAAAGAAGAACCAAGAGCTGGAAGTTGTGAGGCAACAGCGGGAGCGTCTGCAGGAGGAGCTAAGCCAGG CAGAGAGCACCATTGATGAGCTCAAGGAGCAGGTGGATGCTGCTCTGGGTGCTGAGGAGATGGTGGAGA TGCTGACAGATCGGAACCTGAATCTGGAAGAGAAAGTGCGCGAGTTGAGGGAGACTGTGGGAGACTTGG AAGCGATGAATGAGATGAACGATGAGCTGCAGGAGAATGCACGTGAGACAGAACTGGAGCTGCGGGAGC AGCTGGACATGGCAGGCGCGCGGGTTCGTGAGGCCCAGAAGCGTGTGGAGGCAGCCCAGGAGACGGTTG CAGACTACCAGCAGACCATCAAGAAGTACCGCCAGCTGACCGCCCATCTACAGGATGTGAATCGGGAAC TGACAAACCAGCAGGAAGCATCTGTGGAGAGGCAACAGCAGCCACCTCCAGAGACCTTTGACTTCAAAA TCAAGTTTGCTGAGACTAAGGCCCATGCCAAGGCAATTGAGATGGAATTGAGGCAGATGGAGGTGGCCC AGGCCAATCGACACATGTCCCTGCTGACAGCCTTCATGCCTGACAGCTTCCTTCGGCCAGGTGGGGACC ATGACTGCGTTCTGGTGCTGTTGCTCATGCCTCGTCTCATTTGCAAGGCAGAGCTGATCCGGAAGCAGG CCCAGGAGAAGTTTGAACTAAGTGAGAACTGTTCAGAGCGGCCTGGGCTGCGAGGAGCTGCTGGGGAGC AACTCAGCTTTGCTGCTGGACTGGTGTACTCGCTGAGCCTGCTGCAGGCCACGCTACACCGCTATGAGC ATGCCCTCTCTCAGTGCAGTGTGGATGTGTATAAGAAAGTGGGCAGCCTGTACCCTGAGATGAGTGCCC ATGAGCGCTCCTTGGATTTCCTCATTGAACTGCTGCACAAGGATCAGCTGGATGAGACTGTCAATGTGG AGCCTCTCACCAAGGCCATCAAGTACTATCAGCATCTGTACAGCATCCACCTTGCCGAACAGCCTGAGG ACTGTACTATGCAGCTGGCTGACCACATTAAGTTCACGCAGAGTGCTCTGGACTGCATGAGTGTGGAGG TAGGACGGCTGCGTGCCTTCTTGCAGGGTGGGCAGGAGGCTACAGATATTGCCCTCCTGCTCCGGGATC TGGAAACTTCATGCAGTGACATCCGCCAGTTCTGCAAGAAGATCCGAAGGCGAATGCCAGGGACAGATG CTCCTGGGATCCCAGCTGCACTGGCCTTTGGACCACAGGTATCTGACACGCTCCTAGACTGCAGGAAAC ACTTGACGTGGGTCGTGGCTGTGCTGCAGGAGGTGGCAGCTGCTGCTGCCCAGCTCATTGCCCCACTGG CAGAGAATGAGGGGCTACTTGTGGCTGCTCTGGAGGAACTGGCTTTCAAAGCAAGCGAGCAGATCTATG GGACCCCCTCCAGCAGCCCCTATGAGTGTCTGCGCCAGTCATGCAACATCCTCATCAGTACCATGAACA AGCTGGCCACAGCCATGCAGGAGGGGGAGTATGATGCAGAGCGGCCCCCCAGCAAG
Table 123. Human DCTN 1 (P150) protein (SEQ ID NO.: 156)
Exon23 (nucleotide)
GGAGAGGAGCTAAGTGAGGCCAATGTGCGGCTGAGCCTCCTGGAGAAGAAGTTGGACAGTGCTGCCAAG GATGCAGATGAGCGCATCGAGAAAGTCCAGACTCGGCTGGAGGAGACCCAGGCACTGCTGCGAAAGAAG GAGAA
Table 124. Human DCTN 1 (P150) protein fSEO ID NO.: 157)
Exon24 (nucleotide)
AGAGTTTGAGGAGACAATGGATGCACTCCAGGCTGACATCGACCAGCTGGAGGCAGAGAAGGCAGAACT AAAGCAGCGTCTGAACAGCCAGTCCAAACGCACGATTGAGGGACTCCGGGGCCCTCCTCCTTCAGGCAT TGCTACTCTGGTCTCTGGCATTGCTGGTG Table 125. Human DCTN 1 (P150) protein (SEQ ID NO.: 158)
Exon 23 to 24 (nucleotide) GGAGAGGAGCTAAGTGAGGCCAATGTGCGGCTGAGCCTCCTGGAGAAGAAGTTGGACAGTGCTGCCAAG GATGCAGATGAGCGCATCGAGAAAGTCCAGACTCGGCTGGAGGAGACCCAGGCACTGCTGCGAAAGAAG GAGAAAGAGTTTGAGGAGACAATGGATGCACTCCAGGCTGACATCGACCAGCTGGAGGCAGAGAAGGCA GAACTAAAGCAGCGTCTGAACAGCCAGTCCAAACGCACGATTGAGGGACTCCGGGGCCCTCCTCCTTCA GGCATTGCTACTCTGGTCTCTGGCATTGCTGGTG
In another embodiment, the amino acid affected by the mutation is located in a domain of said protein, which is capable of binding to another subunit of the dynactin/dynein complex. Specifically, said domain comprises amino acids 147-157, amino acids 243-314, amino acids 140-157, or amino acids 1-123 of SEQ ID NO.: 61, in case the protein is mouse cytoplasmic dynein intermediate chain 1, or, in case the protein is human cytoplasmic dynein intermediate chain 1 amino acids 1-140, amino acids 157-174, amin acids 164-174, or amino acids 260-331 of SEQ ID NO.: 62. In case the protein is mouse cytoplasmic dynein intermediate chain 2, said domain comprises amino acids 1-123, amino acids 122-139, amino acids 129-130, or amino acids 226-297 of SEQ ID NO.: 64, or, in case the protein is human cytoplasmic dynein intermediate chain 2 amino acids 1-149, amino acids 148-165, amino acids 155-165, or amino acids 252-323 of SEQ ID NO.: 65. In case the protein is mouse DCTN 1 (SEQ ID NO.: 67), said domain comprises amino acids 39-150, amino acids 1006-1021, or amino acids 133-899 of SEQ ID NO.: 67, or, in case the protein is human DCTN 1 amino acids 39-150, amino acids 133-899, or amino acids 1006-1021 of SEQ ID NO.: 68.
In another prefened embodiment, the amino acid affected by the mutation is any one as described in individualized manner in connection with the prefened muteins ofthe invention above, e.g., those specified in Tables 19, 20, 21, 22 or 24.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is amino acid 39G.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is amino acid 40H. In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is amino acid 41R.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is amino acid 42G. In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is amino acid 43 T.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is amino acid 44V.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 45 A.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 46Y.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 47V. In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 48G.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 49 A.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 50T.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 51L.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 52F. In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 53A.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 54T.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 55G.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 56K.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 57W. In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 58V.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 59G. In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 60V
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 611.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 62L.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 63D.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 64E. In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 65 A.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 66K.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 67G.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 68K.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 69N. In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 70D.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 71G.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 72T.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 73V.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 74Q. In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 75 G.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 76R. In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 77K.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 78Y.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 79F.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 80T.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 81C. In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 82D.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 83E.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 84G.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 85H.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 86G. In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 871.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 88F.
In case the protein is human DCTN 1, another prefened embodiment is one wherem the amino acid affected by said mutation is the amino acid 89V.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 90R.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 91Q. In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 92S.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 93 Q. In case the protein is human DCTN 1, another prefened embodiment is one wherein the- amino acid affected by said mutation is the amino acid 941.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 95Q.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 96V.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 97F.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 98E. In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 99D.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 100G.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 101 A.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 102D.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 103T. , In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 104T.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 105S.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 106P.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 107E.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 108T. In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 109P.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 110D. In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 111 S.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 112S.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 113 A.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 114S.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 115K. In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 117L.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 118K.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 119R.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 120E.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 12 IG. In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 123D.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 126 A.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 127K.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 128T.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 129S. In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 13 OK.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 13 IL. In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 132R.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 133G.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 134L.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 135K.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 136P. In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 137K.
In case the protein is human DCTN 1, another prefened embodiment. is one wherein the amino acid affected by said mutation is the amino acid 138K.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 139A.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 140P.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 141T. In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 142 A.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 143R.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 144K.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 145T.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 146T. In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 147T.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 148R. In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 149R.
In case the protein is human DCTN 1, another prefened embodiment is one wherein the amino acid affected by said mutation is the amino acid 150P.
The method of identifying a protein or nucleic acid marker indicative of an increased risk of a mammalian subject of developing a neurodegenerative disease, or the method of identifying a protein or nucleic acid marker indicative of an association of a neurodegenerative disease in a mammalian subject with a mutation in an allele of a gene coding for a protein, which is a subunit of the dynactin/dynein complex comprise the step of analyzing a test sample derived from said subject for the presence of a difference compared to a similar test sample if derived from asubject ofthe same species that is unaffected by, or known not to be at risk of, developing said disease, wherein said difference is indicative of the presence of a mutation in an allele of the gene coding for a protein, which is a subunit ofthe dynactin/dynein complex.
In the above methods, the test sample derived from a mammalian subject, particularly a human subject, may be directly obtained from said subject. It may, however, also be a sample that has been obtained previously. Also included test samples according to the invention are, for example, cDNA preparations that have been prepared from mRNA obtained from a tissue sample from a human subject at an earlier stage. It may also be cloned or PCR-amplifϊed DNA that originates from DNA contained in such tissue sample obtained at an earlier stage.
According to the claimed method, the test sample will be analyzed for a difference to a similar test sample derived from a human subject unaffected by or known not to be at risk of developing a neurological disease. While the method may include actually deriving or directly obtaining a test sample from such a mammalian subject, particularly a human subject, for comparative purposes, the necessary information regarding the relevant structural features and properties of such similar test sample to be used for comparison will often already be available. Thus, it will often be sufficient for the purposes of the above methods ofthe invention to perform an analysis for a difference to a similar test sample as it would be observed if said similar test sample were in fact obtained from a subject of the same species, which subject is unaffected by or known not to be at risk of developing the above medical condition.
The test sample may be a nucleic acid sample, e.g., mRNA (or cDNA derived therefrom), or genomic DNA.
It may also be a protein sample. In a prefened embodiment the nucleic acid sample or the protein sample comprises one or more of the nucleic acids coding for proteins or the proteins itself, which are subunits of the dynactin/dynein complex, preferably the cytoplasmic dynein heavy chain 1, e.g. according to SEQ ID NOS.: 28 or 29, the cytoplasmic dynein intermediate chain 1, e.g. according to SEQ ID NOS.: 30 or 31, the cytoplasmic dynein intermediate chain 2, e.g. according to SEQ ID NOS.: 32 or 33, the cytoplasmic dynein light intermediate chain 1, e.g. according to SEQ ID NOS.: 34 or 35, the cytoplasmic dynein light intermediate chain 2, e.g. according to SEQ ID NOS.: 36 or 37; the cytoplasmic dynein 10 kDa light chain, e.g. according to SEQ ID NOS.: 38 or 39, the cytoplasmic dynein light chain Tctex 1, e.g. according to SEQ ID NOS.: 40 or 41, the cytoplasmic dynein light chain 2B, e.g. according to SEQ ID NO.: 42, DCTN 1, e.g. according to SEQ ID NOS.: 43 or 44, DCTN 2, e.g. according to SEQ ID NO.: 45, DCTN 3, e.g. according to SEQ ID NOS.: 46 or 47), DCTN 4, e.g. according to SEQ ID NOS.: 48 or 49, DCTN 5, e.g. according to SEQ ID NO.: 50, DCTN 6, e.g. according to SEQ ID NOS.: 51 or 52), ARPl, e.g. according to SEQ ID NOS. 53 or 54, ARPl l, e.g. according to SEQ ID NOS. 55 or 56), HAPl, e.g. according to SEQ ID NO. 57 or 58, and CLIP-170, e.g. according to SEQ ID NOS.: 59 or 60), more preferably the cytoplasmic dynein heavy chain 1, cytoplasmic dynein intermediate chain 1, cytoplasmic dynein intermediate chain 2, and/or DCTN 1, e.g., according to the above-mentioned conesponding SEQ ID NOS.
The difference analyzed- may furthermore be one relating to the expression level of said nucleic acid or protein. Alternatively, it may be analyzed whether there is a difference in terms ofthe nucleotide or the amino acid sequence level. The step of analysis for differences between the test samples may comprises the partial or complete determination of the sequence of the nucleic acid, or a PCR- amplified portion of the nucleic acid, of the test sample, and optionally also of the nucleic acid or at PCR-amplified portion ofthe nucleic acid ofthe similar test sample
(or the similar test samples).
Accordingly, another embodiment of the invention relates to oligonucleotides suitable for identifying a mutation in an allele coding for a protein, which is a subunit ofthe dynactin/dynein complex. In a prefened embodiment, the nucleic acid sequence ofthe oligonucleotide conesponds to one within said allele, which contains a mutation as defined above. In another prefened embodiment the oligonucleotide is suitable for hybridizing to the nucleic acid of said allele or a portion of its nucleic acid under stringent conditions. In another prefened embodiment, the oligonucleotide is suitable as primer for amplifying the nucleic acid of said allele or a portion of its nucleic acid.
Suitable methods for the determination of partial or complete nucleic acid sequences, and thus, detection of the above-mentioned differences, are well known to the skilled artisan. They include, for example, Southern blotting, TGGE (temperature gradient gel electrophoresis), DGGE (denaturing gradient gel electrophoresis), SCCP (single chain conformation polymorphism) detection, and the like. High throughput sequence analysis methods such as those described by Kristensen et al. (Kristensen et al., BioTechniques 30 (2001), 318-332), which is incorporated herein by reference in its entirety, are likewise suitable, and hence, contemplated in connection with the present invention.
One embodiment of the present invention relates to the determination whether the above-mentioned differences are present in one or both alleles ofthe gene coding for the protein, which is a subunit of the dynactin/dynein complex, i.e., whether the mammalian subject (or certain cell samples derived therefrom) is (are) homozygous or heterozygous with respect to said mutation. In a prefened embodiment, the portion of the allele to be tested is PCR-amplified and digested with a suitable restriction enzyme and the resulting restriction pattern obtained from the amplified portion is compared to the restriction pattern obtained from the conesponding amplified portion of the similar sample or the similar samples (see Example (8). In another prefened embodiment, the above-mentioned determination whether differences are present in one or both alleles ofthe gene coding for said protein is TGCE, as explained below.
Another prefened embodiment of the invention relates to the separation of
PCR-amplified portions of the allele via electrophoresis through a gradient of increasing temperature via TGCE (see Example 20). Differences in the amplified portion of the allele compared to amplified portions of the alleles contained in the similar test sample(s) are indicated by a difference in migration during electrophoresis.
As mentioned above, the invention ter alia relates to high throughput screening methods. Preferably, the oligonucleotides according to the invention, used in these high throughput methods, are fixed on a solid support to form an anay. The solid support can comprise microplates, standard blotting membranes, or glass chips. In a prefened embodiment, the solid support is a glass chip with a modified surface capable of covalently binding to said oligonucleotides. Nucleic acid samples, preferably genomic DNA, are tagged, e.g. with a fluorescent marker, and allowed to interact with said oligoncleotides bound to the solid support. Hybridization will occur at complementary sequences between nucleic acid sample and oligonucleotide, which is indicative for the presence of a mutation in said nucleic acid sample. Hybridization is then determined by scanning with a laser beam and analyzing the signal on a computer.
Suitable methods for the determination of partial or complete amino acid sequences are likewise well known, and include, for example, detection of particular epitopes within a protein sample via specific antibodies in dot blot, slot blot, or Western blot assays, or via ELISAs or RIAs, or partial amino acid sequence determination on a sequencer via Edman degradation. Also, high-throughput methods may again be employed.
A further aspect of the present invention is represented by a method for identifying a predisposition of a mammalian subject, particularly a human subject, for developing a neurodegenerative disease, said method comprising the step of determining whether a test sample derived from said subject indicates the presence of a mutation in an allele of the gene coding for a protein, which is a subunit of the dynactin/dynein complex, indicative of an increased risk of said human subject of developing said neurodegnereative disease.
Also contemplated in connection with the present invention is a method for determining whether a neurodegenerative disease in a mammalian subject, particularly a human subject, which is associated with a mutation in an allele of a gene coding for a protein, which is asubunit of the dynactin/dynein complex, said method comprising the step of determining whether a test sample derived from said subject indicates the presence of a mutation in an allele ofthe gene coding for said protein.
As in the case of the methods described above, the test sample may also be a sample that has been obtained previously. Furthermore, suitable test samples according to the invention are, for example, cDNA preparations that have been prepared from mRNA obtained from a tissue sample from a mammalian subject, particularly a human subject, at an earlier stage. It may also again be cloned or PCR- amplified DNA that originates from DNA contained in such tissue sample obtained at an earlier stage.
Again, the previously mentioned methods of determining partial or complete nucleic acid or amino acid sequences may be employed for the step of determining whether the test sample (which may be a nucleic -acid or protein test sample as previously defined) indicates the presence of said mutation.
According to the above methods of identifying a predisposition in a mammalian subject, particularly a human subject, of developing a neurodegenerative disease, or determining a potential association between such a neurodegenerative disease and certain mutations, the test sample is analyzed for the presence of a mutation in an allele of a gene of a protein, which is a subunit of the dynactin/dynein complex, which mutation is indicative of an increased risk of developing such a neurodegenerative disease. On the molecular level, said methods would comprise analyzing said sample for the presence of amutation, which would indicate an altered expression or function of said protein. It will be appreciated that such mutations are ter alia those refened to herein in connection with the proteins and nucleic acids according to the invention, and that mutations of this kind may be readily identified, for example, by in vitro assays. Such in vitro assays to determine whether the mutation in an allele of a gene coding for said protein affects the function of the complex may comprise the quantitative and/or qualitative determination of the binding of the subunits to each other within the complex. Qualitative methods may comprise SDS-PAGE and subsequent Western blotting of homogenates of, e.g. the spinal cord, using antibodies specific for the dynactin/dynein subunits. Disruption of the dynactin/dynein complex by a mutation in said proteins can be determined by, e.g. a difference in migration of the subunits compared to proteins derived from homogenates of similar tissue comprising the conesponding proteins without mutation (LaMonte et al, see above.). In another embodiment ofthe invention, disruption, or at least functional alteration of the dynactin/dynein complex due to mutations in its subunits, may be analyzed by affinity chromatography as described in Karki et al. (J Biol Chem 270, 28806-28811, 1995) or co-precipitation experiments as described in Paschal et al. (J Biol Chem 268, 15318-23, 1993). Quantitative methods to determine quantitative binding of the subunits within the complex to each other are, e.g. those using surface plasmon resonance (SPR), such as, for example, the Biacore technology (Biacore AB, Uppsala, Sweden) (see also Example 18). Further suitable in vitro assays comprise the step of determining whether a mutation in one or more subunits of the dynactin/dynein complex affects dynein motility. Such tests comprise, e.g. immunohistology with appropiate antibodies. To determine an effect of the mutation on axonal transport, antibodies directed against tubulin or synaptotagmin may be suitable (Martin et al, 1999, Mol Biol Cell 10, 3717-3728).
In another embodiment ofthe invention, dynein motility may be determined by analysis of single-lipid-droplet motility as described by Welte et al. (Cell 92: 547-557, 1998) or a microtubule gliding assay (see Example 16). In another embodiment, the in. vitro assays may comprise tests to determine whether the mutation in an allele of a gene coding for said protein affects the expression of the protein. In this regard, quantitative analysis of the mRNA expression levels may be applicable. These methods may comprise, for example, Northern blotting or quantitative Polymerase Chain Reaction, which are well known to those skilled in the art.
In a further embodiment of the present invention, the above-metioned mutations may be readily identified, for example, by an animal model (see Example 1).
The above-mentioned mutations may also be identified by any of the aforementioned methods of screening for disease-relevant alleles of said proteins.
The invention further comprises a kit for identifying a predisposition of a mammalian subject, particularly a human subject, for developing a neurodegenerative disease, or for identifying an association of a neurodegenerative disease of said subject with a mutation in an allele coding for a protein, which is a subunit of the dynactin/dynein complex. The kit according to the invention comprises one or more of the above-mentioned oligonucleotides suitable for identifying a mutation in an allele of a gene coding for a protein which is a subunit of the dynactin/dynein complex. In one prefened embodiment, the kit comprises oligonucleotide(s), the nucleotide sequence of which conespond(s) to a nucleotide sequence within said allele, which contains a mutation. In another prefened embodiment, the oligonucleotide(s) is(are) suitable for hybridizing to the nucleic acid of said allele or a portion of its nucleic acid under stringent conditions. In another prefened embodiment, the oligonucleotide(s) is(are) suitable as primer(s) for amplifying the nucleic acid of said allele or a portion of its nucleic acid. In another prefened embodiment, the kit further comprises instructions to use the oligonucleotide or the oligonucleotides for identifying said predisposition in said subject or said association of the neurodegenerative disease of said subject with said mutation.
The invention further comprises a solid support, wherein at least two oligonucleotides are individually fixed to separate areas of the solid support to form an anay. Prefenably the oligonucleotides fixed on the solid support are suitable for for identifying a mutation in an allele of a gene coding for a protein, which is a subunit ofthe dynactin/dynein complex. Prefenably, the oligonucleotides fixed on the solid support have a nucleotide sequence, which conesponds to a nucleotide sequence within said allele, which contains a mutation and. are suitable for hybridizing to the nucleic acid of said allele or a portion of its nucleic acid under stringent conditions. The solid support can be a microplate or standard blotting membranes, such' as nylon or nitrocellulose membranes. In a prefened embodiment, the solid support is a glass chip, preferably a glass chip with a modified surface. The surface of the glass chip is modified as to bind nucleic acids, preferably oligonucleotides, more preferably oligonucleotides with a nucleotide sequence, which conesponds to a nucleotide sequence within said allele, which contains a mutation.
A further embodiment of the present invention comprises the use of the previously mentioned oligonucleotides, or the previously mentioned kit, or the above- mentioned solid support, in a method for identifying a predisposition of a mammalian subject, particularly a human subject, for developing a neurodegenerative disease or in a method for determining whether a neurodegenerative disease in a mammalian subject, particularly a human subject, is associated with a mutation in an allele of a gene coding for a protein, which is a subunit of the dynactin/dynein complex as mentioned previously.
The invention will be further described in the following examples, which do not limit the scope of the invention described in the claims. The following examples are offered for illustrative purposes only, and are not intended to limit the scope ofthe present invention in any way.
EXAMPLE 1: Production of Animals of the Invention and Breeding Strategies To produce mouse mutants, a C3HeB/FeJ male mouse (The Jackson
Laboratory, Bar Harbor ME, USA) was injected intraperitoneally three times in weekly intervals between 8-10 weeks of age with ethyl-nitroso-urea (ENU) (Serva Electrophoresis GmbH, Heidelberg, Germany) at 90mg/kg body weight.
Generation of FI Progeny:
50 days after the last injection the injected male mouse was mated to wild type C3HeB/FeJ female partners. The FI progeny (up to 100 offspring) were then analyzed for phenotypes of dominant traits. Generation of F2 Progeny-genetic confirmation of dominant phenotype:
Affected FI individuals were mated to wild type C3HeB/FeJ mice and the resulting F2 progeny was screened for the identical pathological phenotype as identified in FI generation.
Generation of F3 Progeny:
For maintenance purposes affected F2 individuals were mated to wild type
C3HeB/FeJ mice. Affected F2 individuals were intercrossed to produce homozygous F3 individuals, which undergo perinatal lethality: therefore fetal tissues of these animals were analyzed. Heterozygous F3 individuals were used for the histochemical, neurological and physiological characterization ofthe Cral phenotype.
EXAMPLE 2: First Identification of Phenotype The Cral mouse mutant was identified by the observation of hind limb cramping during manual tail suspension in the heterozygous condition (Figure 1). Adult mice were manually suspended by their tails for one minute. During this period it was observed whether the mice display cramping of their hind limbs. In all tests, the observation of hind limb cramping was invariably conelated to the heterozygous Cral/+ genotype.
A broad range of standard physiological values were tested, but were within wild type (control) ranges.
EXAMPLE 3: Analysis of Muscle Endurance and Motor Coordination
A semi-quantitative evaluation of the phenotype was accomplished by the application ofthe hanging wire assay (for results see Figure 3), as a tool for measuring muscle endurance. Muscle endurance of adult heterozygous Cral individuals (Cral/+) was measured in comparison to wildtype individuals by placing individual mice on a wire grid, mildly shaking the grid to cause the mouse to grip the wires with their paws, and then inverting the grid. The grid was held stationary in the inverted position and the time elapsed until the mouse fell was recorded as the latency to fall. Both sexes of Cral mice exhibit a significantly reduced latency to fall off the grid in comparison to wild type mice.
A reduction in motor coordination was subsequently suggested by a reduced performance in the coat hanger and stationary beam assays. In a coat hanger assay a single heterozygous Cral animal was placed in the middle of the horizontal part of a metal coat hanger. The movements of the animal were observed for 45 seconds and assessed in comparison to movements of a wildtype mice in a separate assay. The following classification was used to describe the performance of the animal: "normal", the mouse climbs up the wire (horizontal and vertical movements); "abnormal", the mouse displays only horizontal movements or it does not display any movements (freeze) or it falls from the metal coat hanger.
In the stationary beam assay, a heterozygous mouse was placed in the middle of a stationary beam, which was divided into fourteen 5 cm zones. The animal was observed for 45 seconds. The following classification was used to describe the performance of the animal: "normal", the mouse moves between at least 3 zones;
"abnormal", the mouse moves within less than 3 zones, or the mouse is falls from the stationary beam.
EXAMPLE 4: Determination of Movement Activity
To determine movement activity during an 24 hour interval, individual heterozygous Cral or wild type mice were monitored with a photobeam activity system (San Diego Instruments, San Diego, CA, USA), according to the manufacturer's instructions. A single animal was transfened into a type 3 mouse cage, with a photobeam frame assembled. Beam breaks caused by a moving mouse were counted automatically using a software package "SDI PAS Photobeam System N2" following the instructions of the manufacturer's handbook. Data were collected over a period of 24 hours after the animals had been acclimatized to the cages for 48 hours.
Figure 2 indicates that heterozygous Cral mice exhibit increased ambulatory activity in the early dark phase of an alternating 12 hour light/dark cycle. EXAMPLE 5: Necropsy and Organ Histology of Mutant Animals
For sampling of organs, adult animals were perfusion fixed with 4% paraformaldehyde. Muscle samples were collected from anaesthesised mice and cryopreserved in liquid nitrogen cooled isopentane at -50°C. Embryos were immersion fixed in paraformaldehyde. Tissues were sampled and processed to paraffin wax. Sections were cut at 5 microns and stained according to subsequent usage.
1. Heterozygotes
The following histopathological abenations were observed in adult Cral/+ (as compared to wild type mice)
in I). Brain:
Slight enlargement ofthe lateral and 3r ventricles.
Neuronal eosinophilic inclusions in the arcuate and the preoptic nuclei of the hypothalamus. Excitatory neuronal damage ("dark neurons") in hippocampus (gyrus dentatus,
CA4, CA3), some areas of the upper cortex and the Purkinje cell layer of the cerebellum (see Figure 4 A: hippocampus):
This type of neuronal damage is reversible: it can be evoked by challenging the individuals by tail suspension for two minutes immediately before sacrifice by cervical dislocation, and can be demonstrated as follows. Brains were removed immediately, immersion fixed in paraformaldehyde and processed for paraffin embedding using standard histopathological techniques. Coronal sections of 5 μm were mounted on glass slides and stained with hematoxylin and eosin by standard histological protocols. The phenomenon of dark neurons after acute neuronal cell stress is well recognized since some years in the neuropathological literature and resembles a fixation effect by aldehyde fixation. This cellular pathomorphology is not accompanied by astro- or microglial activation, it occurs under normal neuronal cell count, and it is only detectable after aldehyde fixation, but not by cryosectioning.
in II). Muscle: Decreasing numbers of α-motor neurons and altered composition of musculus vastus fibre types. Muscle samples were processed according to standard protocols and were cut at 5 μm. Staining of NeuN protein was performed by immunohistochemical analysis with an anti NeuN antibody Mab377 (Chemicon Int. Inc., Temecula, CA, USA), detecting decreasing numbers of α-motor neurons. Periodic acid-Schiff (PAS) staining was performed according to standard protocols, detecting an altered composition of musculus vastus fiber tybes (see Fig. 4B).
2. Homozygotes
The following preliminary histopathological observations were made in organs ofE17.5
Cral/Cral fetus as compared to wild type individuals: Neurodegeneration in the anterior horns ofthe spinal cord:
Mature motor neurons were sparse in the anterior horn region of homozygotes when compared to heterozygote or wildtype littermates. From a histomorphological aspect approximately 50 % of motor neuros were missing, the remaining neurons were smaller of size and did not have a normal mature aspect. Detection of apoptotic cell death within the anterior horns ofthe spinal cord:
Apoptosis detection was performed as follows: deparaffinized and rehydrated paraffin sections were treated with proteinase K (20 μg/ml) for 15 minutes at room temperature. Apoptotic cells were detected in situ by the TUNEL (terminal deoxynucleotidyl transferase-mediated dUTP nick end labeling) assay using the Roche in situ cell death detection kit POD (Roche Diagnostics GmbH, Mannheim, Germany), according to the manufacturer's instructions, and using diaminobenzidine as a staining dye. The percentage of TUNEL positive cells was clearly increased in the anterior horn region ofthe homozygous embryos when compared to heterozygote and wildtype littermates, where only few positive neuronal cells were detected.
EXAMPLE 6: Mapping and Cloning of the Mutation in Mutant Animals of the Invention
1. Generation of F3- and F4-Hvbrids
F3-hybrids were generated by mating affected F2-individuals to C57BL/6J wildtype mice. F3 hybrids were designated as DOl. DOl individuals were screened for the Cral phenotype directly after weaning. For mapping and positional cloning of the mutated gene affected F3 -hybrids were either intercrossed to generate F4 intercross individuals, designated as DIG individuals, or outcrossed to C57BL/6J wildtype mice to generate F4-individuals, designated as DO2 individuals.
2. DNA Isolation from Rodent Tails and Macromapping Mouse genomic DNA was purified from 1 cm long pieces of tails of DIG or
DO2 mice by using the "DNeasy 96 Tissue Kit" (Qiagen, Hilden, Germany) according to the manufacturer's protocol.
For chromosomal mapping ofthe mutant locus in the Cral mouse line standard outcross/backcross and outcross/intercross strategies in strain C57Bl/6Jico (Ifacredo,
France) were used in combination with microsatellite markers specific for the
C3HeB/FeJ and C57Bl/6Jico strains equally distributed over all 19 mouse chromosomes.
Oligonucleotides were obtained from MWG-Biotech AG (Ebersberg,
Germany). PCR reactions were performed with fluorescent-labeled primers, whose sequences were taken from Schalkwyk et al., 1999, http://www-genome.wi.mit.edu (site maintained by the Whitehead Institute for Genome Research, Cambridge MA, USA). The PCR reactions were performed in a MJ tetrad thermocycler PTC 225 device (MJ Research, Inc., Waltham MA, USA) in 25 μl reaction volumes, using BioTherm-DNA-polymerase (Genecraft, Germany). A four minute denaturation step was then followed by 28 amplification cycles, each comprising 30 seconds denaturation and 30 seconds annealing at the respective temperatures given in Schalkwyk et al., see above, and 30 seconds extension at 72°C. Samples were amplified with different dyes and products were separated on an ABI 3700 DNA sequencing device (PE Applied Biosystems, Foster City, USA) using internal length standards in every lane. Analysis was performed with Genescan version 3.0 and Genotyper version 2.1 software from ABI. We macromapped the locus of the mutation by identifying a chromosomal region having an increased allele frequency of markers representing the C3H founder strain.
Our analysis of DO2 and DIC mice indicated that the Cral mutation coseggregates with the marker D12Mitl41 on chromosome 12. 3. Fine Mapping
A detailed haplotype analysis of affected and non-affected Cral mice using identified single nucleotide polymorphisms (SNPs) located in the critical region demonstrated, that the mutation was located between SNP markers in the Ppp2r5c gene (encoding the protein phosphatase 2, regulatory subunit B (B56), gamma isoform) and the Traf3 gene (encoding the Tnf receptor-associated factor 3).
4. PCR Amplification of Cytoplasmic Dvnein Heavy Chainl Gene Oligonucleotides were obtained from MWG-Biotech AG (Ebersberg,
Germany). The PCR reactions were performed in a MJ tetrad thermocycler PTC 225 device (MJ Research, Inc., Waltham MA, USA) in 25 μl reaction volumes using
BioTherm-DNA-polymerase (Genecraft, Germany). A four minute denaturation step was then followed by 28 amplification cycles comprising each 30 seconds denaturation and 30 seconds annealing at the respective temperatures given in
Schalkwyk et al. (1999), and 30 seconds extension at 72°C. A total of 77 exon sequences of the murine Dnchcl gene were identified by sequence alignment of the full-length mouse Dnchcl cDNA sequence (GenBank Ace. No. AY004877) and mouse BAC clone RPCI-23-134O19 (GenBank Ace. No. AL596265) using Sequencher™ Nersion 4.0.5 (Gene Codes Corp., Ann Arbor MI, USA). Exon specific primers located in the flanking intronic sequences were designed using Primer3, maintained by the Whitehead Institute for Biomedical Research.
All 77 exons of the Dnchcl gene were amplified using a DΝA pool of 4 affected pups (Cral/Cral) as well as C3H and C57 control DΝA as PCR templates.
5. DΝA Sequence Analysis
PCR amplicons were purified by using the QIAquick PCR Purification Kit
(Qiagen, Hilden, Germany) according to the manufacturers protocol. PCR products were sequenced using forward/reverse PCR primers and "Big Dye" thermal cycle sequencing Kit (ABI PRISM, Applied Biosystems, Foster City CA, USA). The reaction products were analyzed on an ABI 3700 DNA sequencing device.
The sequences were edited manually and contig assembly for mutation detection was performed using Sequencher version 4.0.5 (Gene Codes Corp., Ann
Arbor MI, USA). The sequence analysis detected an A to G (codon TAC to TGC) transition in exon 13 of the mouse gene, at a location conesponding to nucleotide position 3328 (position +3164 ofthe coding sequnce) in the Dnchcl mRNA sequence
(GenBank Ace. No. AY004877, SEQ ID NO:l) The PCR amplicons with 364 bp in size, and including exon 13, were generated by PCR amplification with oligonucleotide Dnchc 1-25 (5'-TCCAAGACTTTGAAGTGAGGTTC; located in intron 12, SEQ ID NO: 15) and with oligonucleotide Dnchcl-26 (5'-
CAGGGCCAAACACCAATACT; located in intron 13, SEQ ID NO 16). The PCR amplicons generated contain either the wild type sequence (SEQ ID NO: 13) or the mutated sequence (SEQ ID NO: 14), as listed in Tables 10 and 11, respectively.
Table 10. Wild type Dnchcl 364 bp PCR Amplicon (SEQ ID NO:13) wild type: TCCAAGACTTTGAAGTGAGGTTCTCTAATGG GTGAAGACATGGA CTGTTGACATGGTGGGTTCTAGCATATTAATAGTCTACAGCACTG CAGACTAGAATTGAGCTGTGTTTCCTTTGCAGGTTTGGCTTCAGT ACCAGTGTTTGTGGGATATGCAGGCAGAAAACATTTACAACAGGC TAGGGGAAGATCTCAACAAGTGGCAAGCTCTCCTGGTCCAGATAA GGAAAGCCAGAGGAACCTTTGACAATGCGGAAACCAAGAAAGAGT TTGGTCCGGTGGTGATAGATTACGGCAAGGTGAGCTTGGCTTGTT GTCAAAAGGCACCAGGCAGCCGTAAGATCAGTATTGGTGTTTGGC CCTG
Table 11. Mutant Dnchcl 364 bp PCR Amplicon (SEQ ID NO: 14) mutant:
TCCAAGACTTTGAAGTGAGGTTCTCTAATGGTGTGAAGACATGGA CTGTTGACATGGTGGGTTC AGCATA T A GTCTACAGCACTG CAGACTAGAATTGAGCTGTGTTTCCTTTGCAGGTT GGCTTCAGT GCCAGTGTTTGTGGGATATGCAGGCAGAAAACATTTACAACAGGC TAGGGGAAGATCTCAACAAGTGGCAAGCTCTCCTGGTCCAGATAA GGAAAGCCAGAGGAACCTTTGACAATGCGGAAACCAAGAAAGAGT TTGG CCGG GGTGATAGATTACGGCAAGGTGAGCTTGGCTTGTT GTCAAAAGGCACCAGGCAGCCGTAAGATCAG TTGG GTTTGGC CCTG The A to G transition (see nucleotide exchange underlined in SEQ ID NO: 14) results in an Tyr (Y) to Cys (C) amino acid exchange at aa position 1055 in SEQ ID NO:2. The mutation was confirmed by sequence analysis of 13 adult Cral"/+ mice and 5 Crar/_ pups, respectively. The complete nucleic acid sequence ofthe mutant transcript (SEQ ID NO:3) and the complete amino acid sequence ofthe mutant protein (SEQ ID NO:4) are shown above.
EXAMPLE 7: Method for Production of Mutant Animals of the Invention by Gene Targeting Technology The construction of a recombinant targeting vector to insert a point mutation in exon 13 of the mouse Dnchcl gene may be performed according to well known techniques: for example by the Lambda-KO-5/z system of Nehls and Wattler, WO- A2-01/75127.
1. Vector construction In a first step, a l,5kbp genomic DNA fragment was PCR amplified, representing the left arm of homology of the targeting vector to be constructed. After subsequent subcloning of the PCR fragment into a plasmid vector, for example pCR 2.1-TOPO (K4500-01, Invitrogen Corp., Carlsbad, California, USA), according to the manufacurer's instructions, plasmid DNA, bearing the conect Dnchcl insert is subject to site-directed mutagenesis, using a QuickChange Site-Directed Mutagenesis Kit (200518, Stiatagene, La Jolla CA, USA), as outlined in the manufacurer's instructions. The plasmid vector (parental DNA template) and two oligonucleotide primers, each primer complementary to opposite strands of the vector insert and containing the desired point mutation (exon 13, position 3169 of Dnchcl cDN A), were denatured and subject to PCR amplification with a proof-reading DNA polymerase (Pfu Turbo), provided in the kit. Using the non-strand displacing action of Pfu Turbo DNA polymerase, mutagenic primers were incorporated and extended, resulting in nicked circular DNA strands. In a restriction digest with Dpnl, only the methylated parental parental DNA template was susceptible to Dpnl digestion. After transformation in XLl-Blue supercompetent cells, provided with the kit, nicks in the mutated (point mutation) plasmid DNA were repaired. Mutation positive colonies were selected and plasmid DNA was isolated, according to the manufacurer's instructions (Stiatagene, La Jolla CA, USA). Plasmid DNA, bearing the point mutation in exon 13, as described in the present invention, was subject to PCR amplification with primers, bearing SfiC and SfiA sequence overhangs, respectively, as described in the published patent application WO-A2-01/75127. The PCR fragment, representing the left arm of homology was further processed as described in the aforementioned patent application. The vector described in WO-A2-01/75127, includes a linear lambda vector (lambda-KO-5y?) that comprises a sniffer fragment, an E. coli origin of replication, an antibiotic resistance gene for bacteria selection, two negative selection markers suitable for use in mammalian cells, and LoxP sequences for cre-recombinase mediated conversion of linear lambda phages into high copy plasmids. In a final lambda targeting vector, the stuffer fragment was replaced by Sfi A,B,C,D ligation of the left arm of homology (bearing the Dnchcl point mutation in exon 13), an ES cell selection cassette, and a right arm of homology, as described in the aforementioned patent application. In- vitro packaging of the ligation products, plating of a phage library, plasmid conversion, and DNA isolation of the homologous recombination plasmid vector is performed according to standard procedures known to persons skilled in the art.
2. ES Cell Transformation and Production of Mice Targeting vectors containing the point mutation were used for mouse ES cell transformation and to producing chimeric mice by blastocyst injection and transfer using standard methodology, well known in the art. The chimeras were bred to wild type mice to determine germline transmission. Heterozygotes and subsequently homozygotes were generated according to well-known techniques.
EXAMPLE 8: Method for the Detection of Nucleic Acid of the Present Invention: Mutation Detection using a Polymorphic Rsal Restriction Site
The nucleotide transition A to G in the nucleic acid sequence of the Dnchcl gene results in the disappearance of a restriction site for the restriction enzyme Rsal.
As a result, the restriction pattern of the nucleic acid sequence of Dnchcl will differ between the wild type and the mutant sequence. Diagnostic analysis was applied on amplified fragments from nucleic acids extracted from mutant and wild type mice as already described in the example. PCR and restriction steps were performed as follows.
The PCR reactions were carried out on lOng genomic DNAs using primers Dnchcl -25
(5'-TCCAAGACTTTGAAGTGAGGTTC, located in intron 12,_SEQ ID
NO:15) and Dnchcl-26 (5'-CAGGGCCAAACACCAATACT, located in intron 13,
SEQ ID NO:16), generating PCR products of either SEQ ID NO:13 (including the wild type exon 13 sequence) or SEQ ID NO: 14 (including the mutant exon 13 sequence). The products have a size of 364 bp.
PCR reactions were performed in 25 μl using Taq-DNA polymerase (SIGMA, Deisenhofen, Germany) according to the manufacturer's protocol. A further 4 minute denaturation step was followed by 28 cycles of denaturation at 94°C for 30 seconds; annealing at 55°C for 30 seconds; and 90 seconds extension at 72°C or the enzymatic digestion, 7 μl of PCR reaction, 10 μl H2O, 2 μl NEB buffer 1 and 1 unit Rsal (New England BioLabs, Inc., Beverly MA, USA) were incubated at 37°C for 2 hours. Restriction fragments were size separated by electrophoresis on 2% agarose gels (SeaKem ME agarose, Biozym Diagnostik Gmbh, Hess. Oldenburg, Germany) with 0.5 μg ethidium bromide ml"1 agarose. Gels were photographed after 2 hours electrophoresis at 3 V m"1. The presence of the point mutation deletes the Rsal site present in the PCR product of the wild type. This results in the appearance of a non- restricted fragment of 364 bp in the Cral"7" mutant samples in contrast to two restriction fragments of 136 bp and 228 bp in the wild type. This procedure even allows the discrimination of heterozygous and homozygous Cral mutants.
EXAMPLE 9: Identification of the Full-Length cDNA Sequence of Human DNCHl
No full-length cDNA sequences of the human DNCHl gene have been published. Here, we disclose a full-length cDNA sequence of the human DNCHl gene, which has the highest homology to the coding sequence of the orthologous mouse gene, Dnchcl (mRNA sequence published as Genbank Accession No.
AY004877). Although incomplete human DNCHl mRNA sequences, and several EST sequences containing partial sequences of human DNCHl, have been published, construction of the conect, full-length sequence for human DNCHl cDNA has not previously been achieved, perhaps as a consequence ofthe large size ofthe transcript, approximately 14.5 kb. Sequencing of several full-length cDNA clones generated from RNA of various human tissues obtained from independent sources confirms the sequence disclosed herein as SEQ ID NO: 17. Particular attention is required to prevent RNA degradation, especially in those tissues known to exhibit high RNase activity (e.g. brain tissues); the use of fresh tissue being especially important.
EXAMPLE 10: Comparison of the Full-Length cDNA Sequences of Human DNCHl and Mouse Dnchc 1
An exon structure comparison, as schematically depicted in Fig. 7, indicates an almost perfect identity in exon number und exon lengths between the mouse cytoplasmic dynein heavy chainl (Dnchc 1) and the human cytoplasmic dynein heavy chainl (DNCH 1) cDNAs. Exonic sequences were aligned with Sequencher software (version 4.0.5, GeneCodes Corp., Ann Arbor MI, USA).
Figure 8 exhibits a comparative listing of all mouse (MmDnchcl) and human
(Hs DNCHl) cytoplasmic dynein heavy chainl gene exons. The size of each exon is indicated in length by basepairs (bp). The human gene consists of 78 exons, and the mouse gene consists of 77 exons. The difference is caused by an additional RNA splice event in human, separating exon 67 (61 bp) and exon 68 (124 bp). The total lengths of the cDNAs are 13.941 bp in human DNCH 1, and 13.935 bp in mouse Dnchc 1.
EXAMPLE 11: Characteristics of Human and Mouse Cytoplasmic Dynein Heavy Chainl Protein The human ortholog of the mouse cytoplasmic dynein heavy chainl protein, human cytoplasmic dynein heavy chainl protein, has a length of 4646 amino acid residues (in comparison to 4644 for the conesponding mouse protein). Figure 9 represents an amino acid alignment of human DNCH 1 and mouse Dnchc 1, with black boxes indicating amino acid identity, and grey boxes indicating amino acid similarity. The amino acid identity is 97%, indicating that these are true orthologs.
EXAMPLE 12: Detection of Transcriptionally Deregulated Genes Expressed in the Brain
A series of genes selected for their putative biological relevance to cytoplasmic dynein heavy chainl function were analysed for altered RNA expression levels in the brain of homozygous Cral mice, in comparison to expression levels in brain of wild type mice.
Significantly altered expression levels were found for those genes listed in Figure 6. Transcriptional deregulation was determined by quantitative PCR-Light Cycler technology (Roche Diagnostics GmbH, Mannheim, Germany), according to the manufacturer's instructions.
EXAMPLE 13: Exons 12 and 13
Exon 13 is critical for activity of the cytoplasmic dynein heavy chainl, as demonstrated by the altered activity of the mouse protein bearing the amino acid substitution at position 1055, encoded by exon 13, the causative point mutation being located close to the 5' end of exon 13. The nucleotide sequence of exon 13 of the mouse wild type Dnchc 1 is provided as SEQ ID NO: 19.
Table 12. Nucleotide sequence of mouse exon 13 (SEQ ID NO: 19)
GTTTGGCTTCAGTACCAGTGTTTGTGGGATATGCAGGCAGAAAAC ATTTACAACAGGCTAGGGGAAGATCTCAACAAGTGGCAAGCTCTC CTGGTCCAGATAAGGAAAGCCAGAGGAACCTTTGACAATGCGGAA ACCAAGAAAGAGTTTGGTCCGGTGGTGATAGATTACGGCAAG
As the causative point mutation is close to the 5' end of exon 13, it is probable that the amino acid sequence encoded by exon 12 also has a significant influence on the activity ofthe protein.
SEQ ID NO:20 indicates the nucleotide sequence of exons 12 plus 13 of the mouse wild type Dnchc 1. Table 13. Nucleotide sequence of mouse exonl 2 and 13 (SEQ ID NO:20)
GTGGGAGTGCATTACGAGTTGACAGAGGAAGAGAAGTTCTATCGG AATGCACTGACAAGGATGCCCGACGGCCCTGTCGCCCTGGAAGAG TCCTACTCTGCGGTCATGGGCATAGTGACTGAAGTTGAGCAGTAT GTTAAGGTTTGGCTTCAGTACCAGTGTTTGTGGGATATGCAGGCA GAAAACATTTACAACAGGCTAGGGGAAGATCTCAACAAGTGGCAA GCTCTCCTGGTCCAGATAAGGAAAGCCAGAGGAACCTTTGACAAT GCGGAAACCAAGAAAGAGTTTGGTCCGGTGGTGATAGATTACGGC AAG
The amino acid sequences encoded by exons 12 plus 13 are located within a region known to be important for heavy chain dimerization (Tynan et al. (2000) J Biol Chem 275, 32769-32774). Therefore these amino acid sequences, and the peptide sequences encoded by the conesponding exons in other mammalian systems, may be used as targets for inactivation ofthe protein by small molecules, antibodies, antibody fragments, aptamers and other molecules designed to bind thereto.
Table 14. Amino acid sequence encoded in-frame by nucleotide sequences of mouse exon 13 (SEO ID NO:21)
VWLQYQCLWDMQAENIYNRLGEDLNKWQALLVQIRKARGTFDNAE TKKEFGPVVIDYGK
Table 15. Amino acid sequence encoded in-frame by nucleotide sequences of mouse exon 12 and 13 (SEQ ID NO:22)
VGVHYELTEEEKFYRNALTRMPDGPVALEESYSAVMGIVTEVEQY VKV LQYQCLWDMQAENIYNRLGEDLNKWQALLVQIRKARGTFDN AETKKEFGPVVIDYGK The conesponding human peptide sequences, encoded by human exon 13 (SEQ ID NO:23), or human exon 12 and 13 (SEQ ID NO:24), are prefened embodiments ofthe invention.
Table 16. Amino acid sequence encoded in-frame by nucleotide sequences of human exon 13 (SEO ID NO:23)
VW QYQC WDMQAENIYNRLGEDLNKWQALLVQIRKARGTFDNAE TKKEFGPVVIDYGK
Table 17. Amino acid sequence encoded in-frame by nucleotide sequences of human exon 12 and 13 (SEQ ID NO:24)
VGVHYELTEEEKFYRNALTRMPDGPVALEESYSAVMGIVSEVEQY VKVWLQYQCLWDMQAENIYNRLGEDLNKWQALLVQIRKARGTFDN AETKKEFGPVVIDYGK
Table 18. Amino acid sequence encoded in-frame by nucleotide sequences of human exon 12 and 13 (SEQ ID NO:24)
VGVHYELTEEEKFYRNALTRMPDGPVA EESYS VMGIVSEVEQY VKV LQYQCL DMQAE IYNRLGEDLNKWQA LVQIRKARGTFDN AETKKEFGPVVIDYGK
EXAMPLE 14: Gene Therapy
A number of viruses, including retroviruses, adenoviruses, herpes viruses, and pox viruses, have been developed as live viral vectors for gene therapy. A nucleic acid that codes for mutated cytoplasmic dynein heavy chainl protein (e.g. SEQ ID NO:4, SEQ ID NO:6) is inserted into the genome of a parent virus to allow it to be expressed by that parent virus. This task is accomplished by first constructing a DNA donor vector for in vivo recombination with a parent virus. The DNA donor vector contains:
(i) a prokaryotic origin of replication, so that the vector may be amplified in a prokaryotic host; (ii) a gene encoding a marker which allows selection of prokaryotic host cells that contain the vector (e.g. a gene encoding antibiotic resistance);
(iii) at least one gene encoding a desired protein located adjacent to a transcriptional promoter capable of directing the expression ofthe gene; and
(iv) DNA sequences homologous to the region of the parent virus genome where the foreign gene or genes will be inserted, flanking the construct of element (iii).
The donor vector further contain additional genes which encodes one or more marker which will allow identification of recombinant viruses containing inserted foreign DNA. The marker genes to be used include genes that encode antibiotic or chemical resistance (e.g. see Spyropoulos et al. (1988) J Virol 62, 1046-1054; Falkner and Moss (1988) J Virol 62, 1849-1854; Franke et al. (1985) Mol Cell Biol 5, 1918-1924), as well as genes such as the E. coli lacL gene, that permit identification of recombinant viral plaques by calorimetric assay (Panicali et al. (1986) Gene 47, 193-199).
Homologous recombination between donor plasmid DNA and viral DNA in an infected cell are made using standard techniques. The recombination results in the formation of recombinant viruses that incorporate the nucleic acid encoding SEQ ID NO:4. Appropriate host cells for in vivo recombination are eukaryotic cells that can be infected by the virus and transfected by the plasmid vector such as, for example, chick embryo fibroblasts, HuTK143 cells (human cells), and CV-1 and BSC-40 cells (both monkey kidney cells). Infection of cells by the virus and transfection of these cells with plasmid vectors is accomplished by techniques standard in the art.
Following in vivo recombination, recombinant viral progeny are identified by co-integration of a gene encoding a marker or indicator gene with the foreign gene or genes of interest, which, in this case, is the β-galactosidase gene. The presence ofthe β-galactosidase gene is selected using the chromogenic substrate 5-bromo-4-chloro-3- indolyl-β-D-galactosidase (Panicali et al. (1986) Gene 47, 193). Recombinant virus appears as blue plaques in a lawn of the host cells. Expression of the polypeptide encoded by the inserted gene is further confirmed by in situ enzyme immunoassay performed on viral plaques and confirmed by Western blot analysis, radioimmunoprecipitation assay (RIPA), and/or enzyme immunoassay (EIA). Positive viruses are cultured and expanded and stored.
In gene therapy, B cells are collected from peripheral blood of a patient and infected at MOI of 1, 2, 4, 8, 10 and 20. Expression ofthe cytoplasmic dynein heavy chainl is assayed 24 hours post-infection. Wild type virus is used as the negative control. The percent of cells transduced as a function of MOI and days after infection was determined by antibody and chromogenic substrate assays described above. B cells tranfected at high efficiency are reintroduced into the patient.
EXAMPLE 15: Transgenic animal model bearing transgenic cytoplasmic dynein heavy chainl
Transgenic mice carrying a mammalian dynein heavy chain 1 transgene are generated by either using the embryonic stem cell method, or the pronucleus method, both of them well-known methods in the art; preferably using the method of Nehls and Wattler, as described in WO-A2-01/75127. For transgenic methods see also US patents US6436701, US6018097, US5942435, US5824837, US5731489, and US5523226.
EXAMPLE 16: In vitro dynein motility assay Abnormalities in axonal transport are described in the human disease ALS
(Sasaki and Iwata (1996) Neurology 47, 535-540). Such abnormalities are also observed in several mouse models with motor neuron degeneration, e.g. the wobbler mouse (Mitsumoto et al. (1986) Ann Neurol 19, 36-43) and transgenic mice overexpressing the heavy chain of neurofilament protein (Collard et al. (1995) Nature 375, 61-64), SOD-1 (Zhang et al. (1997) J Cell Biol 139, 1307-1315) and dynamitin (LaMonte et al. (2002) Neuron 34, 715-727). Studies in Drosophila have shown that mutations in the cytoplasmic dynein heavy chain (cDhc64c) lead to a disruption of axonal organelle transport in both directions and as a consequence to axonal swelling and posterior paralysis (Martin et al. (1999) Mol Biol Cell 10, 3717-3728). A microtubule gliding assay is performed based on a commercial assay offered by Cytoskeleton, Inc. (Denver, CO, USA). In brief, the assay involves coating a glass slide with the protein of interest and then examining, by time-lapse or by real time microscopy, the protein's ability to translocate microtubules in the presence of ATP. Cytplasmic dynein heavy chain 1 proteins, carrying non-conserevd amino acid substitutions at residue positions as highlighted in Figures 9 and 10, and listed in Example 19, are over-expressed either in a bacterial, or in an eucaryotic expresion system. A prefened method is the cDNA subcloning into expression vectors of the Gateway cloning and expression system (Invitrogen, California, USA), according to the manufacturer's instructions. Purification of recombinant dynein heavy chain 1 from host cells can be performed using standard methods well-known to those skilled in the art. For standard references, see in Sambrook et al. (eds.), MOLECULAR CLONING: A LABORATORY MANUAL (2nd Ed.), Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, 1989; and Ausubel et al. (eds.), CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, John Wiley & Sons, New York, NY, 1993.
Differences in proteins ability to translocate microtubules in the presence of ATP, whereby the proteins carry particular non-conserved amino acid substitution, are indicative of functional domains of dynein heavy chain 1 in axonal transport.
EXAMPLE 17: Interaction of the dynein complex with the EAAT2 glutamate transporter
A direct link between the Cral mouse line and the excitotoxicity hypothesis for ALS, as described in the background of the Invention, is the excitatory neuronal damage detected in the brains of heterozygote Cral animals. Comparable defects have been found in the brains of mice lacking EAAT2, an glutamate transporter (Tanaka et al., Science vol.276, 1699-1702, June 1997).
Co-immunoprecipitation studies using antibodies raised against the cytoplasmic dynein heavy chain 1, the 74 kDa intermediate chain, the dynactin pl50 component and against the EAAT2 transporter in various combinations are performed using brain homogenates of wild type mice, Cral homozygotes, and Cral heterozygotes. Anti dynein heavy chain 1 antibodies are raised against epitopes, which cany non-conserved amino acid substitutions of those amino acid residues highlighted in Figures 9 and 10, and listed in Example 19. Protein expression vectors and antibodies are generated as described, in example, in Ausubel et al., Cunent protocols in Molecular Biology, Massachusetts general Hospital, Harvard Medical School, 1996 by John Wiley and Sons, Inc.). Antibodies raised against he 74 kDa intermediate chain, the dynactin pi 50 component and against the EAAT2 transporter are commmercially available (anti-EAAT2 antibody from Accurate Chemical and Scientific Corp; anti-74 kDa intermediate chain antibody from Chemicon Int. Corp.; anti-dynactin pi 50 antibody from BD Transduction Laboratories). Co- Immunoprecipitation studies are well known in the art and are performed as described, for example, in Ausubel et al., Cunent protocols in Molecular Biology, Massachusetts general Hospital, Harvard Medical School, 1996 by John Wiley and Sons, Inc.).
The results of the assay are indicative for dynein heavy chain 1 function in EAAT2 glutamate transporter/dynein motor complex interaction. Functional amino acid residues are identified.
EXAMPLE 18: Quantitative Binding Study
To investigate a possible influence of an cytoplasmic dynein heavy chain 1 mutation on the hole dynein complex, which might result in an impaired transport process, quantitative binding studies are performed. Surface plasmon resonance (SPR) spectroscopy, such as, in example, in the Biacore technology (Biacore AB, Uppsala, Sweden) is an appropriate tool. By this method the interaction of two molecules binding each other is described by two rate parameters, the association rate parameter k(a) and the dissociation rate parameter k(d). Under standardized conditions these kinetic parameters can be determined by analysis of their interaction in an affinity- based biosensor system. The association rate describes the cohesion frequency and the attraction between two molecules. The dissociation rate describes the stability of the complex.
Using the SPR technique, the affinity of mutated dynein heavy chain domains, canying non-conserved amino acid substitutions ofthe residues highlighted in Figures 9 and 10, and listed in Example 19, to other components of the dynein complex are analysed. In similar studies the influence of mutations on protein - protein affinities have been studied (Hobba et al., J Biol Chem 273(31):19691-19698) 1998; Starling et al., J Exp Med 185(8):1487-1492, 1997).
EXAMPLE 19: Characterization of dynactin/dynein complex proteins from different species - amino acid conservation
Inter-species comparison of mouse and human dynein heavy chain 1, dynein intermediate chain 1, dynein intermediate chain 2, and DCTN 1 amino acids was perfomed. The degree of identity and the degree of similarity are summarized in the following table:
The high degree of amino acid identity and similarity is indicative for highly conserved residues between the species indicating functional significance of these' conserved residues in the proteins compared in this Example, see Figures 9, 11, 13 and 15. The amino acid being exchanged in dynein heavy chain 1 (1055Y to C, as described in the invention herein) is conserved between the species compared, as indicated in Figure 9.
In an inter-species comparison of mouse, human, and rat dynein heavy chain 1, dynein intermediate chain 1, dynein intermediate chain 2, and DCTN 1 amino acids was perfomed, the degree of identity and the degree of similarity are summarized in the following table:
The high degree of amino acid identity and similarity is indicative for highly conserved residues between the species indicating functional significance of these conserved residues in the proteins compared in this Example, see Figure 10, 12, 14, and 16. The amino acid being exchanged in dynein heavy chain 1 (1055Y to C, as described in the invention herein) is conserved between the species compared, as indicated in Figure 10.
For several subunits ofthe dynactin/dynein complex, several binding domains are predicted, with which the individual proteins of the dynactin/dynein complex binds to other subunits of the complex. The binding domains of several proteins, which are subunits of the dynactin/dynein complex are summarized in respect to the amino acids positions:
a) With respect to mouse Dnchcl the following domains and binding sites are predicted, which are summarized in respect to the amino acid positions of the mouse Dnchcl protein: heavy chain dimerization domain (Hcd) between amino acids 300 and 1140;
74 kDa intermediate chains binding domain (led) between amino acids 446 and 701; 53-59 kDa light intermediate chains binding domains (Lcds) between amino acids 649 and 800 (Tynan et al. (2000) J Biol Chem. 275, 32769-32774).
b) With respect to cytoplasmic dynein intermediate chain 1 the following binding domains are predicted, which are summarized in respect to the amino acid positions ofthe mouse cytoplasmic dynein intermediate chain 1 protein:
10 kDa light chain binding domain (lOkDad) between amino acids 147 and
157 (Lo et al., J.Biol. Chem. 276(17): 14059-14066, 2000); light chain 2B binding domain (2Bd) between amino acids 243 and 314 (Susalka et al., J. Biol. Chem.
277(36):32939-32946, 2002); Tctexl binding domain (Tctexld) between amino acid 140 and 157 (Mok et al. J. Biol. Chem. 276(17):14067-14074, 2001); pl50 binding domain (pl50d) between amino acid 1 and 123 (see in Susalka et al., J. Biol. Chem. 277(36):32939-32946, 2002).
c) For mouse cytoplasmic dynein intermediate chain 2 several binding domains are predicted, which are summarized in respect to the amino acid positions of the mouse cytoplasmic dynein intermediate chain 2 protein:
10 kDa light chain binding domain (lOkDad) between amino acids 129 and 139; light chain 2B binding domain (2Bd) between amino acids 226 and 297; Tctexl binding domain (Tctexld) between amino acid 122 and 139; pl50 binding domain (pl50d) between amino acid 1 and 123 (see in Susalka et al., J. Biol. Chem. 277(36):32939-32946, 2002).
d) For mouse pi 50 (DCTN 1) several binding domains are predicted, which are summarized in respect to the amino acid positions of the mouse pi 50 protein: microtubule binding domain (Microtd) between amino acids 39 and 150 (Waterman-Storer et al, P.N.A.S. 92:1634-1638, 1995); ARPl binding domain (ARPld) between amino acids 1006 and 1021 (see in Waterman-Storer et al, P.N.A.S. 92:1634-1638, 1995); cytoplasmic dynein intermediate chain binding domain (Died) between amino acid 133 and 899 (Karki and Holzbaur, J. Biol. Chem. 270:28806- 28811, 1995).
In an inter-species comparison of the amino acids of the conesponding mouse and human proteins, the degree of conserved (i.e. identical and similar) amino acids in these domains and binding sites is summarized in the following tables:
Cytoplasmic dynein intermediate chain 1
In an inter-species comparison of the amino acids ofthe conesponding mouse, rat, and human proteins, the degree of conserved (i.e. identical and similar) amino acids in these domains and binding sites is summarized in the following tables:
*(mouse and rat amino acid sequences are 100% identical for cytoplasmic dynein intermediate chain 2)
In an inter-species comparison of cytoploasmic dynein heavy chain 1 amino acid sequences of the species mouse, human, rat, Drosophila, and C. elegans, the degree of conserved (i.e., identical and similar) amino acids in these domains and binding sites is the following:
Conserved amino acid residues within the defined binding domains of the individual proteins are listed in Table 19, 20, 21, and 22. Evolutionary pressure has conserved these residues at their particular locations in the molecule. It is predicted that any non-conservative amino acid substitution will modify the protein's normal biological function in a manner analogous to that observed in the present invention. Hence, identification of such an abnormal cytoplasmic dynein intermediate chain 1 protein sequence in a biological sample, or of the a DNA encoding such an abnormal cytoplasmic dynein intermediate chain 1 protein, will be indicative of an increased probability of developing the phenotype of the present invention.
EXAMPLE 20: Mutation Detection at Human Patient Samples by
Heteroduplex Analysis using Temperature Gradient
Capillary Electrophoresis (TGCE) - Mutation Detection in
Exon 13 of Human Cytoplasmic Dynein Heavy Chain 1
(DNCHl) Assay Description: Human genomic DNA is isolated and is subject to PCR amplification according to standard methods in the art, in example, as described in
Example 6. For detection of mutations with unknown positions in PCR amplified
DNA fragments, double-stranded (ds) DNA is electrophoresed through a temporal gradient of increasing temperature (Temperature Gradient Capillary Electrophoresis (TGCE); RevealSystem, SCE9610, by SpectruMedix LLC, State College, PA, USA).
Because retardation of dsDNA during electrophoresis is greatest at the temperature of partial denaturation, DNA fragments of the same size can be separated according to their thermodynamic stabilities. Base mismatches within dsDNA molecules
(heteroduplices) lead to a significant destabilization resulting in significant differences in melting temperatures (Tm) between heteoduphces and perfectly paired dsDNA
(homoduplices). Such differences in Tm allow the separation of heteroduplices from homoduplices in a temperature gradient electrophoresis and serve as the basis for mutation detection by TGCE.
Detection of point mutations in exon 13: For detection of homo- or heterozygous mutations, an equimolar mixture of chromosomal DNA from 5 to 10 healthy individuals is prepared. An equimolar amount of this template DNA (healthy individuals) is added to each sample DNA (patient), and the target region is amplified using a standard PCR reaction with gene specific primers. For analysis of human DNCHl exon 13, a 290 bp DNA fragment containing all exon 13 DNA sequence, was generated with the following intronic primers:
primer sequence location in intron no. hDnchcl-21 (SEQ ID NO: 26) S'-TGTGAACATAAGAGGTGCCAGT 12
hDnchcl-22 (SEQ ID NO: 27) 5^CTACCCGTGACACCTTTCAA 13
Following the manufacturers instructions, hybrids of wildtype and mutant sequences are formed in a denaturation/renaturation step, tiansforming base pair exchanges into heteroduplices with lower thermal stability. A typical temperature profile for denaturation/renaturation is:
• heat sample to 95°C and hold for 3 min
• decrease from 95°C to 80°C at 3°C/min
• decrease from 80°C to 55°C at 1 °C/min
• hold 20 min at 55°C
• decrease from 55°C to 45°C at l°C/min • decrease from 45°C to 25°C at 2°C/min
Depending on the DNA concentration obtained in the PCR reaction the sample is diluted in a range of 1: 10 to 1:50 and subjected to TGCE. Washing, dilution and running buffers are supplied by the manufacturer. Typical operation parameters for TGCE are:
• Prerun: 25 min
• Injection voltage: 3-8 kV
• Injection time: 3-10 sec. • Running voltage: 10 kV
• Electrophoresis time: 60 min The applied temperature gradient during electrophoresis depends on the base composition (G+C content) of the analyzed fragment and ranges from 55°C to 70°C. For the 290 bp exon 13 fragment of hDNCHl a temperature gradient from 55°C to 65 °C with a ramp time of 21 min was applied.
Upon completion the obtained electrophoresis pattern is analyzed for additional bands resulting from decreased mobility of heteroduplices during TGCE, using the manufacturers software program Revelation 2.10. Candidate fragments are further analyzed by DNA sequencing, using the method described in Example 6, Section DNA Sequence Analysis.
Table 19. Conserved amino acid residues in binding domains Hcd, led, and Led of Dnchcl of mouse (M. musculus), rat (R. norvegicus), human (H. sapiens), Drosophila melanogaster, and
Caenorhabditis elegans:
- conserved residues numbered as mouse Dnchcl amino acid positions.
Explanation of amino acid single letter code:
A=Ala C=Cys D=Asp E=Glu F=Phe G=Gly H=His l=lle N=Asn P=Pro Q=Gln R=Arg S=Ser T=Thr V=Val K=Lys L=Leu M=Met W=Trp Y=Tyr
Binding Domains
P150d = binding domain for p150 protein Tctexld = binding domain forTctexl protein 10kDad = binding domain for 10kDa light chain 2Bd = binding domain for 2B light chain protein Table 20. Conserved amino acid residues in binding domains pl50d, Tctexld, lOkDad, and 2Bd of cytoplasmic dynein intermediate chainl of mouse (Mus musculus), rat (Rattus norvegicus), and human (Homo sapiens)
conserved residues numbered as human cytoplasmic dynein heavy chain 1 amino acid positions
C. Conserved amino acid residues in binding domain lOkDad
164S 165Y 166S| 167K| 168E| 169T| 170Q[ 171T| 172P| 173L| 174A
10
Explanation of amino acid single letter code:
A=Ala C=Cys D=Asp E=Glu F=Phe G=Gly H=His l=lle N=Asn P=Pro Q=Gln R=Arg S=Ser T=Thr V=Val K=Lys L=Leu M=Met W=Trp Y=Tyr
Binding Domains
P150d = binding domain for p150 protein Tctexld = binding domain for Tctexl protein 10kDad = binding domain for 10kDa light chain 2Bd = binding domain for 2B light chain protein Table 21. Conserved amino acid residues in binding domains pl50d, Tctexld, lOkDad, and 2Bd of cytoplasmic dynein intermediate chain 2 of mouse (Mus musculus), rat (Rattus norvegicus), and human (Homo sapiens
conserved residues numbered as human cytoplasmic dynein heavy chain 2 amino acid positions
l
C. Conserved amino acid residues in binding domain lOkDad
155T 156Y 157T 158K 159E 160T 161Q 162T 163P 164V 165M
Explanation of amino acid single letter code:
A=Ala C=Cys D=Asp E=Glu F=Phe G=Gly H=His Nile N=Asn P=Pro Q=Gln R=Arg S=Ser T=Thr V=Val K=Lys L=Leu M=Met W=Trp Y=Tyr
Binding Domains
P150d = binding domain for p150 protein Tctexld = binding domain for Tctexl protein 10kDad = binding domain for 10kDa light chain 2Bd = binding domain for 2B light chain protein Table 22. Conserved amino acid residues in binding domains Microd, Arpld, and Died of pl50 of mouse (M. musculus), rat (rattus norvegicus) and human (Homo sapiens). conserved residues numbered as human p!50 amino acid positions
Explanation of amino acid single letter code:
A=Ala C=Cys D=Asp E=Glu F=Phe G=Gly H=His l=lle N=Asn P=Pro Q=Gln R=Arg S=Ser T=Thr V=Val K=Lys L=Leu M=Met W=Trp Y=Tyr
Binding Domains
P150d = binding domain for p150 protein Tctexld = binding domain for Tctexl protein 10kDad = binding domain for 10kDa light chain 2Bd = binding domain for 2B light chain protein This invention has been described in detail including the preferred embodiments thereof. However, it will be appreciated that those skilled in the art, upon consideration of this disclosure, may make modifications and improvements thereon without departing from the spirit and scope ofthe invention as set forth in the claims. All references, patents, patent applications and Genbank references recited in this patent application is hereby incorporated by reference in their entirety.
Table 23. List of certain sequences provided in this application

Claims

We Claim:
1. A modified cytoplasmic dynein heavy chainl polypeptide, wherein: (a) the amino acid sequence of said modified cytoplasmic dynein heavy chainl differs from the corresponding wild type sequence by substitution, deletion, or insertion of at least one amino acid in the wild type cytoplasmic dynein heavy chainl sequence;
(b) a biological activity of said modified cytoplasmic dynein heavy chainl polypeptide is altered by at least 10% in comparison to the activity of the wild type cytoplasmic dynein heavy chainl polypeptide.
2. The modified cytoplasmic dynein heavy chainl polypeptide of claim 1 wherein said biological activity is altered by at least 50% in comparison to the activity ofthe wild type cytoplasmic dynein heavy chainl polypeptide.
3. The modified cytoplasmic dynein heavy chainl polypeptide of claim 1 wherein said biological activity is altered by at least 75% in comparison to the activity ofthe wild type cytoplasmic dynein heavy chainl polypeptide.
4. The modified cytoplasmic dynein heavy chainl polypeptide of any of claims 1 to 3, wherein the alteration of said biological activity is a reduction of activity.
5. The modified cytoplasmic dynein heavy chainl polypeptide of any of claims 1 to 3, wherein the alteration of said biological activity is an increase of activity.
6. The modified cytoplasmic dynein heavy chainl polypeptide of any of claims 1 to 5, wherein the alteration of said biological activity is demonstrated by a method selected from the group consisting of:
(a) determining the relative proportions of cytoplasmic dynein heavy chainl dimer and cytoplasmic dynein heavy chainl monomer in a test sample; (b) quantifying the proportion of cytoplasmic dynein complex that is fully assembled from its subunits in an in vitro assembly assay;
(c) quantifying the proportion of cytoplasmic dynein complex subunits that remain unassembled in an in vitro assembly assay; (d) quantifying the proportion of cytoplasmic dynein heavy chainl that binds to microtubules in vitro;
(e) assaying the rate of dimerization of the cytoplasmic dynein heavy chainl polypeptide in vitro;
(f) assaying the rate of assembly of the cytoplasmic dynein complex from constituent subunits in vitro;
(g) assaying the rate of binding of cytoplasmic dynein heavy chainl to microtubules in vitro;
(h) assaying motor activity ofthe cytoplasmic dynein complex in vitro;
(i) assaying motor activity of the cytoplasmic dynein heavy chainl in vitro;
(j) quantifying binding of cytoplasmic dynein heavy chainl polypeptide to an antibody having an epitope specific for cytoplasmic dynein heavy chainl ; and
wherein the method compares the results provided by said modified cytoplasmic dynein heavy chainl polypeptide to those provided by the corresponding wild type cytoplasmic dynein heavy chainl polypeptide.
7. The modified cytoplasmic dynein heavy chainl polypeptide of claim 6, wherein said antibody is selected from the following group;
(a) an antibody binding an epitope situated within the dimerization domain of the cytoplasmic dynein heavy chainl ;
(b) an antibody binding an epitope situated within a binding domain ofthe cytoplasmic dynein heavy chainl the binds a subunit ofthe cytoplasmic dynein complex; (c) an antibody binding an epitope located in exon 12 of cytoplasmic dynein heavy chainl;
(d) an antibody binding an epitope located in exon 13 of cytoplasmic dynein heavy chainl ; (e) an antibody binding an epitope located in exons 12 plus 13 of cytoplasmic dynein heavy chainl ;
(f) an antibody binding an epitope formed by the intact dimer of cytoplasmic dynein heavy chainl, but not by the individual monomers.
8. The modified cytoplasmic dynein heavy chainl polypeptide of claim 6, wherein motor activity of the cytoplasmic dynein heavy chainl is determined in vitro by at least one parameter selected from the group consisting of:
(a) rate of total protein transport through cellular Golgi apparatus;
(b) axonal transport;
(c) retrograde axonal transport; (d) microtubule gliding rate;
(e) phagosome movement along microtubules;
(f) rate of intracellular trafficking of membranous organelles;
(g) nuclear migration rate;
(h) prometaphase chromosome movement.
9. The modified cytoplasmic dynein heavy chainl polypeptide according to any one of claims 1 to 8 wherein expression of the protein within a non-human animal model heterozygous for the modified and wild type cytoplasmic dynein heavy chainl gene results in the animal developing at least one of the following phenotypical features:
(a) epilepsy;
(b) myoclonic cramping;
(c) neuronal excitotoxicity; (d) cell damage in hippocampus;
(e) cell damage in cerebellum;
(f) neurodegenerative disease;
(g) under-activity or undesirable activity of endogenous cytoplasmic dynein heavy chainl ;
(h) under-expression, under-production or undesirable production of endogenous cytoplasmic dynein heavy chainl; and
(i) undesirable medical condition shown to be modulated by endogenous cytoplasmic dynein heavy chainl .
10. The modified cytoplasmic dynein heavy chainl polypeptide according to claim 9 wherein the phenotypical features developed by said non-human animal model comprise at least one feature selected from the following group:
(a) myoclonic cramping ofthe fore limbs;
(b) myoclonic cramping ofthe hind limbs; (c) cell damage in CA3 and CA4 sectors of hippocampus;
(d) cell damage in gyrus dentatus;
(e) neuronal damage in the upper layer of the cortex and in the Purkinje cell layer ofthe cerebellum;
(f) motor neuron impairment; (g) Alzheimer's disease;
(h) Parkinson's disease;
(i) amyotropic lateral sclerosis;
(j) spinal muscular atrophy; and
(k) fiber type grouping in Musculus tibialis anterior.
11. A modified cytoplasmic dynein heavy chainl polypeptide, wherein: (a) the amino acid sequence of said modified cytoplasmic dynein heavy chainl differs from the corresponding wild type sequence by substitution, deletion, or insertion of at least one amino acid residue in the wild type cytoplasmic dynein heavy chainl sequence; (b) the position of said amino acid residue in the cytoplasmic dynein heavy chainl sequence is selected from the group consisting of:
(i) those positions at which, in each of the wild type cytoplasmic dynein heavy chainl reference sequences, the identity of the wild type amino acid residue is restricted to conservative amino acid substitutions; and
(ii) those positions at which, in each of the wild type cytoplasmic dynein heavy chainl reference sequences, the identity of the wild type amino acid residue is conserved; and
(c) said wild type cytoplasmic dynein heavy chainl reference sequences consist of:
(i) SEQ ID NO: 18 (Homo sapiens);
(ii) Genbank Accession No. NP_062099 (Rattus norvegicus); and
(iii) Genbank Accession No. NP_084514 (Mus musculus).
12. The modified cytoplasmic dynein heavy chainl polypeptide of claim 11 wherein said the position of said amino acid residue is a position at which, in all ofthe wild type cytoplasmic dynein heavy chainl reference sequences, the identity ofthe wild type amino acid residue is conserved.
13. The modified cytoplasmic dynein heavy chainl polypeptide of any of claims 11 to 12, wherein said wild type cytoplasmic dynein heavy chainl reference sequences consist of:
(i) SEQ ID NO: 18 (Homo sapiens);
(ii) Genbank Accession No. NP_062099 (Rattus norvegicus);
(iii) Genbank Accession No. NP_084514 (Mus musculus); (iv) Genbank Accession No. NP_523929 (Drosophila melanogaster); and (v) Genbank Accession No. NP_084514 (Caenorhabd tis elegans).
14. The modified cytoplasmic dynein heavy chainl polypeptide of any of claims 11 to 13 wherein said amino acid residue corresponds to a residue selected from the group of conserved amino acid residues between Leu302 (302L) and
Phel 140 (1140F) of SEQ ID NO:2 (Mus musculus) specified in Table 19.
15. The modified cytoplasmic dynein heavy chainl polypeptide of any of claims 11 to 14 wherein said amino acid residue is positioned in a cytoplasmic dynein heavy chainl domain capable of binding a subunit of the cytoplasmic dynein complex selected from the group consisting of:
(a) cytoplasmic dynein heavy chainl ;
(b) cytoplasmic dynein intermediate chain;
(c) cytoplasmic dynein light intermediate chain; and
(d) cytoplasmic dynein light intermediate chain.
16. The modified cytoplasmic dynein heavy chainl polypeptide of any of claims 11 to 15 wherein said amino acid residue is positioned in the cytoplasmic dynein heavy chainl dimerization binding domain.
17. The modified cytoplasmic dynein heavy chainl polypeptide of any of claims 11 to 16 wherein said amino acid residue is located in a sequence selected from the group consisting of:
(a) sequences encoded by cytoplasmic dynein heavy chainl exoή 13;
(b) SEQ ID NO.21;
(c) SEQ ID O.23;
(d) sequences encoded by cytoplasmic dynein heavy chainl exons 12 andl3
(e) SEQ ID NO.22; (f) SEQ ID NO.24.
18. The modified cytoplasmic dynein heavy chainl polypeptide of any of claims 11 to 17 wherein said amino acid residue is located in a position corresponding to a residue selected from the group consisting of:
(a) in SEQ ID NO:2 (Mus musculus),
(i) residue 300 to residue 1140;
(ii) residue 416 to residue 701;
(iii) residue 649 to residue 800; (b) in SEQ ID NO: 18 (Homo sapiens); (i) residue 302 to residue 1142;
(ii) residue 418 to residue 703 ;
(iii) residue 651 to residue 802.
19. The modified cytoplasmic dynein heavy chainl polypeptide of claim 18 wherein said amino acid residue is located in a position corresponding to a residue selected from the group consisting of:
(a) in SEQ ID NO:2 (Mus musculus), residue 649 to residue 701 ;
(b) in SEQ ID NO: 18 (Homo sapiens), residue 651 to residue 703.
20. The modified cytoplasmic dynein heavy chainl polypeptide of any of claims 11 to 19, wherein the amino acid sequence of said modified cytoplasmic dynein heavy chainl differs from the corresponding wild type sequence by substitution, deletion, or insertion of two or more of said amino acid residues in the wild type cytoplasmic dynein heavy chainl sequence and wherein said amino acid residues are contiguous amino acid residues.
21. The modified cytoplasmic dynein heavy chainl polypeptide of any of claims 11 to 20, wherein the amino acid sequence of said modified cytoplasmic dynein heavy chainl differs from the corresponding wild type sequence by substitution, deletion, or insertion of at least ten of said amino acid residues.
22. The modified cytoplasmic dynein heavy chainl polypeptide of any of claims 11 to 21, wherein the amino acid sequence of said modified cytoplasmic dynein heavy chainl differs from the corresponding wild type sequence by substitution, deletion, or insertion of at least ten of said amino acid residues.
23. The modified cytoplasmic dynein heavy chainl polypeptide of any of claims 11 to 18 and 20 to 22, wherein said amino acid residue is selected from the following group:
(a) a residue at a position within ten residues of position 1055 ofthe amino acid sequence as shown in SEQ ID NO:2;
(b) a residue at a position within ten residues of position 1057 ofthe amino acid sequence as shown in SEQ ID NO : 18 ;
(c) a residue corresponding to one of the residues of the amino acid sequence
VEQYVKV LQYQCLWDMQAEN .
24. The modified cytoplasmic dynein heavy chainl polypeptide of any of claims 11 to 18 and 20 to 22, wherein said amino acid residue corresponds to a residue in SEQ ID NO:2 selected from the group consisting of:1035Y; 1036S 1037A; 1038V; 1039M; 1040G; 10411; 1042V; 1044E; 1045V; 1046E 1047Q; 1048Y; 1049V; 1050K; 1052W; 1053L; 1054Q; 1055Y; 1056Q 1058L; 1059W; D1060D; 1061M; 1062Q; 1063A; 1064E; and 1065N.
25. The modified cytoplasmic dynein heavy chainl polypeptide of claim 24 wherein said amino acid residue corresponds to a residue in SEQ ID NO:2 selected from the group consisting of: 1044E; 1045V; 1046E; 1047Q; 1048Y; 1049V; 1050K; 1052W; 1053L; 1054Q; 1055Y; 1056Q; 1058L; 1059W; 1060D; 1061M; 1062Q; 1063 A; 1064E; and 1065N.
26. The modified cytoplasmic dynein heavy chainl polypeptide of claim 24 wherein said amino acid residue corresponds to a residue in SEQ ID NO:2 selected from the group consisting of: 1052W; 1053L; 1054Q; 1055Y; and
1056Q.
27. A modified cytoplasmic dynein heavy chainl polypeptide wherein the modification is an amino acid substitution in the wild type cytoplasmic dynein heavy chainl sequence at a position selected from the group consisting of:
(a) a position corresponding to position 1055 of the amino acid sequence as shown in SEQ ID NO:2; and
(b) a position corresponding to position 1057 of the amino acid sequence as shown in SEQ ID NO: 19.
28. The modified cytoplasmic dynein heavy chainl polypeptide according to any of claims 1 to 27 wherein the modified cytoplasmic dynein heavy chainl polypeptide is a mammalian cytoplasmic dynein heavy chainl polypeptide.
29. The modified cytoplasmic dynein heavy chainl polypeptide according to claim 28 wherein the cytoplasmic dynein heavy chainl polypeptide is selected from the group consisting of:
(a) human cytoplasmic dynein heavy chainl polypeptide;
(b) murine cytoplasmic dynein heavy chainl polypeptide;
(c) rat cytoplasmic dynein heavy chainl polypeptide.
30. The modified cytoplasmic dynein heavy chainl polypeptide of any of claims 1 to 29, wherein said modified cytoplasmic dynein heavy chainl protein is a recombinant protein.
1. The modified cytoplasmic dynein heavy chainl polypeptide of any of claims 1 to 30 wherein said substitution, deletion, or insertion of at least one amino acid residue in the wild type cytoplasmic dynein heavy chainl sequence is located within a region ofthe polypeptide selected from the group consisting of:
(a) the region encoded by exon 12;
(b) the region encoded by exon 13 ;
(c) the cytoplasmic dynein heavy chainl dimerization domain;
(d) a cytoplasmic dynein heavy chainl binding domain for a subunit ofthe cytoplasmic dynein complex distinct from cytoplasmic dynein heavy chainl.
32. The modified cytoplasmic dynein heavy chainl polypeptide of any of claims 1 to 31 wherein said deletion is of more than one amino acid residue in the wild type cytoplasmic dynein heavy chainl sequence and extends into a region of the polypeptide selected from the group consisting of:
(a) exon 12;
(b) exon 13;
(c) the cytoplasmic dynein heavy chainl dimerization domain;
(d) a cytoplasmic dynein heavy chainl binding domain for a subunit ofthe cytoplasmic dynein complex distinct from cytoplasmic dynein heavy chainl.
33. The modified cytoplasmic dynein heavy chainl polypeptide according to any of claims 1 to 32 wherein the amino acid substitution replaces a Tyr residue.
34. The modified cytoplasmic dynein heavy chainl polypeptide according to any of claims 1 to 33 wherein said amino acid substitution is with an amino acid residue selected from the group consisting of Met, Leu, He, Val and Cys.
35. The modified cytoplasmic dynein heavy chainl polypeptide according to claim
34 wherein the amino acid substitution is with a Cys residue.
36. The modified cytoplasmic dynein heavy chainl polypeptide according to claim
35 wherein the modified cytoplasmic dynein heavy chaiiil polypeptide has an amino acid sequence selected from the group consisting of SEQ ID NO:4 and
SEQ ID NO:6.
37. A cytoplasmic dynein heavy chainl polypeptide comprising the polypeptide according to any one of claims 1 to 36.
38. A murine cytoplasmic dynein heavy chainl polypeptide having an amino acid sequence of SEQ ID NO:4.
39. A human cytoplasmic dynein heavy chainl polypeptide having an amino acid sequence selected from the group consisting of:
(a) the amino acid sequence as shown in SEQ ID NO: 6; and , (b) the amino acid sequence as shown in SEQ ID NO: 18.
40. A cytoplasmic dynein heavy chainl chimeric protein, comprising a cytoplasmic dynein heavy chainl polypeptide according to any one of claims 1 to 39, conjugated or fused with a non-cytoplasmic dynein heavy chainl polypeptide.
41. The cytoplasmic dynein heavy chainl chimeric protein of claim 40, which comprises a cytoplasmic dynein heavy chainl polypeptide according to any one of claims 37 to 39, conjugated or fused with a non-cytoplasmic dynein heavy chainl polypeptide.
42. A monoclonal antibody capable of binding specifically to a cytoplasmic dynein heavy chainl polypeptide having an amino acid sequence selected from the group consisting of SEQ ID NO:4 and SEQ ID NO:6 in preference to a cytoplasmic dynein heavy chainl polypeptide having an amino acid sequence selected from the group consisting of SEQ ID NO:2 and SEQ ID NO: 18.
43. A monoclonal antibody capable of. binding specifically to a cytoplasmic dynein heavy chainl polypeptide having an amino acid sequence of SEQ ID NO:6 in preference to the cytoplasmic dynein heavy chainl polypeptide of
SEQ ID NO: 18.
44. A composition comprising:
(a) a polypeptide selected from the group consisting of:
(i) the cytoplasmic dynein heavy chainl polypeptide of any of claims 1 to 37;
(ii) the murine cytoplasmic dynein heavy chainl polypeptide of claim 38;
(iii) the in-frame amino acid sequence derived from exon 12 of Dchc; (iv) the in-frame amino acid sequence derived from exon 13 of
Dchc;
(v) the in-frame amino acid sequence derived from exons 12 and 13 of Dchc;
(vi) the human cytoplasmic dynein heavy chainl polypeptide of claim 39;
(vii) the cytoplasmic dynein heavy chainl chimeric protein of any of claims 40 to 41; and
(viii) the monoclonal antibody of any of claims 42 to 43 ; and
(b) a pharmaceutically acceptable carrier.
45. The composition of claim 44 wherein the amino acid sequence of said polypeptide is selected from the group consisting of:
(a) SEQ ID NO.2; (b) SEQ ID NO: 18;
(c) SEQ ID NO.21;
(d) SEQ ID NO:22;
(e) SEQ ID NO:23; and (f) SEQ ID NO.24.
46. A nucleic acid sequence encoding a cytoplasmic dynein heavy chainl polypeptide selected from the group consisting of:
(a) the cytoplasmic dynein heavy chainl polypeptide according to any one ofclaims 27 to 39; and (b) the cytoplasmic dynein heavy chainl chimeric protein of claim 40.
47. A polynucleotide, preferably isolated, comprising the nucleic acid sequence according to claim 46.
48. A polynucleotide, preferably isolated, comprising a nucleic acid sequence encoding a polypeptide comprising the amino acid sequence shown in SEQ ID NO:18.
49. A polynucleotide, preferably isolated, comprising a nucleic acid sequence encoding a polypeptide comprising an amino acid sequence selected from the following group:
(a) SEQ ID NO.21; (b) SEQ ID NO:22;
(c) SEQ ID NO:23; and
(d) SEQ ID NO:24.
50. A nucleic acid vector comprising a polynucleotide selected from the following group:
(a) the polynucleotide of claim 47; (b) the polynucleotide of claim 48 ;
(c) the polynucleotide of claim 49;
(d) a polynucleotide comprising a nucleic acid sequence encoding a polypeptide comprising the amino acid sequence SEQ ID NO:23; and (e) a polynucleotide comprising a nucleic acid sequence encoding a polypeptide comprising the amino acid sequence SEQ ID NO:24.
51. An expression vector comprising the polynucleotide of any one of claims 47 to 48 operably linked to an expression control sequence suitable for directing transcription and translation ofthe polynucleotide in a selected host cell.
52. A host cell transformed with the vector of claim 51.
53. An antisense nucleic acid of length sufficient to inhibit the expression of a mutant cytoplasmic dynein heavy chainl protein and total cellular cytoplasmic dynein heavy chainl protein biological activity, wherein said antisense nucleic acid is complementary to a mammalian cytoplasmic dynein heavy chainl nucleic acid sequence.
54. The antisense nucleic acid according to claim 53 wherein said mammalian cytoplasmic dynein heavy chainl nucleic acid sequence is selected from the group consisting of human, bovine, equine, porcine, ovine, canine, feline, rat and murine cytoplasmic dynein heavy chainl nucleic acid sequences.
55. The antisense nucleic acid according to any of claims 53 to 54 wherein said mammalian cytoplasmic dynein heavy chainl nucleic acid sequence is selected from the group consisting of human cytoplasmic dynein heavy chainl sequences corresponding to SEQ ID NO: 6 and SEQ ID NO: 18 and mouse cytoplasmic dynein heavy chainl sequences corresponding to SEQ ID NO:2 and SEQ ID NO:4.
6. The antisense nucleic acid of any of claims 53 to 55, wherein the inhibitor of cytoplasmic dynein heavy chainl biological activity inhibits a condition selected from the group consisting of:
(a) epilepsy; (b) myoclonic cramping;
(c) neuronal excitotoxicity;
(d) cell damage in hippocampus;
(e) cell damage in cerebellum;
(f) neurodegenerative disease; (g) under-activity or undesirable activity of endogenous cytoplasmic dynein heavy chainl ;
(h) under-expression, under-production or undesirable production of endogenous cytoplasmic dynein heavy chainl ; and
(i) undesirable medical condition shown to be modulated by endogenous cytoplasmic dynein heavy chainl .
57. The antisense nucleic acid according to claim 56, wherein the inhibitor of cytoplasmic dynein heavy chainl biological activity inhibits a condition selected from the group consisting of:
(a) myoclonic cramping ofthe fore limbs; (b) myoclonic cramping ofthe hind limbs;
(c) cell damage in CA3 and CA4 sectors of hippocampus;
(d) cell damage in gyrus dentatus;
(e) neuronal damage in the upper layer of the cortex and in the Purkinje cell layer ofthe cerebellum; (f) motor neuron impairment;
(g) Alzheimer's disease;
(h) Parkinson's disease; (i) amyotropic lateral sclerosis;
(j) spinal muscular atrophy;
(k) fiber type grouping in Musculus tibialis anterior.
58. The antisense nucleic acid of any of claims 53 to 56, wherein the inhibitor of cytoplasmic dynein heavy chainl biological activity inhibits a condition selected from the group consisting of:
(a) over-activity or undesirable activity of endogenous cytoplasmic dynein heavy chainl;
(b) over-expression, over-production or undesirable production of endogenous cytoplasmic dynein heavy chainl; and
(c) undesirable medical condition shown to be modulated by endogenous cytoplasmic dynein heavy chainl.
59. The antisense nucleic acid according to claim 58, wherein the inhibitor of cytoplasmic dynein heavy chainl biological activity inhibits a condition selected from the group consisting of:
(a) undesirable cell division;
(b) tumorigenesis.
60. A ribozyme comprising a hybridising region and a catalytic region wherein the hybridizing region is capable of hybridizing to at least part of a target mRNA ' sequence transcribed from a genomic gene corresponding to SEQ ID NO:l, 3, 5 or 17, wherein the catalytic domain is capable of cleaving the target mRNA sequence to reduce or inhibit a cytoplasmic dynein heavy chainl mediated disorder.
61. A pharmaceutical composition comprising a nucleic acid molecule that inhibits or otherwise reduces a cytoplasmic dynein heavy chainl mediated disorder wherein the nucleic acid comprises at least about ten nucleotides and hybridizes to or forms a heteroduplex with an mRNA molecule directed from a gene encoding cytoplasmic dynein heavy chainl, the composition further comprising one or more pharmaceutically acceptable carriers.
62. The pharmaceutical composition of claim 61 for topical administration.
63. A medicament for the prevention, treatment or amelioration in a mammal of at least one medical condition selected from the group consisting of:
(a) epilepsy;
(b) myoclonic cramping;
(c) neuronal excitotoxicity;
(d) cell damage in hippocampus; (e) cell damage in cerebellum;
(f) neurodegenerative disease;
(g) under-activity or undesirable activity of endogenous cytoplasmic dynein heavy chainl;
(h) under-expression, under-production or undesirable production of endogenous cytoplasmic dynein heavy chainl ; and
(i) undesirable medical condition shown to be modulated by endogenous cytoplasmic dynein heavy chainl;
wherein said medicament comprises a polypeptide selected from the group consisting of:
(i) a cytoplasmic dynein heavy chainl polypeptide;
(ii) the in-frame amino acid sequence derived from exon 12 of mouse or human Dchc;
(iii) the in-frame amino acid sequence derived from exon 13 of mouse or human Dchc; (iv) the in-frame amino acid sequence derived from exons 12 and 13 of mouse or human Dchc; (v) the chimeric protein according to any of claims 40 to 41; and (vi) the monoclonal antibody according to any of claims 42 to 43.
64. The medicament according to claim 63 wherein said medical condition comprises at least one feature selected from the following group:
(a) myoclonic cramping ofthe fore limbs;
(b) myoclonic cramping ofthe hind limbs;
(c) cell damage in CA3 and CA4 sectors of hippocampus;
(d) cell damage in gyrus dentatus;
(e) neuronal damage in the upper layer of the cortex and in the Purkinje cell layer ofthe cerebellum;
(f) motor neuron impairment;
(g) Alzheimer's disease; (h) Parkinson's disease;
(i) amyotropic lateral sclerosis; (j) spinal muscular atrophy;
(k) fiber type grouping in Musculus tibialis anterior.
65. The medicament according to claims 63 to 64, wherein said polypeptide is a wild type mammalian cytoplasmic dynein heavy chainl polypeptide.
66. The medicament according to claim 65, wherein said polypeptide is human cytoplasmic dynein heavy chainl polypeptide.
67. The medicament according to claims 63 to 66, wherein said polypeptide has an amino acid sequence selected from the following group:
(i) SEQ ID NO:2; (ii) SEQ ID NO: 18; (iii) SEQ ID NO.21; (iv) SEQ ID NO:22; (v) SEQ ID NO:23; and (vi) SEQ ID NO:24.
68. A medicament for the prevention, treatment or amelioration in a mammal of at least one medical condition selected from the group consisting of:
(a) over-activity or undesirable activity of endogenous cytoplasmic dynein heavy chainl ;
(b) over-expression, over-production or undesirable production of endogenous cytoplasmic dynein heavy chainl ; and (c) undesirable medical condition shown to be modulated by endogenous cytoplasmic dynein heavy chainl;
wherein the medicament comprises a polypeptide selected from the group consisting of:
(i) a cytoplasmic dynein heavy chainl polypeptide according to any of claims 1 to 39;
(ii) the in-frame amino acid sequence derived from exon 12 of mouse or human Dchc;
(iii) the in-frame amino acid sequence derived from exon 13 of mouse or human Dchc; (iv) the in-frame amino acid sequence derived from exons 12 and 13 of mouse or human Dchc;
(v) the chimeric protein according to any of claims 40 to 41 ; and
(vi) the monoclonal antibody according to any of claims 42 to 43.
69. The medicament according to claim 68 wherein said medical condition is selected from the following group:
(a) undesirable cell division; (b) tumorigenesis.
70. The medicament according to any of claims 68 to 69, wherein said polypeptide has an amino acid sequence selected from the following group:
(a) SEQ ID NO.4; (b) SEQ ID NO:6;
(c) SEQ ID NO.21;
(d) SEQ ID NO:22;
(e) SEQ ID NO.23; and
(f) SEQ ID NO.24.
71. The medicament according to any of claims 68 to 70, wherein said polypeptide is a dynein heavy chainl polypeptide according to any of claims 11 to 39.
72. A medicament for the prevention, treatment or amelioration in a mammal of at least one medical condition selected from the group consisting of:
(a) epilepsy; (b) myoclonic cramping;
(c) neuronal excitotoxicity;
(d) cell damage in hippocampus;
(e) cell damage in cerebellum;
(f) neurodegenerative disease; (g) under-activity or undesirable activity of endogenous cytoplasmic dynein heavy chainl;
(h) under-expression, under-production or undesirable production of endogenous cytoplasmic dynein heavy chainl ; and .
(i) undesirable medical condition shown to be modulated by endogenous cytoplasmic dynein heavy chain 1 ; wherein the medicament comprises the polynucleotide of any of claims 47 to 49, or the vector of any one of claims 50 to 51.
. The medicament according to claim 72 wherein said medical condition comprises at least one feature selected from the following group:
(a) myoclonic cramping ofthe fore limbs;
(b) myoclonic cramping ofthe hind limbs;
(c) cell damage in CA3 and CA4 sectors of hippocampus;
(d) cell damage in gyrus dentatus;
(e) neuronal damage in the upper layer of the cortex and in the Purkinje cell layer ofthe cerebellum;
(f) motor neuron impairment;
(g) Alzheimer's disease; (h) Parkinson's disease;
(i) amyotropic lateral sclerosis; (j) spinal muscular atrophy;
(k) fiber type grouping in Musculus tibialis anterior.
A. The medicament according to claim 73, wherein said polynucleotide comprises a nucleic acid sequence encoding a polypeptide comprising an amino acid sequence selected from the following group:
(a) SEQ ID NO.2;
(b) SEQ ID NO: 18
(c) SEQ ID NO.21
(d) SEQ ID NO:22
(e) SEQ ID NO:23; and (f) SEQ ID NO:24.
75. A medicament for the prevention, treatment or amelioration in a mammal of at least one medical condition selected from the group consisting of:
(a) over-activity or undesirable activity of endogenous cytoplasmic dynein heavy chainl; (b) over-expression, over-production or undesirable production of endogenous cytoplasmic dynein heavy chainl ; and
(c) undesirable medical condition shown to be modulated by endogenous cytoplasmic dynein heavy chainl ;
wherein the medicament comprises a polynucleotide selected from the group consisting of:
(i) a polynucleotide according to claim 47;
(ii) a polynucleotide comprising a nucleic acid sequence encoding an in- frame amino acid sequence selected from exon 12 of mouse or human Dchc; (iii) a polynucleotide comprising a nucleic acid sequence encoding an in- frame amino acid sequence selected from exon 13 of mouse or human Dchc;
(iv) a polynucleotide comprising a nucleic acid sequence encoding an in- frame amino acid sequence selected from exons 12 and 13 of mouse or human Dchc.
76. The medicament according to claim 73, wherein said polynucleotide comprises a nucleic acid sequence encoding a polypeptide comprising an amino acid sequence selected from the following group:
(a) SEQ ID NO:4; (b) SEQ ID NO:6;
(c) SEQ ID NO.21;
(d) SEQ ID NO:22;
(e) SEQ ID NO.23; and (f) SEQ ID NO.24.
77. A medicament for the prevention, treatment or amelioration in a mammal of at least one medical condition selected from the group consisting of:
(a) over-activity or undesirable activity of endogenous cytoplasmic dynein heavy chainl ;
(b) over-expression, over-production or undesirable production of endogenous cytoplasmic dynein heavy chainl; and
(c) undesirable medical condition shown to be modulated by endogenous cytoplasmic dynein heavy chainl;
wherein the medicament comprises a vector selected from the group consisting of:
(i) a nucleic acid vector comprising a polynucleotide encoding a polypeptide comprising an amino acid sequence selected from SEQ ID NO:4, 6, 21, 22, 23 and 24; and (ii) an expression vector comprising a polynucleotide operably inked to an expression control sequence suitable for directing transcription and translation of said polynucleotide in a selected host cell, wherein said polynucleotide encodes a polypeptide comprising an amino acid sequence selected from SEQ ID NO:4, 6, 21, 22, 23 and 24.
78. A process for preparing a cytoplasmic dynein heavy chainl polypeptide comprising:
(a) growing a culture of the host cell of claim 52 in a suitable culture medium; and
(b) recovering the cytoplasmic dynein heavy chainl polypeptide from the culture.
79. A method for the prevention, treatment or amelioration of a cytoplasmic dynein heavy chainl -mediated medical condition in a mammalian subject, particularly a human subject, comprising the step of administering to the subject a cytoplasmic dynein heavy chainl polypeptide selected from the group consisting of:
(a) the modified cytoplasmic dynein heavy chainl polypeptide of claims 1 to 10;
(b) the modified cytoplasmic dynein heavy chainl polypeptide of claims 11 to 26;
(c) the modified cytoplasmic dynein heavy chainl polypeptide of claims 27 to 36; (d) the cytoplasmic dynein heavy chainl polypeptide of claim 37; and
(e) the cytoplasmic dynein heavy chainl polypeptide of claims 38 or 39.
80. A method of prevention, treatment or amelioration of a cytoplasmic dynein heavy chainl -mediated medical condition in a mammalian subject, particularly a human subject, comprising the step of administering to the subject a protein selected from the group consisting of:
(a) the chimeric protein of any of claims 40 to 41 ; and
(b) the monoclonal antibody of claim 42 to 43.
81. A method of preventing, treating or ameliorating a cytoplasmic dynein heavy chainl -mediated medical condition in a mammalian subject, particularly a human subject, comprising the step of administering to the subject a composition selected from the following group:
(a) the composition of claim 44; and
(b) the composition of claim 45.
82. A method of diagnosing in a mammalian subject, particularly a human subject, at least one of: (a) cytoplasmic dynein heavy chainl -mediated medical condition;
(b) a susceptibility to develop a cytoplasmic dynein heavy chainl -mediated medical condition;
wherein the method comprises the steps of:
(i) isolating a biological sample from the subject;
(ii) comparing expression levels of cytoplasmic dynein heavy chainl in the subject sample against a reference value.
83. The method of claim 82 wherein said reference value is obtained by performing the method with a wild type sample equivalent to the biological sample from the subject.
84. The method of claims 82 or 83 wherein a positive diagnosis is indicated by determining a cytoplasmic dynein heavy chainl expression level in the subject sample that differs from that in the wild type sample by a factor selected from the group consisting of:
(a) expression in subject sample being less than 50% of expression in wild type sample;
(b) expression in subject sample being less than 20% of expression in wild type sample;
(c) expression in subject sample being less than 5% of expression in wild type sample;
and wherein the expression level of cytoplasmic dynein heavy chainl in the subject sample is at least 0.5% of that in the wild type sample.
85. The method of any of claims 82 to 84, wherein said abnormal expression is delimited the alteration in expression of cytoplasmic dynein heavy chainl is determined by detecting the existence of a mutation in a nucleic acid sequence controlling the level of expression of the cytoplasmic dynein heavy chainl polypeptide.
86. A method of diagnosing in a mammalian subject, particularly a human subject, at least one of:
(a) cytoplasmic dynein heavy chainl -mediated medical condition;
(b) a susceptibility to develop a cytoplasmic dynein heavy chainl -mediated medical condition;
wherein the method comprises the steps of:
(i) isolating a sample of nucleic acid from the subject; and (ii) determining that said sample comprises a mutation in the nucleic acid sequence of a polynucleotide encoding the cytoplasmic dynein heavy chainl polypeptide, wherein said mutation is responsible for a substitution, deletion or insertion of at least one amino acid residue in the encoded polypeptide.
87. The method of claim 86 wherein said method comprises the additional step of identifying said mutation.
88. The method of claim 87 wherein the method is capable of detecting a point mutation.
89. The method of claims 86 or 87 wherein the method comprises the additional step of determining that the cytoplasmic dynein heavy chainl encoded by said polynuclotide is a modified cytoplasmic dynein heavy chainl polypeptide selected from the group consisting of:
(a) the modified cytoplasmic dynein heavy chainl polypeptide of claims 1 to 10; (b) the modified cytoplasmic dynein heavy chainl polypeptide of claims
11 to 26; (c) the modified cytoplasmic dynein heavy chainl polypeptide of claims 27 to 36.
90. The method of any of claims 86 to 89 wherein the method includes the additional step of amplification and subsequent sequencing of nucleic acid, and said mutation is identified by the sequence ofthe amplified nucleic acid.
91. The method of any of claims 86 to 90, wherein said method comprises the additional step of confirming that said mutation is associated with at least one of:
(a) cytoplasmic dynein heavy chainl -mediated medical condition; (b) a susceptibility to develop a cytoplasmic dynein heavy chainl -mediated medical condition; wherein said confirmation is obtained by generating a non-human ammal model selected from the group consisting of:
(i) a non-human animal model expressing the corresponding mutation in the animal's cytoplasmic dynein heavy chainl, as a heterozygote;
(ii) a non-human animal model expressing the corresponding mutation in the animal's cytoplasmic dynein heavy chainl, as a homozygote;
(iii) a transgenic non-human animal model expressing the corresponding mutation in human cytoplasmic dynein heavy chainl, as a heterozygote; and
(iv) a transgenic non-human animal model expressing the corresponding mutation in human cytoplasmic dynein heavy chainl, as a heterozygote;
and observing the phenotype of said non-human animal.
92. The method of any of claims 86 to 91, wherein said method comprises the additional step of confirming that said mutation is associated with at least one of:
(a) cytoplasmic dynein heavy chainl -mediated medical condition; (b) a susceptibility to develop a cytoplasmic dynein heavy chainl -mediated medical condition;
wherein said confirmation is obtained by an analysis selected from the group consisting of:
(i) a structural analysis of cytoplasmic dynein heavy chainl comprising said mutation;
(ii) assaying a biological function of cytoplasmic dynein heavy chainl comprising said mutation.
93. The method of claim 92 wherein said analysis comprises at least one method selected from the group consisting of:
(a) assaying whether the cytoplasmic dynein heavy chainl comprising said mutation is capable of dimerization;
(b) assaying whether the cytoplasmic dynein heavy chainl comprising said mutation binds a recombinantly produced peptide corresponding to the dimerization domain of cytoplasmic dynein heavy chainl, preferably corresponding to the dimerization domain of human cytoplasmic dynein heavy chainl ;
(c) assaying whether the cytoplasmic dynein heavy chainl comprising said mutation binds other components of the dynein complex selected from the group comprsing:
(i) dynein intermediate chain;
(ii) dynein light intermediate chain; (iii) dynein light chain;
(iv) dynactin;
(v) dynamitin;
(d) assaying whether the cytoplasmic dynein heavy chainl comprising said mutation is capable of integration into an intact dynein complex;
(e) assaying whether formation of intact dynein complex is inhibited in the presence of the cytoplasmic dvnein heavy chainl comprising said mutation;
(f) assaying whether the cytoplasmic dynein heavy chainl comprising said mutation is capable of actin movement; and
(g) assaying whether the cytoplasmic dynein heavy chainl comprising said mutation is capable of axonal transport.
The method of any of claims 86 to 93, wherein said method comprises database comparison, wherein the database comprises mutations in cytplasmic dynein heavy chain 1 that are associated with at least one medical condition selected from the group consisting of:
(a) epilepsy;
(b) myoclonic cramping;
(c) neuronal excitotoxicity; (d) cell damage in hippocampus;
(e) cell damage in cerebellum;
(f) neurodegenerative disease;
(g) under-activity or undesirable activity of endogenous cytoplasmic dynein heavy chainl ; (h) under-expression, under-production or undesirable production of endogenous cytoplasmic dynein heavy chainl ; and (i) undesirable medical condition shown to be modulated by endogenous cytoplasmic dynein heavy chainl.
95. A database according to claim 94 wherein said database comprises mutations in cytplasmic dynein heavy chain 1 that are associated to at least one feature selected from the group consisting of:
(a) myoclonic cramping ofthe fore limbs;
(b) myoclonic cramping ofthe hind limbs;
(c) cell damage in CA3 and CA4 sectors of hippocampus; (d) cell damage in gyrus dentatus;
(e) neuronal damage in the upper layer of the cortex and in the Purkinje cell layer ofthe cerebellum;
(f) motor neuron impairment;
(g) Alzheimer's disease; (h) Parkinson's disease;
(i) amyotropic lateral sclerosis;
(j) spinal muscular atrophy;
(k) fiber type grouping in Musculus tϊbialis anterior.
96. The method of any of claims 86 to 95 wherein the mutation is located the nucleic acid sequence encoding cytoplasmic dynein heavy chain 1, wherein cytoplasmic dynein heavy chain 1 is selected from SEQ ID NO: 17.
97. The method of any of claims 86 to 96 wherein the mutation is located in a selected region of the nucleic acid sequence encoding cytoplasmic dynein heavy chain 1, wherein said selected region is selected from the group of:
(a) exon 12;
(b) exon 12 and exon 13; (c) the dimerization binding site of cytoplasmic dynein heavy chainl .
98. The method of claim 97 wherein the mutation is located in cytoplasmic dynein heavy chainl, wherein said selected region comprises the amino acid sequences, selected from the group of:
(a) SEQ ID NO:23
(b) SEQ ID NO:24
(c) residues 302 to residues 1142 in SEQ ID NO:18.
99. The method of any of claims 86 to 98, wherein said medical condition is a neurodegenerative disease.
100. The method of claim 99 wherein said neurodegenerative disease is a progressive neurodegenerative disease and is selected from the group of Alzheimer's disease, Parkinson's disease, amyotropic lateral sclerosis and spinal muscular atrophy.
101. A method of gene delivery and expression in a target cell of a mammal, comprising the step of introducing a viral vector into the target cell, wherein the viral vector is derived from a virus that has a low replicative efficiency in the target cell and has at least one insertion site containing a nucleic acid of any of claims 47, 53, 54, 55, 56, 57, 58 and 59, and the nucleic acid is operably linked to a promoter capable of expression in the host.
102. The method of claim 101, wherein the viral vector is a non-lytic viral vector.
103. A method of gene delivery and expression in a target cell of a mammal comprising the steps of:
(a) providing an isolated nucleic acid fragment of claims 47, 53, 54, 55, 56, 57, 58 and 59; (b) selecting a viral vector derived from a virus that has a low replicative efficiency in the target cell, wherein the vector has at least one insertion site for insertion of said isolated nucleic acid fragment operably linked to a promoter capable of expression in the target cells; (c) inserting the isolated nucleic acid fragment into, the insertion site; and
(d) introducing the vector into said target cell wherein said gene is expressed at detectable levels.
104. The method of any of claims 101 to 103 wherein the virus is selected from the group consisting of retrovirus, adenovirus, iridoviruses, coronaviruses, togaviruses, caliciviruses and picornaviruses.
105. The method of any of claims 101 to 104 wherein the virus is selected from the group consisting of retrovirus, adenovirus, and pox virus.
106. The method of claim 105 wherein the pox virus is vaccinia.
107. The method of any of claims 101 to 106, wherein the virus is a strain that has been genetically modified or selected to be non- virulent in a host.
108. A non-human animal model expressing a modified cytoplasmic dynein heavy chainl polypeptide selected from the group consisting of:
(a) the modified cytoplasmic dynein heavy chainl polypeptide of claims 1 to 10; (b) the modified cytoplasmic dynein heavy chainl polypeptide of claims
11 to 26;
(c) the modified cytoplasmic dynein heavy chainl polypeptide of claims 27 to 36.
109. The non-human animal model according to claim 108 which is a mammalian non-human animal model.
110. The non-human animal model according to claim 109 which is selected from the group consisting of bovine, equine, porcine, ovine, canine, feline, rat and murine non-human animal models.
111. The non-human animal model according to any one of claims 108 to 110 wherein the modified cytoplasmic dynein heavy chainl is encoded by a nucleic acid sequence which is heterozygous in the animal model.
112. The non-human animal model according to any one of claims 108 to 111 wherein the animal exhibits at least one ofthe following phenotypical features:
(a) epilepsy; (b) myoclonic cramping;
(c) neuronal excitotoxicity;
(d) cell damage in hippocampus;
(e) cell damage in cerebellum;
(f) neurodegenerative disease; (g) under-activity or undesirable activity of endogenous cytoplasmic dynein heavy chainl;
(h) under-expression, under-production or undesirable production of endogenous cytoplasmic dynein heavy chainl; and
(i) undesirable medical condition shown to be modulated by endogenous cytoplasmic dynein heavy chainl .
113. The non-human animal model according to claim 112 wherein the phenotypical features exhibited by the animal include at least one feature selected from the following group:
(a) myoclonic cramping ofthe fore limbs; (b) myoclonic cramping ofthe hind limbs;
(c) cell damage in CA3 and CA4 sectors of hippocampus; (d) cell damage in gyrus dentatus;
(e) neuronal damage in the upper layer of the cortex and in the Purkinje cell layer ofthe cerebellum;
(f) motor neuron impairment; (g) Alzheimer's disease;
(h) Parkinson's disease;
(i) amyotropic lateral sclerosis;
(j) spinal muscular atrophy; and
(k) fiber type grouping in Musculus tibialis anterior.
114. A transgenic non-human animal model expressing a human cytoplasmic dynein heavy chainl.
115. A transgenic non-human animal model according to claim 114 wherein the human cytoplasmic dynein heavy chainl has an amino acid sequence selected from SEQ ID NO:6 or SEQ ID NO: 18.
116. The non-human animal model according to any of claims 108 to 115 wherein the animal is a mouse.
117. An animal model according to any one of claims 108 to 116 utilized for the study of diseases or symptoms associated with cytoplasmic dynein heavy chainl activity deficiency.
118. An animal model according to any one of claims 108 to 116 utilized for the identification of early diagnostic markers for diseases associated with cytoplasmic dynein heavy chainl activity deficiency.
119. An animal model according to any one of claims 108 to 116 utilized for monitoring the activity of agents useful in the prevention or treatment of diseases or symptoms associated with cytoplasmic dynein heavy chainl activity deficiency.
120. An animal model according to any one of claims 108 to 116 utilized as a model system for testing agents suspected of promoting or aggravating diseases associated with cytoplasmic dynein heavy chainl activity deficiency by administering or applying such agents to the model and monitoring at least one effect thereof.
121. A primary cell or cell lines derived from the animal model according to any one of claims 108 to 116.
122. A method of identifying a protein or nucleic acid marker indicative of an increased risk of a mammalian subject, particularly a human subject, of developing a neurodegenerative disease, said method comprising the step of analyzing a test sample derived from said subject for the presence of a difference compared to a similar test sample if derived from a subject of the same species unaffected by or known not to be at risk of developing said disease, wherein said difference is indicative of the presence of a mutation in an allele of a gene coding for a protein, which is a subunit of the dynactin/dynein complex.
123. A method of identifying a protein or nucleic acid marker indicative of an association of a neurodegenerative disease in a mammalian subject, particularly a human subject, with a mutation in an allele of a gene coding for a protein, which is a subunit of the dynactin/dynein complex, said method comprising the step of analyzing a test sample derived from said subject for the presence of a difference compared to a similar test sample if derived from a subject of the same species, unaffected by or known not to be at risk of developing said disease, wherein said difference is indicative of the presence of a mutation in an allele of a gene coding for a protein, which is a subunit of the dynactin/dynein complex.
124. The method of claim 122 or 123, wherein said test sample is analyzed for a difference compared to similar test samples if derived from a group of mammalian subjects of the same species as said subject, which subjects are unaffected by, or known not to be at risk of developing, said neurodegenerative disease.
125. The method according to any one of claims 122 to 124, wherein said mammalian subject whose test sample is analyzed has a neurodegenerative disease or is known or suspected to be at risk of developing a neurodegenerative disease.
126. The method of any one of claims 122 to 125, further comprising the step of obtaining said similar test sample or said similar test samples from said mammalian subject or group of mammalian subjects.
127. The method according to any one of claims 122 to 126, wherein said neurodegenerative disease is selected from the group consisting of Alzheimer's Disease, Parkinson's Disease, Huntington's Disease.
128. The method according to any one of claims 122 to 126, wherein said neurodegenerative disease is a motomeuron degenerative disease.
129. The method according to claim 128, wherein said motomeuron degenerative disease is selected from the group consisting of Amyotrophic Lateral Sclerosis, Spinal Muscular Atrophy, Bulbo-Spinal Muscular Atrophy,
Progressive Bulbar Palsy, Progressive Muscular Atrophy, and Primary Lateral Sclerosis.
130. The method according to any one of claims 122 to 129, wherein said test sample is a nucleic acid sample.
131. The method according to claim 130, wherein said nucleic acid is selected from the group consisting of mRNA, cDNA and genomic DNA.
132. The method according to any of claims 130 or 131, wherein the nucleic acid is selected from the group consisting of nucleic acids coding for the cytoplasmic dynein heavy chain 1, e.g. SEQ ID NOS.: 28 or 29, the cytoplasmic dynein intermediate chain 1, e.g. SEQ ID NOS.: 30 or 31, the cytoplasmic dynein intermediate chain 2, e.g. SEQ ID NOS.: 32 or 33, the cytoplasmic dynein light intermediate chain 1, e.g. SEQ ID NOS.: 34 or 35, the cytoplasmic dynein light intermediate chain 2, e.g. SEQ ID NOS.: 36 or 37; the cytoplasmic dynein 10 kDa light chain, e.g. SEQ ID NOS.: 38 or 39, the cytoplasmic dynein light chain Tctex 1, e.g. SEQ ID NOS.: 40 or 41, the cytoplasmic dynein light chain 2B, e.g. SEQ ID NO.: 42, DCTN 1, e.g. SEQ
ID NOS.: 43 or 44, DCTN 2, e.g. SEQ ID NOS.: 159 or 45, DCTN 3, e.g. SEQ ID NOS.: 46 or 47, DCTN 4, e.g. SEQ ID NOS.: 48 or 49, DCTN 5, e.g. SEQ ID NO.: 50, DCTN 6, e.g. SEQ ID NOS.: 51 or 52, ARPl, e.g. SEQ ID NOS.: 53 or 54, ARPll, e.g. SEQ ID NOS.: 55 or 56, HAPl, e.g. SEQ ID NOS.: 57 or 58, and CLIP-170, e.g. SEQ ID NOS.: 59 or 60, preferably the cytoplasmic dynein heavy chain 1, cytoplasmic dynein intermediate chain 1, cytoplasmic dynein intermediate chain 2, and/or DCTN 1, e.g. according to the above- mentioned corresponding SEQ ID NOS.
133. The method according to any of claims 122 to 132, wherein the step of analyzing said nucleic acid sample comprises amplifying at least a portion of its nucleic acid via the polymerase chain reaction, and optionally also amplifying via the polymerase chain reaction at least a portion of the nucleic acid of said similar sample or said similar samples.
134. The method according to any of claims 122 to 133, wherein the step of analyzing further comprises the step of determining whether said allele is homozygous or heterozygous with respect to said mutation.
135. The method according to claim 122 or 134, wherein the step of analyzing further comprises the separation of the amplified portion of said sample and optionally said similar sample or said similar samples by electrophoresis.
136. The method according to any of claims 122 to 135, wherein the step of analyzing comprises the partial or complete determination of the sequence of the nucleic acid or the amplified portion ofthe nucleic acid of said sample, and optionally also of the nucleic acid or the amplified portion of the nucleic acid of said similar sample or said similar samples.
137. The method according to any one of claims 122 to 129, wherein said test sample is a protein sample.
138. The method according to claim 137, wherein said protein sample comprises a protein selected from the group consisting of the cytoplasmic dynein heavy chain 1, e.g. encoded by SEQ ID NOS.: 28 or 29, the cytoplasmic dynein intermediate chain 1, e.g. encoded by SEQ ID NOS.: 30 or 31, the cytoplasmic dynein intermediate chain 2, e.g. encoded by SEQ ID NOS.: 32 or 33, the cytoplasmic dynein light intermediate chain 1, e.g. encoded by SEQ ID NOS.: 34 or 35, the cytoplasmic dynein light intermediate chain 2, e.g. encoded by SEQ ID NOS.: 36 or 37; the cytoplasmic dynein 10 kDa light chain, e.g. encoded by SEQ ID NOS.: 38 or 39, the cytoplasmic dynein light chain Tctex 1, e.g. encoded by SEQ ID NOS.: 40 or 41, the cytoplasmic dynein light chain 2B, e.g. encoded by SEQ ID NO.: 42, DCTN 1, e.g. encoded by SEQ ID NOS.: 43 or 44, DCTN 2, e.g. encoded by SEQ ID NOS.: 159 or 45, DCTN 3, e.g. encoded by SEQ ID NOS.: 46 or 47, DCTN 4, e.g. encoded by SEQ ID
NOS.: 48 or 49, DCTN 5, e.g. encoded by SEQ ID NO.: 50, DCTN 6, e.g. encoded by SEQ ID NOS.: 51 or 52, ARPl, e.g. encoded by SEQ ID NOS.: 53 or 54, ARPl l, e.g. encoded by SEQ ID NOS.: 55 or 56, HAPl, e.g. encoded by SEQ ID NOS.: 57 or 58, and CLIP-170, e.g. encoded by SEQ ID NOS.: 59 or 60, preferably the cytoplasmic dynein heavy chain 1, cytoplasmic dynein intermediate chain 1, cytoplasmic dynein intermediate chain 2, and/or DCTN 1, e.g. encoded by the above-mentioned corresponding SEQ ID NOS.
139. The method according to any one of claims 122 to 138, wherein said mutation selectively affects cell types associated with or suspected to be involved in a neurodegenerative disease.
140. The method according to any one of claims 122 to 139, wherein said mutation selectively affects motomeurons, preferably α-motorneurons.
141. The method according to any of claims 122 to 140, wherein said mutation affects a cellular process selected from the group of processes consisting of neuronal axonal transport, cellular transport, proliferation, differentiation and apoptosis.
142. The method according to any of claims 122 to 141, wherein said mutation leads to a disruption of, or alteration in the functional interaction within the dynactin/dynein complex in neurons, preferably in motomeurons.
143. The method according to any one of claims 122 to 142, wherein said mutation results in a deletion or substitution by another amino acid of an amino acid encoded by said allele, or an insertion of additional amino acids not normally present in the amino acid sequence ofthe protein encoded by said allele.
144. The method according to claim 143, wherein said deletion, substitution, or insertion is encoded by both alleles ofthe gene coding for said protein.
145. The method according to claim 143 or 144, wherein said deletion, substitution, or insertion of the amino acid occurs in an evolutionary conserved region of said protein.
146. The method according to any of claims 122 to 145, wherein said mutation results in the substitution of an amino acid which is identical between the corresponding mouse and human, preferably between the corresponding mouse, rat, and human protein encoded by said allele, by another amino acid.
147. The method according to any one of claims 143 to 146, wherein said amino acid is substituted by a naturally occurring amino acid.
148. The method according to any of claims 143 to 147, wherein said amino acid is encoded by a codon within the open reading frame of a nucleic acid sequence selected from the group consisting of SEQ ID NOS.: 70 to 112 or SEQ ID NOS.: 114 to 158.
149. The method according to any of claims 143 to 148, wherein said amino acid is located in a domain of said protein, which is capable of binding to another subunit ofthe dynactin/dynein complex.
150. The method according to claim 149, wherein said domain is defined by an amino acid sequence selected from the group of sequences consisting of
in case the protein is mouse cytoplasmic dynein intermediate chain 1 (SEQ ID
NO.: 61):
i) amino acids 147- 157; ii) amino acid 243 -314 ; iii) amino acids 140-157; and amino acids 1-123;
in case the protein is human cytoplasmic dynein intermediate chain 1 (SEQ ID NO.: 62):
v) amino acids 164-174; vi) amino acids 260-331; vii) amino acids 157-174; and viii) amino acids 1-140;
in case the protein is mouse cytoplasmic dynein intermediate chain 2 (SEQ ID NO.: 64):
i) amino acids 1-123; ϋ) amino acids 122-139; iii) amino acids 129-130; and iv) amino acids 226-297;
in case the protein is human cytoplasmic dynein intermediate chain 2 (SEQ ID NO.: 65):
v) amino acids 155-165; vi) amino acids 252-323; vii) amino acids 148-165; and viii) amino acids 1-149;
in case the protein is mouse DCTN 1 (SEQ ID NO.: 67):
i) amino acids 39-150; ii) amino acids 1006-1021; and iii) amino acids 133-899: or
in case the protein is human DCTNl (SEQ ID NO.: 68):
iv) amino acids 39-150; v) amino acids 1006-1021; and vi) amino acids 133-899.
The method according to claim 150, wherein
a) if the protein is cytoplasmic dynein intermediate chain 1 (SEQ ID NO.: 61 or 62), said amino acid is any one of the amino acids specified in Table 20; b) if the protein is cytoplasmic dynein intermediate chain 2 (SEQ ID NO.: 64 or 65), said amino acid is any one of the amino acids specified in Table 21; c) if the protein is DCTN 1 (SEQ ID NO.: 67 or 68), said amiήo acid is any one ofthe amino acids specified in Table 22.
152. A method for identifying a predisposition of a mammalian subject, particularly a human subject, for developing a neurodegenerative disease, said method comprising the step of determining whether a test sample derived from said subject indicates the presence of a mutation in an allele of a gene coding for a protein, which is a subunit of the dynactin/dynein complex, indicative of an increased risk of said subject of developing said neurodegenerative disease.
153. The method according to claim 152, further comprising the step of assigning a certain risk of developing said neurodegenerative disease to said subject.
154. A method for determining whether a neurodegenerative disease in a mammalian subject, particularly a human subject, is associated with a mutation in an allele of a gene coding for a protein, which is a subunit of the dynactin/dynein complex, said method comprising the step of determining whether a test sample derived from said subject indicates the presence of a mutation in an allele of a gene coding for said protein.
155. The method according to any of claims 152 to 154, wherein said neurodegenerative disease is selected from the group consisting of Alzheimer's Disease, Parkinson's Disease, and Huntington's Disease.
156. The method according to any one of claims 152 to 154, wherein said neurodegenerative disease is a motomeuron degenerative disease.
157. The method according to claim 156, wherein said motomeuron degenerative disease is selected from the group consisting of: Amyotrophic Lateral Sclerosis, Spinal Muscular Atrophy, Bulbo-Spinal Muscular Atrophy, Progressive Bulbar Palsy, Progressive Muscular Atrophy, and Primary Lateral Sclerosis.
158. The method according to any one of claims 152 to 157, wherein said test sample is a nucleic acid sample.
159. The method according to claim 158, wherein said nucleic acid is selected from the group consisting of mRNA, cDNA and genomic DNA.
160. The method according to claim 158 or 159, wherein the nucleic acid is selected from the group consisting of nucleic acids coding for the cytoplasmic dynein heavy chain 1, e.g. SEQ ID NOS.: 28 or 29, the cytoplasmic dynein intermediate chain 1, e.g. SEQ ID NOS.: 30 or 31, the cytoplasmic dynein intermediate chain 2, e.g. SEQ ID NOS.: 32 or 33, the cytoplasmic dynein light intermediate chain 1, e.g. SEQ ID NOS.: 34 or 35, the cytoplasmic dynein light intermediate chain 2, e.g. SEQ ID NOS.: 36 or 37; the cytoplasmic dynein 10 kDa light chain, e.g. SEQ ID NOS.: 38 or 39, the cytoplasmic dynein light chain Tctex 1, e.g. SEQ ID NOS.: 40 or 41, the cytoplasmic dynein light chain 2B, e.g. SEQ ID NO.: 42, DCTN 1, e.g. SEQ ID NOS.: 43 or 44, DCTN 2, e.g. SEQ ID NOS.: 159 or 45, DCTN 3, e.g. SEQ ID NOS.: 46 or 47, DCTN 4, e.g. SEQ ID NOS.: 48 or 49, DCTN 5, e.g. SEQ ID NO.: 50, DCTN 6, e.g. SEQ ID NOS.: 51 or 52, ARPl, e.g. SEQ ID NOS.:
53 or 54, ARPll, e.g. SEQ ID NOS.: 55 or 56, HAPl, e.g. SEQ ID NOS.: 57 or 58, and CLIP-170, e.g. SEQ ID NOS.: 59 or 60, preferably the cytoplasmic dynein heavy chain 1, cytoplasmic dynein intermediate chain 1, cytoplasmic dynein intermediate chain 2, and/or DCTN 1, e.g. according to the above- mentioned corresponding SEQ ID NOS.
161. The method according to any one of claims 152 to 157, wherein said test sample is a protein sample.
162. The method of claim 161, wherein said protein sample comprises a protein selected from the group consisting of the cytoplasmic dynein heavy chain 1, e.g. encoded by SEQ ID NOS.: 28 or 29, the cytoplasmic dynein intermediate chain 1, e.g. encoded by SEQ ID NOS.: 30 or 31, the cytoplasmic dynein intermediate chain 2, e.g. encoded by SEQ ID NOS.: 32 or 33, the cytoplasmic dynein light intermediate chain 1, e.g. encoded by SEQ ID NOS.: 34 or 35, the cytoplasmic dynein light intermediate chain 2, e.g. encoded by SEQ ID NOS.: 36 or 37; the cytoplasmic dynein 10 kDa light chain, e.g. encoded by SEQ ID NOS.: 38 or 39, the cytoplasmic dynein light chain Tctex 1, e.g. encoded by SEQ ID NOS.: 40 or 41, the cytoplasmic dynein light chain 2B, e.g. encoded by SEQ ID NO.: 42, DCTN 1, e.g. encoded by SEQ ID NOS.: 43 or 44, DCTN 2, e.g. encoded by SEQ ID NOS.: 159 or 45, DCTN 3, e.g. encoded by SEQ ID NOS.: 46 or 47, DCTN 4, e.g. encoded by SEQ ID NOS.: 48 or 49, DCTN
5, e.g. encoded by SEQ ID NO.: 50, DCTN 6, e.g. encoded by SEQ ID NOS.: 51 or 52, ARPl, e.g. encoded by SEQ ID NOS.: 53 or 54, ARPl l, e.g. encoded by SEQ ID NOS.: 55 or 56, HAPl, e.g. encoded by SEQ ID NOS.: 57 or 58, and CLIP-170, e.g. encoded by SEQ ID NOS.: 59 or 60, preferably the cytoplasmic dynein heavy chain 1, cytoplasmic dynein intermediate chain 1, cytoplasmic dynein intermediate chain 2, and/or DCTN 1, e.g. encoded by the above-mentioned corresponding SEQ ID NOS.
163. The method according to any one of claims 152 to 162, wherein said mutation selectively affects cell types associated with or suspected to be involved in developing a neurodegenerative disease.
164. The method according to any one of claims 152 to 163, wherein said mutation selectively affects motomeurons, preferably α-motomeurons.
165. The method according to any of claims 152 to 164, wherein said mutation affects a cellular process selected from the group of processes consisting of neuronal axonal transport, cellular transport, proliferation, differentiation and apoptosis.
166. The method according to any of claims 152 to 165, wherein said mutation leads to a disruption of, or alteration in the functional interaction within the dynactin/dynein complex in neurons, preferably in motomeurons.
167. The method according to any one of claims 152 to 166, wherein said mutation results in a deletion or substitution by another amino acid of an amino acid encoded by said allele, or an insertion of additional amino acids not normally present in the amino acid sequence of said protein, encoded by said allele.
168. The method according to claim 167, wherein said deletion, substitution, or insertion is encoded by both alleles ofthe gene coding for said protein.
169. The method according to any of claims 167 or 168, wherein said deletion, substitution, or insertion occurs in an evolutionary conserved region of said protein.
170. The method according to any of claims 152 to 169, wherein said mutation results in the substitution of an amino acid which is identical between the corresponding mouse and human protein, preferably between the corresponding mouse, rat, and human protein encoded by said allele, by another amino acid.
171. The method according to any of claims 167 to 170, wherein said amino acid is substituted by a naturally occurring amino acid.
172. The method according to any of claims 167 to 171, wherein said amino acid is encoded by a codon within the open reading frame of a nucleic acid sequence selected from the group consisting of SEQ ID NO.: 70-112 or SEQ ID NO.:
114-158.
173. The method according to any of claims 167 to 172, wherein said amino acid is located in a domain of said protein, which is capable of binding to another subunit ofthe dynactin/dynein complex.
174. The method according to claim 173, wherein said domain is defined by an amino acid sequence selected from the group of sequences consisting of
in case the protein is mouse cytoplasmic dynein intermediate chain 1 (SEQ ID NO.: 61):
i) amino acids 147-157; ii) amino acid 243-314; iii) amino acids 140-157; and iv) amino acids 1-123;
in case the protein is human cytoplasmic dynein intermediate chain 1 (SEQ ID NO.: 62):
v) amino acids 164-174; vi) amino acids 260-331 ; vii) amino acids 157-174; and viii) amino acids 1-140;
in case the protein is mouse cytoplasmic dynein intermediate chain 2 (SEQ ID NO.: 64):
i) amino acids 1-123; ii) amino acids 122-139; iii) amino acids 129-130; and iv) amino acids 226-297;
in case the protein is human cytoplasmic dynein intermediate chain 2 (SEQ ID
NO.: 65):
v) amino acids 155-165; vi) amino acids 252-323; vii) amino acids 148- 165 ; and viii) amino acids 1-149;
in case the protein is mouse DCTN 1 (SEQ ID NO.: 67):
i) amino acids 39-150; ii) amino acids 1006-1021; and iii) amino acids 133-899: or in case the protein is human DCTNl (SEQ ID NO.: 68):
iv) amino acids 39-150; v) amino acids 1006- 1021 ; and vi) amino acids 133-899.
175. The method according to claim 174, wherein
a) if the protein is cytoplasmic dynein intermediate chain 1 (SEQ ID NOS.: 61 or 62), said amino acid is any one of the amino acids specified in Table 20; b) if the protein is cytoplasmic dynein intermediate chain 2 (SEQ ID NOS.: 64 or 65), said amino acid is any one of the amino acids specified in Table 21; c) if the protein is DCTN 1 (SEQ ID NOS.: 67 or 68), said amino acid is any one ofthe amino acids specified in Table 22.
176. An oligonucleotide suitable for identifying a mutation in an allele of a gene coding for a protein, which is a subunit ofthe dynactin/dynein complex.
177. An oligonucleotide according to claim 176, the nucleotide sequence of which corresponds to a nucleotide sequence within said allele, which contains a mutation as defined in any of claims 139 to 151.
178. An oligonucleotide according to claim 176 or 177, which is suitable for hybridizing to the nucleic acid of said allele or a portion of its nucleic acid under stringent conditions.
179. An oligonucleotide according to any of claims 176 to 178, which is suitable as primer for amplifying the nucleic acid of said allele or a portion of its nucleic acid.
180. A kit for identifying a predisposition of a mammalian subject, particularly a human subject, for developing a neurodegenerative disease, or for identifying an association of a neurodegenerative disease of said subject with a mutation in an allele coding for a protein, which is a subunit of the dynactin/dynein complex, said kit comprising one or more oligonucleotides according to any of claims 176 to 178.
181. A kit for identifying a predisposition of a mammalian subject, particularly a human subject, for developing a neurodegenerative disease or for an association of a neurodegenerative disease of said subject with a mutation in an allele coding for a protein, which is a subunit of the dynactin/dynein complex, said kit comprising at least two oligonucleotides according to claim 179.
182. The kit according to claims 180 or 181, further comprising instructions to use the oligonucleotide or the oligonucleotides for identifying said predisposition in said subject or said association of the neurodegenerative disease of said subject with said mutation.
183. A solid support, wherein at least two oligonucleotides according to any of claims 176 to 178 are individually fixed to separate areas of the solid support to form an array.
184. The solid support according to claim 183, which is a glass chip, preferably a glass chip with a modified surface.
185. Use of the oligonucleotides of any of claims 176 to 179, or the kit of any of claims 180 to 182, or the solid support of claim 183 or 184, in a method according to any one of claims 122 to 136, 139 to 160, or 163 to 175.
EP03807821A 2002-09-13 2003-09-11 Cytoplasmic dynein heavy chain 1 genes, expression products, non-human animal model: uses in human neurological diseases Withdrawn EP1556484A2 (en)

Applications Claiming Priority (7)

Application Number Priority Date Filing Date Title
US41077602P 2002-09-13 2002-09-13
US410776P 2002-09-13
US42660902P 2002-11-15 2002-11-15
US426609P 2002-11-15
US44492003P 2003-02-04 2003-02-04
US444920P 2003-02-04
PCT/EP2003/010118 WO2004032614A2 (en) 2002-09-13 2003-09-11 Animal with modification of cytoplasmic dynein heavy chain 1 gene

Publications (1)

Publication Number Publication Date
EP1556484A2 true EP1556484A2 (en) 2005-07-27

Family

ID=32096875

Family Applications (1)

Application Number Title Priority Date Filing Date
EP03807821A Withdrawn EP1556484A2 (en) 2002-09-13 2003-09-11 Cytoplasmic dynein heavy chain 1 genes, expression products, non-human animal model: uses in human neurological diseases

Country Status (3)

Country Link
EP (1) EP1556484A2 (en)
AU (1) AU2003296554A1 (en)
WO (1) WO2004032614A2 (en)

Family Cites Families (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP1242443A4 (en) * 1999-12-23 2005-06-22 Nuvelo Inc NEW NUCLEIC ACIDS AND POLYPEPTIDES

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
BUÉE L. ET AL: "Tau protein isoforms, phosphorylation and role in neurodegenerative disorders", BRAIN RESEARCH REVIEWS, vol. 33, 2000, pages 95 - 130 *
See also references of WO2004032614A3 *

Also Published As

Publication number Publication date
WO2004032614A2 (en) 2004-04-22
AU2003296554A1 (en) 2004-05-04
AU2003296554A8 (en) 2004-05-04
WO2004032614A3 (en) 2005-06-02

Similar Documents

Publication Publication Date Title
US7846679B2 (en) Methods for detecting the presence of mutant mammalian presenilin protein
WO2003104270A2 (en) Dudulin 2 genes, expression products, non-human animal model: uses in human hematological disease
CA2066204C (en) Cystic fibrosis gene
US6902907B1 (en) Cystic fibrosis gene
US6300540B1 (en) Transgenic mouse expressing an APP-FAD DNA sequence
US20070010657A1 (en) Cytoplasmic dynein heavy chain 1 genes, expression products, non-human animal model uses in human neurological diseases
JP2004535794A (en) Sperm-specific cation channels and uses thereof
US20080081037A1 (en) Methods and Agents for Diagnosis and Prevention, Amelioration or Treatment of Goblet Cell-Related Disorders
JP5954800B2 (en) Method for detecting causal factor of male infertility and male infertility model animal
US20050020527A1 (en) Spinster-like protein genes, expression products, non-human animal model: uses in human metabolic disorders
JP2000516087A (en) Gene sequences and proteins associated with Alzheimer's disease and uses thereof
US9068018B2 (en) Methods of using voltage-gated Hv1 proton channels to detect changes in intracellular pH
US6998467B1 (en) Antibody specific for presenilin 1 and method of use thereof
WO2004032614A2 (en) Animal with modification of cytoplasmic dynein heavy chain 1 gene
KR100544933B1 (en) Screening method for prion infectious agents
US20050028229A1 (en) Alpha-hemoglobin stabilizing protein transgenic mouse and methods of use thereof
JP5379119B2 (en) Gene sequences and proteins related to Alzheimer's disease and uses thereof
AU2001265698B2 (en) Mutation associated with epilepsy
AU647408C (en) Cystic fibrosis gene
WO2004020619A1 (en) Modified phospholipase c-gamma-2, expression products, and non-human animal models comprising said genes, and therapeutic uses
WO2004007723A2 (en) Genes
WO2012113022A1 (en) Therapeutic uses of slirp
WO2007028656A2 (en) Animal model and method for testing drugs and treatments for neurodevelopment disorders
CN1893821A (en) Receptor

Legal Events

Date Code Title Description
PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

17P Request for examination filed

Effective date: 20050411

AK Designated contracting states

Kind code of ref document: A2

Designated state(s): AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IT LI LU MC NL PT RO SE SI SK TR

AX Request for extension of the european patent

Extension state: AL LT LV MK

DAX Request for extension of the european patent (deleted)
RIN1 Information on inventor provided before grant (corrected)

Inventor name: WABNITZ, PHILIPP

Inventor name: STUMM, GABRIELE

Inventor name: PERAUS, GISELA

Inventor name: MARQUARDT, ANDREAS

Inventor name: KLOCKE, RAINER

RAP1 Party data changed (applicant data changed or rights of an application transferred)

Owner name: INGENIUM PHARMACEUTICALS GMBH

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN

18D Application deemed to be withdrawn

Effective date: 20090401