EP1389903A2 - Compositions d'additif alimentaire et methodes associees - Google Patents

Compositions d'additif alimentaire et methodes associees

Info

Publication number
EP1389903A2
EP1389903A2 EP02719019A EP02719019A EP1389903A2 EP 1389903 A2 EP1389903 A2 EP 1389903A2 EP 02719019 A EP02719019 A EP 02719019A EP 02719019 A EP02719019 A EP 02719019A EP 1389903 A2 EP1389903 A2 EP 1389903A2
Authority
EP
European Patent Office
Prior art keywords
protein
lysozyme
seed
feed
seeds
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Withdrawn
Application number
EP02719019A
Other languages
German (de)
English (en)
Other versions
EP1389903A4 (fr
Inventor
Ning Huang
Raymond L. Rodriguez
Frank E. Hagie
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Invitria Inc
Original Assignee
Ventria Bioscience Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from US09/847,232 external-priority patent/US20030172403A1/en
Application filed by Ventria Bioscience Inc filed Critical Ventria Bioscience Inc
Publication of EP1389903A2 publication Critical patent/EP1389903A2/fr
Publication of EP1389903A4 publication Critical patent/EP1389903A4/fr
Withdrawn legal-status Critical Current

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/0004—Oxidoreductases (1.)
    • C12N9/0065—Oxidoreductases (1.) acting on hydrogen peroxide as acceptor (1.11)
    • A—HUMAN NECESSITIES
    • A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23K—FODDER
    • A23K10/00—Animal feeding-stuffs
    • A23K10/30—Animal feeding-stuffs from material of plant origin, e.g. roots, seeds or hay; from material of fungal origin, e.g. mushrooms
    • A—HUMAN NECESSITIES
    • A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23K—FODDER
    • A23K20/00—Accessory food factors for animal feeding-stuffs
    • A23K20/10—Organic substances
    • A23K20/142—Amino acids; Derivatives thereof
    • A23K20/147—Polymeric derivatives, e.g. peptides or proteins
    • A—HUMAN NECESSITIES
    • A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23L—FOODS, FOODSTUFFS, OR NON-ALCOHOLIC BEVERAGES, NOT COVERED BY SUBCLASSES A21D OR A23B-A23J; THEIR PREPARATION OR TREATMENT, e.g. COOKING, MODIFICATION OF NUTRITIVE QUALITIES, PHYSICAL TREATMENT; PRESERVATION OF FOODS OR FOODSTUFFS, IN GENERAL
    • A23L33/00—Modifying nutritive qualities of foods; Dietetic products; Preparation or treatment thereof
    • A23L33/10—Modifying nutritive qualities of foods; Dietetic products; Preparation or treatment thereof using additives
    • A23L33/105—Plant extracts, their artificial duplicates or their derivatives
    • A—HUMAN NECESSITIES
    • A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23L—FOODS, FOODSTUFFS, OR NON-ALCOHOLIC BEVERAGES, NOT COVERED BY SUBCLASSES A21D OR A23B-A23J; THEIR PREPARATION OR TREATMENT, e.g. COOKING, MODIFICATION OF NUTRITIVE QUALITIES, PHYSICAL TREATMENT; PRESERVATION OF FOODS OR FOODSTUFFS, IN GENERAL
    • A23L33/00—Modifying nutritive qualities of foods; Dietetic products; Preparation or treatment thereof
    • A23L33/10—Modifying nutritive qualities of foods; Dietetic products; Preparation or treatment thereof using additives
    • A23L33/17—Amino acids, peptides or proteins
    • A23L33/19—Dairy proteins
    • A—HUMAN NECESSITIES
    • A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23L—FOODS, FOODSTUFFS, OR NON-ALCOHOLIC BEVERAGES, NOT COVERED BY SUBCLASSES A21D OR A23B-A23J; THEIR PREPARATION OR TREATMENT, e.g. COOKING, MODIFICATION OF NUTRITIVE QUALITIES, PHYSICAL TREATMENT; PRESERVATION OF FOODS OR FOODSTUFFS, IN GENERAL
    • A23L7/00—Cereal-derived products; Malt products; Preparation or treatment thereof
    • A23L7/20—Malt products
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/475—Growth factors; Growth regulators
    • C07K14/485—Epidermal growth factor [EGF], i.e. urogastrone
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/575—Hormones
    • C07K14/65—Insulin-like growth factors, i.e. somatomedins, e.g. IGF-1, IGF-2
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/79—Transferrins, e.g. lactoferrins, ovotransferrins
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/81—Protease inhibitors
    • C07K14/8107—Endopeptidase (E.C. 3.4.21-99) inhibitors
    • C07K14/811—Serine protease (E.C. 3.4.21) inhibitors
    • C07K14/8121—Serpins
    • C07K14/8125—Alpha-1-antitrypsin
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/82—Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
    • C12N15/8241—Phenotypically and genetically modified plants via recombinant DNA technology
    • C12N15/8242—Phenotypically and genetically modified plants via recombinant DNA technology with non-agronomic quality (output) traits, e.g. for industrial processing; Value added, non-agronomic traits
    • C12N15/8257—Phenotypically and genetically modified plants via recombinant DNA technology with non-agronomic quality (output) traits, e.g. for industrial processing; Value added, non-agronomic traits for the production of primary gene products, e.g. pharmaceutical products, interferon
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14—Hydrolases (3)
    • C12N9/24—Hydrolases (3) acting on glycosyl compounds (3.2)
    • C12N9/2402—Hydrolases (3) acting on glycosyl compounds (3.2) hydrolysing O- and S- glycosyl compounds (3.2.1)
    • C12N9/2462—Lysozyme (3.2.1.17)

Definitions

  • Maga E. et al. J. of Food Protection, 61 , 52-56, 1998.
  • Maga E. et al. Transgenic Research, 3, 36-42, 1994.
  • Maga E. et al. Journal of Dairy Science, 78, 2645-2652, 1995.
  • feed conversion efficiency The profitability of livestock and poultry producers is dependent upon the efficiency and rate that nutrients in feed are converted into salable products such as meat, milk and eggs.
  • An animal's maximum growth rate and efficiency of conversion of feed into products (feed conversion efficiency) are set by its genetic potential.
  • stress prevent the expression of an animal's genetic potential.
  • a common form of stress encountered by animals is that of infectious challenge. Animals are exposed to millions of potential pathogens daily, through contact, ingestion, and inhalation. Infectious challenge may or may not result in clinical disease, depending upon the pathogenicity of the challenging microorganism and the immunocompetence of the animal. Regardless of the outcome, a stress response is indicated by decreased growth performance and feed conversion efficiency when the immune system is stimulated.
  • Veterinarians like their medical doctor counterparts, occasionally prescribe the therapeutic use of antibiotics in order to protect the health of animals.
  • the animal industries also rely on the chronic, low level (sub-therapeutic) feeding of antibiotics to prevent disease and mitigate the economic impact of infection.
  • Approximately 100% of chicken and turkeys, 90% of swine and veal calves, and 60% of cattle raised in the United States receive diets that continuously contain antibiotics. These antibiotics are fed prophylactically with the goal of preventing infectious disease before it can be established.
  • the use of antibiotics at sub-therapeutic levels (ST antibiotics) permits the large-scale husbandry of animals at very high population densities, with minimal labor costs and results in cost effective and wholesome production of foods. Modern animal farming in the United States is virtually dependent upon the use of antibiotics throughout the production cycle.
  • ST antibiotics used by the animal production industries accounted for $3.3 billion in sales.
  • Sub- therapeutic levels of antibiotics in the diet or water allow an increased rate of growth and feed conversion efficiency, and increase the general state of health of fish, chickens, pigs, sheep, and cattle.
  • Regulatory statutes restrict ST antibiotics to those that are poorly absorbed from the digestive tract and consequently do not contaminate meat, mile, and eggs. For this reason, the mode of action of ST antibiotics is limited to effects within the digestive tract.
  • ST antibiotics exert their beneficial effects by suppressing the growth of microorganisms.
  • Antibiotics lack efficacy in germ-free or highly sanitized environments and do not require the presence of clinically identifiable disease or pathogenic agents.
  • the behavioral and metabolic changes that occur during an immune response to pathogen challenge include anorexia, fever, decreased accretion of skeletal muscle, synthesis of acute phase proteins, increased use of amino acids as an energy source, and decreased use of fat as an energy source. These changes form the basis for impaired growth, poor feed utilization, and altered nutrition requirements in growing chickens and pigs challenged by non-infectious pathogens.
  • antibiotics "enhance growth and production performance because an animal can reduce that portion of the nutrition requirement associated with fighting subclinical disease and bolstering health defense processes, thereby enhancing the portion of nutrients available for growth and production.”
  • an object of the invention to provide an animal feed or feed supplement containing a transgenic plant-produced heterologous, anti-microbial protein which when fed to production animals results in improved feed efficiency, and methods for using and producing the improved animal feed.
  • the invention includes an improved feed for production animals (poultry and hoofed farm animals), comprising one or more plant-derived feed ingredients, substantially unsupplemented with small-molecule antibiotics, and, as an additive, a seed composition containing a flour, extract, or malt obtained from mature monocot seeds and one or more seed-produced heterologous, anti-microbial proteins in substantially unpurified form.
  • the one or more seed-produced anti-microbial protein(s) present in the seed composition are an anti-microbial proteins, including the anti-microbial milk proteins such as lactoferrin, lysozyme, lactoferricin, lactohedrin, kappa-casein, haptocorrin, or lactoperoxidase, a milk protein like alpha-1-antitrypsin that may function as an antimicrobial by inhibiting proteolysis of other anti-microbial proteins, non-milk anti-microbial proteins and acute-phase proteins, e.g., proteins that are produced normally in production animals in response to infection, and small anti-microbial proteins.
  • the anti-microbial milk proteins such as lactoferrin, lysozyme, lactoferricin, lactohedrin, kappa-casein, haptocorrin, or lactoperoxidase
  • a milk protein like alpha-1-antitrypsin that may function as an antimicrobial by inhibiting proteolysis of other anti
  • Exemplary anti-microbial proteins are lysozyme and lactoferrin, where lysozyme is preferably present in an amount between about 0.05 and 0.5 grams protein/kg feed, and lactoferrin, in an amount between 0.2 to 2 grams/protein/kg feed. 17.
  • the one or more seed-produced anti-microbial protein(s) present in the food are acute-phase, non-milk proteins selected from the group consisting of C-reactive protein, serum amyloid A; ferritin, haptoglobin, seromucoids, ceruloplasmin, 15-keto-13,14-dihydro-prostaglandin F2 alpha, fibrinogen, alpha-1-acid glycoprotein, mannose binding protein, lipopolysaccharide binding protein, alpha-2 macroglobulin and defensins.
  • the one or more seed-produced anti-microbial protein(s) present in the food are antimicrobial peptides selected from the group consisting of cecropin, magainin, defensins, tachyplesin, parasin l.buforin I, PMAP-23, moronecidin, anoplin, gambicin, and SAMP-29.
  • the one or more seed-produced anti-microbial protein(s) present in the food are antimicrobial pproteins selected from the group consisting: CAP37, granulysin, secretory leukocyte protease inhibitor, CAP18, ubiquicidin, bovine antimicrobial protein-1, Ace-AMP1 , tachyplesin, big defensin, Ac-AMP2, Ah-AMP1 , and CAP18.
  • the seed composition may be prepared as follows: (a) the flour is prepared by milling mature monocot seeds,
  • the extract is prepared by suspending milled flour in a buffered aqueous medium
  • the malt is prepared by (i) steeping barley seeds to a desired water content, (ii) germinating the stepped barley, (iii) drying the germinated seeds, under conditions effective to stop germination, (iv) crushing the dried seeds, (v) optionally, adding crushed seeds from a non-barley monocot plant, (vi) forming a mixture of crushed seeds in water, and (vii) malting the crushed seed mixture until a desired malt is achieved, where at least one of the barley or non-barley monocot seeds contain such anti- microbial protein(s).
  • Step (v) in the malt-producing step may include adding to the crushed dried barley seeds, mature rice transgenic seeds that produce an anti-microbial protein.
  • the invention includes an improvement over existing methods for achieving high growth rates in production animals, particularly methods in which a production animal is fed a feed supplemented with subclinical (sub-therapeutic or ST) levels of one or more small-molecule antibiotics.
  • the improvement comprises replacing the small-molecule antibiotic(s) in the feed with a seed composition containing a flour, extract, or malt obtained from mature monocot seeds and one or more seed-produced heterologous, anti-microbial proteins in substantially unpurified form.
  • the invention includes a method of producing a feed for production animals.
  • the method includes the steps of first obtaining a monocot plant that has been stably transformed with a first chimeric gene having (i) a transcriptional regulatory region from a monocot gene having a seed maturation-specific promoter, (ii) operably linked to said transcriptional regulatory region, a leader/targeting DNA sequence encoding a monocot seed-specific transit sequence capable of targeting a linked polypeptide to an endosperm-cell organelle, and (iii) a protein-coding sequence encoding a heterologous, anti-microbial normally.
  • the transformed plant is cultivated under seed-maturation conditions, and the mature seeds are harvested, then extracted to yield a flour, extract, or malt composition containing the anti-microbial protein in substantially unpurified form.
  • the seed composition is added to an animal feed that is substantially free of small-molecule antibiotics, i.e., has no or significantly reduced amounts of small-molecule antibiotics added.
  • the flour is prepared by milling mature monocot seeds
  • the extract is prepared by suspending milled flour in a buffered aqueous medium
  • the malt is prepared by (i) steeping barley seeds to a desired water content, (ii) germinating the stepped barley, (iii) drying the germinated seeds, under conditions effective to stop germination, (iv) crushing the dried seeds, and (v) after mixing the crushed seeds with water, malting the crushed seed mixture until a desired malt is achieved.
  • Exemplary transcriptional regulatory regions in the chimeric gene are from the promoter of the group of genes: rice glutelins, rice globulins, oryzins, and prolamines, barley hordeins, wheat gliadins and glutenins, maize zeins and glutelins, oat glutelins, and sorghum kafirins, millet pennisetins, and rye secalins genes.
  • Exemplary leader/targeting sequences are likewise from the group of genes selected from the group of rice glutelins, rice globulins oryzins, and prolamines, barley hordeins, wheat gliadins and glutenins, maize zeins and glutelins, oat glutelins, and sorghum kafirins, millet pennisetins, and rye secalins genes.
  • the transcriptional regulatory region in the chimeric gene is a rice glutelin Gt1 promoter
  • the leader DNA sequence is a rice glutelin Gt1 signal sequence capable of targeting a linked polypeptide to a protein storage body.
  • An exemplary glutelin Gt1 promoter and glutelin Gt1 signal sequence are included within the sequence identified by SEQ ID NO:15.
  • the transcriptional regulatory region in the chimeric gene is a rice globulin Gib promoter
  • the leader DNA sequence is a rice glutelin Gt1 signal sequence capable of targeting a linked polypeptide to a protein storage body.
  • An exemplary globulin Gib promoter and glutelin Gt1 signal sequence are included within the sequence identified by SEQ ID NO: 16.
  • the transformed monocot seed may further encode at least one transcription factors 02, PBF, and Reb, as exemplified by SEQ ID NOS: 31 , 32, ands 33, respectively, and preferably 02 and/or PBF.
  • the protein-coding sequence may be the coding sequence for a milk protein selected from the group consisting of lactoferrin, lysozyme, lactoferricin, lactohedrin, kappa-casein, haptocorrin, lactoperoxidase, alpha-1-antitrypsin, and immunoglobulins, preferably a sequence which has been codon-optimized for expression in monocots.
  • Exemplary codon-optimized sequences for human milk proteins are represented by SEQ ID NOS: 1, 3, and 7-14.
  • Exemplary coding sequences for acute-phase, non-milk proteins are identified by SEQ ID NOS: 36, and 46-56.
  • Exemplary coding sequences for antimicrobial peptides are identified by SEQ ID NOS: 34-68, 40-41, and 43.
  • Exemplary sequences for other anti-microbial proteins are identified by SEQ ID NOS: 37, 45, and 57-59.
  • the plant may be further stably transformed with a second chimeric gene having (i) a transcriptional regulatory region from a monocot gene having a seed maturation- specific promoter, (ii) operably linked to said transcriptional regulatory region, a transit DNA sequence encoding a monocot seed-specific transit sequence capable of targeting a linked polypeptide to an endosperm-cell organelle, and (iii) a protein-coding sequence encoding a second heterologous, anti-microbial protein.
  • a second chimeric gene having (i) a transcriptional regulatory region from a monocot gene having a seed maturation- specific promoter, (ii) operably linked to said transcriptional regulatory region, a transit DNA sequence encoding a monocot seed-specific transit sequence capable of targeting a linked polypeptide to an endosperm-cell organelle, and (iii) a protein-coding sequence encoding a second heterologous, anti-microbial protein.
  • the invention includes an improved feed for production animals (poultry and hoofed farm animals), comprising one or more plant-derived feed ingredients, substantially unsupplemented with small-molecule antibiotics, and, as an additive, a seed composition containing one or more seed-produced heterologous, antimicrobial proteins in substantially purified form.
  • Figure 1 is a map of the pAPH 59 expression construct that contains the human lysozyme coding sequence under the control of a Gt1 promoter and Gt1 signal sequence.
  • Figure 2 shows the results of Western blot analysis for the expression of recombinant human lysozyme in various tissues of rice plants, where lanes 1 and 15 are a human milk lysozyme standard; lane 2 is a broad range molecular weight marker from Sigma; lanes 3 and 4 represent mature seed tissue extracts; lanes 5 and 6 represent germinated seed extracts; lanes 7 and 8 represent root tissue extracts; lanes 9 and 10 represent extracts from young root tissue; lanes 11 and 12 represent leaf extracts; and lanes 13 and 14 represent extracts from young leaf; from untransformed ("U”) or transgenic ("T”) plants, respectively.
  • the total loading protein amount was 40 ⁇ g per lane.
  • Figure 3 shows the effect of incubating recombinant human lysozyme from transgenic rice seed, a human lysozyme standard (30 ⁇ g/ml), a control (20 mM sodium phosphate, pH 7.0, 5 mM EDTA) or an untransformed rice extract on the growth of E.coli strain JM109.
  • a human lysozyme standard (30 ⁇ g/ml)
  • a control (20 mM sodium phosphate, pH 7.0, 5 mM EDTA
  • an untransformed rice extract on the growth of E.coli strain JM109.
  • Figure 4 is a graph showing the specific activity of lysozyme, as determined by incubating an identical concentration of a human lysozyme standard, human lysozyme from transgenic rice (plant) and lysozyme from chicken egg white with a standard amount of M. luteus, followed by evaluation of the reduction in the turbidity due to the activity of lysozyme over five minutes.
  • FIG. 5A Thermal stability of human lysozyme ("Hlys”) and recombinant human lysozyme from transgenic rice (“rHLys”). Lysozyme was dissolved at 100 ⁇ g/ml in PBS. The mixtures were subjected to different temperatures for different lengths of time. At the end of each heat treatment, the remaining lysozyme activity was assessed by activity assay.
  • Figure 5B pH stability of Hlys and rHlys. Lysozyme was dissolved in different buffers at 100 ⁇ g/ml. The mixture was incubated at 37 ° C for 30 min. The lysozyme activity was determined by activity assay.
  • Figure 6 presents the results of an analysis of lysozyme expression in transgenic rice grains over several generations. Proteins from 1 g of brown rice flour were extracted with 40 ml of extraction buffer containing 0.35 M NaCl in PBS. Extraction was conducted at room temperature for 1 h with shaking. Homogenate was centrifuged at 14,000 rpm for 15 min at 4 ° C. Protein supernatant was removed and diluted as needed for lysozyme turbidimetric activity assay. Extraction was repeated three times and standard deviation was shown as an error bar. Lysozyme yield was expressed as percentage of total soluble protein (%TSP).
  • Figure 7 is a restriction map of the pAPI164 plasmid that contains the human lactoferrin coding sequence under the control of a rice glutelin (Gt1 ) promoter, aGtl signal peptide, and a nopaline synthase (NOS) terminator/polyadenylation site.
  • Figure 8 shows the results of a SDS-PAGE analysis for human lactoferrin stained with Coomassie blue, where lane 1 is the molecular weight marker; lanes 2 - 5 are purified human derived lactoferrin (Sigma, USA); lanes 6 - 10 are single seed extracts from homozygous transgenic lines and lane 11 is a seed extract from non- transformed TP-309.
  • Figure 9 shows the results of a Western blot analysis of various tissues of the transgenic rice plants, demonstrating the tissue specificity of rLF expression.
  • Lane 1 is the molecular weight marker
  • lane 2 is human lactoferrin (Sigma, USA)
  • lane 3 is an extract from leaf
  • lane 4 is an extract from sheath
  • lane 5 is an extract from root
  • lane 6 is an extract from seed
  • lane 7 is an extract from 5-day germinated seeds.
  • Figure 10 is a bar diagram illustrating the bactericidal effect of native human lactoferrin ("nHLF”) and purified recombinant human lactoferrin produced by transgenic rice (“rHLF”) on growth of E. coli (EPEC) after pepsin/pancreatic treatment.
  • nHLF native human lactoferrin
  • EPEC E. coli
  • Figure 11 is a graph illustrating pH-dependent iron release by native human lactoferrin ("nHLF”) and purified recombinant human lactoferrin produced by transgenic rice seeds (“rHLF”).
  • nHLF native human lactoferrin
  • rHLF purified recombinant human lactoferrin produced by transgenic rice seeds
  • Figure 12 shows the binding and uptake of HLf to Caco-2 cells after in vitro digestion.
  • Figure 12 A shows the determination of Dissociation constant.
  • Figure 12B shows the number of binding sites for HLf on Caco-2 cells.
  • Figure 12C shows the total uptake of HLf and Fe to Caco-2 cells within 24 h.
  • Figure 12D shows degradation of HLf after uptake into Caco cells determined by the amount of free 125 l in the cell fractions.
  • Figure 13 shows three AAT plasmids: pAPI255 containing Gib promoter, Gib signal peptide, codon-optimized AAT gene, Nos terminator and ampicillin resistence gene;pAPI250 containing Gt1 promoter, Gt1 signal peptide, codon-optimized AAT gene, Nos terminator and ampicillin resistance gene; and pAPI282 containing Bx7 promoter, Bx7 signal peptide, codon-optimized AAT gene, Nos terminator and ampicillin resistance gene.
  • Figure 14 shows Coomassie brilliant blue staining of aqueous phase extraction of transgenic rice cells expressing human AAT. Both untransformed and transgenic rice grains were ground with PBS. The resulting extract was spun at 14,000 rpm at 4 ° C for 10 min. Supemanant was collected and loaded onto a precast SDS-PAGE gel.
  • Figure 15 shows Western blot analysis of recombinant human AAT from transgenic rice grains.
  • the extract from transgenic rice grain was separated by SDS- PAGE gel and then blotted onto a filter.
  • the identification of AAT in rice grain was carried out by anti-AAT antibody by Western analysis.
  • Figures 16A-B shows Coomassie staining ( Figure 16A) and western blot analysis ( Figure 16B) of protein from transgenic rice grains expressing AAT.
  • the activity of rAAT was demonstrated by a band shift assay.
  • AAT samples from different sources were incubated with equal moles of porcine pancreatic elastase (PPE) at 37°C for 15 min.
  • Negative control for band shift assay was prepared with the AAT samples incubated with equal volume of PPE added.
  • Lane M is molecular weight markers.
  • Lane 1a is purified AAT from human plasma.
  • Lane 1b is purified AAT from human plasma + PPE.
  • Lane 2a is protein extract containing AAT from transgenic rice seed; Lane 2b is protein extract containing AAT from transgenic rice seed + PPE. Lane 3a is untransformed seed extract. Lane 3b is untransformed seed extract + PPE. A shifted band was shown in lane 1b, 2b and 3b in Figure 16A. The shifted band was confirmed to contain AAT entity by Western blot in Figure 16B.
  • Figure 17A-C are schematic representations of 3 plasmids containing the Reb coding sequence under the control of 3 dfferent promoters.
  • Figure 17A shows the globulin promoter (Gib), with the Reb gene and the Reb terminator.
  • Figure 17B shows the actin promoter (Act), with the Reb gene and the Reb terminator.
  • Figure 17C shows the native Reb promoter, with the Reb gene and the Reb terminator.
  • Figures 18A-B are schematic depictions of 2 plasmids which contain different transcription factor coding sequences under the control of the rice endosperm-specific glutelin promoter (Gt-1 ).
  • Figure 18A shows plasmid pGT1 -BPBF (API286) containing the Gt1 promoter, barley prolamin box binding factor (BPBF), Nos terminator and kanamycin resistance gene.
  • Figure 18B shows pGT1-PBF (API285) containing the Gt1 promoter, the maize prolamin box binding factor (PBF), Nos terminator and kanamycin resistance gene.
  • Figure 19 illustrates the results of an analysis for the expression of recombinant human lysozyme in mature seed of T 0 transgenic plants derived from progenitor cells transformed with constructs containing the human lysozyme gene expressed under the control of the Gib promoter and the Reb gene expressed under the control of its own promoter ("Native-Reb"). Seeds of 30 plants containing the Reb and lysozyme genes and seeds from 17 plants containing only the lysozyme gene were analyzed for lysozyme, with twenty individual seeds of each plant analyzed.
  • Figure 20 is a comparison of the codon-optimized epidermal growth factor sequence ("Egfactor”) with a native epidermal growth factor sequence ("Native Gene”), aligned to show 53 codons in the mature sequences, with 27 (51%) codon changes and 30 (19%) nucleotides changes.
  • Egfactor codon-optimized epidermal growth factor sequence
  • Native Gene native epidermal growth factor sequence
  • Figure 21 is a restriction map of the 4,143 bp plasmid, API270 (pGlb-EFG v2.1), showing an expression cassette for epidermal growth factor ("EGF"), and containing a Gib promoter, a Gib signal peptide, codon optimized EGF, a Nos terminator and an ampicillin resistance selectable marker.
  • Figure 22 is a restriction map of the 3877 bp plasmid, API303 (pGt1-EGF v2.1 ), showing an expression cassette for epidermal growth factor (EGF), and containing a rice Gt1 promoter, a Gt1 signal peptide, codon optimized EGF, a Nos terminator and an ampicillin resistance selectable marker.
  • Figure 23 is a Western blot analysis of recombinant human EFG ("rhEGF") in transgenic rice seed.
  • Lane 1 shows a broad range of molecular weight markers.
  • Lane 2 shows rhEGF expressed in yeast, loaded at 125 ng.
  • Lanes 2 to 6 show rhEGF expressed from different transgenic rice seeds.
  • Lane 7 is from seeds of control untransformed TP 309.
  • Figure 24 is a comparison of the codon-optimized insulin-like growth factor I sequence ("Insgfact”) with a native human insulin-like growth factor I sequence ("native Gene”), aligned to show 70 codons in the mature sequences, with 40 (57%) codon changes and 47 (22%) nucleotides changes.
  • Figure 25 is a restriction map of the 3928 bp plasmid, API304 (pGt1-IFG v2.1 ), showing an expression cassette for insulin-like growth factor I ("IGF"), and containing a rice Gt1 promoter, a Gt1 signal peptide, codon optimized IGF, a Nos terminator and an ampicillin resistance selectable marker.
  • IGF insulin-like growth factor
  • Figure 26 is a restriction map of the 4194 bp plasmid, API271 (pGlb-IGF v2.1), showing an expression cassette for insulin-like growth factor I ("IGF"), and containing a Gib promoter, a Gib signal peptide, codon optimized IGF, a Nos terminator and an ampicillin resistance selectable marker.
  • IGF insulin-like growth factor
  • Figure 27 is a Western blot analysis of recombinant human IGF-I ("rhlGF”) expressed in transgenic rice seeds.
  • Lane 1 shows a broad range of molecular weight markers.
  • Lane 2 shows rhlGF expressed in yeast, loaded at 1 ⁇ g.
  • Lanes 3-9 show rhlGF from different transgenic seeds.
  • Lane 10 is from seeds of control untransformed TP 309.
  • Figure 28 is a restriction map of the 5250 bp plasmid, API321 (pGlb-gtlsig- Haptocorrin v 2.1 ), showing an expression cassette for haptocorrin, and containing a Gib promoter, a Gt1 signal peptide, codon optimized haptocorrin, a Nos terminator and an ampicillin resistance selectable marker.
  • Figure 29 is a restriction map of the 4948 bp plasmid, API320 (pGtl -Haptocorrin v 2.1), showing an expression cassette for haptocorrin, and containing a Gt1 promoter, a Gt1 signal peptide, codon optimized haptocorrin, a Nos terminator and an ampicillin resistance selectable marker.
  • Figure 30 is a restriction map of the 4468 bp plasmid, API292 (pGlb-kcasein v2.1), showing an expression cassette for kappa-casein ("k-casein”), and containing a Gib promoter, a Gib signal peptide, a k-casein gene, a Nos terminator and an ampicillin resistance selectable marker.
  • k-casein kappa-casein
  • Figure 31 is a restriction map of the 4204 bp plasmid, API297 (pGT1-kaapa- Casein v2.1), showing an expression cassette for kappa-casein, and containing a Gt1 promoter, a Gt1 signal peptide, mature kappa-casein polypeptide encoding gene, a Nos terminator and an ampicillin resistance selectable marker.
  • Figure 32 is a restriction map of the 4834 bp plasmid, API420 (pGt1-LAD), showing an expression cassette for lactahedrin, and containing a Gt1 promoter, a Gt1 signal peptide, lactohedrin gene, a Nos terminator and a kanamycin resistance selectable marker.
  • Figure 33 is a restriction map of the 5638 bp plasmid, API418 (pGT1-LPO-S), showing an expression cassette for lactoperoxidase (minus the propeptide), and containing a Gt1 promoter, a Gt1 signal peptide, lactoperoxidase gene without the propeptide, a Nos terminator and a kanamycin resistance selectable marker.
  • Figure 34 is a restriction map of the 5801 bp plasmid, API416 (pGtl- lactoperoxidase), showing an expression cassette for codon optimized human lactoperoxidase, and containing a rice Gt1 promoter, a Gt1 signal peptide, codon optimized lactoperoxidase, a Nos terminator and a kanamycin resistance selectable marker.
  • API416 pGtl- lactoperoxidase
  • Figure 35 is a restriction map of the 4408 bp plasmid, API230 (pBX7-Lysozyme v2.1.1 ), showing an expression cassette for codon optimized lysozyme, and containing a BX-7 promoter, a Gt1 signal peptide, codon optimized lysozyme gene, a Nos terminator and an ampicillin resistance selectable marker.
  • Figures 36A-B represent schematic diagrams of the map of 2 plasmids, API254 ( Figure 36A) and API264 ( Figure 36B) containing heterologous protein coding sequences under the control of the rice endosperm-specific globulin promoter (Gib), the
  • API254 contains the lactoferrin coding sequence
  • API264 contains the human lysozyme coding sequence.
  • Figure 37 is a restriction map of the 4271 bp plasmid, API225, showing an expression cassette for codon optimized lysozyme, and containing a GT-3 promoter, a Gt1 signal peptide, codon optimized lysozyme, a Nos terminator and an ampicillin resistance selectable marker.
  • Figure 38 is a restriction map of the 4106 bp plasmid, API229, showing an expression cassette for codon optimized lysozyme, and containing a RP-6 promoter, a Gt1 signal peptide, codon optimized lysosyme, a Nos terminator and an ampicillin resistance selectable marker.
  • Figure 39 is a comparison of the expression of lysozyme under Gt1 or Gib promoter with Gt1 signal peptide or Gib signal peptide.
  • Figure 50A is a schematic representation of plasmid AP1159 that contains Gt1 promoter, Gt1 signal peptide, a lysozyme gene and Nos terminator; plasmid API 228 that contains Gib promoter, Gt1 signal peptide, a lysozyme gene and Nos terminator; and plasmid API264 that contains Gib promoter, Gib signal peptide, a lysozyme gene and Nos terminator.
  • Figure 39B shows the activities of lysozyme in lysozyme-positive seeds produced in transgenic rice plants transformed with API159, API228 and API264. The seeds from multiple lines of each construct were analyzed by the lysozyme activity assay. Individual seeds from each plant were analyzed. Seeds lacking detectable amounts of lysozyme were excluded. The activities of 20-lysozyme-positive seeds per plant, including both hemizygous and homozygous seeds were averaged. The average activities were plotted on the chart.
  • Figure 40 shows the expression time course of human lysozyme during endosperm development in transgenic line.
  • FIG. 41 is a bar graph comparing the level of lysozyme expression in transgenic T1 rice seeds under 7 different promoters: Gt1 , Gib, Glub-2, Bx7, Gt3, Glub-1 and Rp6. All constructs contained a Gt1 signal peptide.
  • polypeptide refers to a biopolymer compound made up of a single chain of amino acid residues linked by peptide bonds.
  • protein as used herein may be synonymous with the term “polypeptide” or “peptide” or may refer, in addition, to a complex of two or more polypeptides.
  • anti-bacterial protein refers to a polypeptide that is has the ability to limit or diminish the intensity or duration of infection by a micro-organism, e.g., bacteria, virus, or fungal organism, when administered to the gut of a production animal.
  • proteins include those that are (i) "bacteriostatic protein,” meaning the protein is capable of inhibiting the growth of, but not capable of killing bacteria, (ii) "bactericidal protein,” meaning a protein capable of killing bacteria, (iii) antiviral proteins, (iii) agents, such as alpha-antitrypsin, that act, at least in part, by reducing proteolysis of other anti-microbial proteins, (iv) acute phase proteins which are induced in production animals in response to infection, (v) probiotic proteins, and (vi) cationic antimicrobial proteins, such as bactericidal permeability increasing protein, lactoferrin, transferrin, cathepsin G, cystatin, CAP18, and pepsinogen C. (See, e.g., Robert E. W. Hancock et al., 2000.), recognizing that some anti-microbial proteins will be in two or more of these classes.
  • Anti-microbial proteins include, without limitation, (i) anti-microbial milk proteins (either human or non-human) lactoferrin, lysozyme, lactoferricin, lactohedrin, kappa-casein, haptocorrin, lactoperoxidase, alpha- 1-antitrypsin, and immunoglobulins, e.g., IgA,
  • acute-phase proteins such as C-reactive protein (CRP); lactoferrin; lysozyme; serum amyloid A (SAA); ferritin; haptoglobin (Hp); complements 2-9, in particular complement-3; seromucoid; ceruloplasmin (Cp); 15-keto-13,14-dihydro- prostaglandin F2 alpha (PGFM); fibrinogen (Fb); alpha(1)-acid glycoprotein (AGP); alpha(1 )-antitrypsin; mannose binding protein; lipoplysaccharide binding protein; alpha-2 macroglobulin and various defensins,
  • CRP C-reactive protein
  • SAA serum amyloid A
  • Hp haptoglobin
  • Cp ceruloplasmin
  • PGFM 15-keto-13,14-dihydro- prostaglandin F2 alpha
  • Fb fibrinogen
  • alpha(1)-acid glycoprotein (AGP) alpha(1 )
  • antimicrobial peptides such as cecropin, magainin, defensins, tachyplesin, parasin l.buforin I, PMAP-23, moronecidin, anoplin, gambicin, and SAMP-29, and
  • anti-microbial protein(s) including CAP37, granulysin, secretory leukocyte protease inhibitor, CAP18, ubiquicidin, bovine antimicrobial protein-1 , Ace- AMP1 , tachyplesin, big defensin, Ac-AMP2, Ah-AMP1 , and CAP18.
  • milk protein or "proteins normally present in milk” refers to a protein or biologically active fragments thereof, found in normal mammalian milk, e.g., human milk, including, without limitation, of lactoferrin, lysozyme, lactoferricin, EGF, IGF-I, lactohedrin, kappa-casein, haptocorrin, lactoperoxidase, alpha-1-antitrypsin, and immunoglobulins, and biologically active fragments thereof.
  • the milk protein may be human milk protein, i.e., having the protein sequence of a normal human milk protein, or active fragment thereof, or of another mammalian source, e.g., bovine or ovine, or of a non-mammalian source, e.g., avian source.
  • human milk protein i.e., having the protein sequence of a normal human milk protein, or active fragment thereof, or of another mammalian source, e.g., bovine or ovine, or of a non-mammalian source, e.g., avian source.
  • active fragments of an anti-microbial protein refers to a modified antimicrobial protein containing either amino acid substitutions, deletions or additions, or fragment substitutions or deletions, but retain the anti-microbial activity of the native anti-microbial protein.
  • a "small-molecule antibiotic” refers to one a non-peptide antibiotic having a molecular weight typically less than 2 Kdaltons, typically of fungal origin, meaning produced by a strain of fungus, or being an analog of such a compound.
  • Exemplary small-molecule antibiotics that have been used in animal feed, at subclinical levels, include, as examples, bacitracin, roxarsone; penicillin G, amoxicillin, semduramicin, chlortetracycline, tetracycline, neomycin, salinomycin, and virginiamycin.
  • vector refers to a nucleic acid construct designed for transfer between different host cells.
  • An "expression vector” refers to a vector that has the ability to incorporate and express heterologous DNA fragments in a foreign cell. Many prokaryotic and eukaryotic expression vectors are commercially available. Selection of appropriate expression vectors is within the knowledge of those having skill in the art. Accordingly, an "expression cassette” or “expression vector” is a nucleic acid construct generated recombinantly or synthetically, with a series of specified nucleic acid elements that permit transcription of a particular nucleic acid in a target cell.
  • the recombinant expression cassette can be incorporated into a plasmid, chromosome, mitochondrial DNA, plastid DNA, virus, or nucleic acid fragment.
  • the recombinant expression cassette portion of an expression vector includes, among other sequences, a nucleic acid sequence to be transcribed and a promoter.
  • plasmid refers to a circular double-stranded (ds) DNA construct used as a cloning vector, and which forms an extrachromosomal self-replicating genetic element in many bacteria and some eukaryotes.
  • selectable marker-encoding nucleotide sequence refers to a nucleotide sequence capable of expression in plant cells and where expression of the selectable marker confers to plant cells containing the expressed gene the ability to grow in the presence of a selective agent.
  • Bar gene refers to a nucleotide sequence encoding a phosphinothricin acetyltransferase enzyme that upon expression confers resistance to the herbicide glufosinate-ammonium ("Basta").
  • a “transcription regulatory region” or “promoter” refers to nucleic acid sequences that influence and/or promote initiation of transcription. Promoters are typically considered to include regulatory regions, such as enhancer or inducer elements. The promoter will generally be appropriate to the host cell in which the target gene is being expressed. The promoter, together with other transcriptional and translational regulatory nucleic acid sequences (also termed “control sequences"), is necessary to express any given gene. In general, the transcriptional and translational regulatory sequences include, but are not limited to, promoter sequences, ribosomal binding sites, transcriptional start and stop sequences, translational start and stop sequences, and enhancer or activator sequences.
  • Chimeric gene or “heterologous nucleic acid construct”, as defined herein refers to a construct which has been introduced into a host and may include parts of different genes of exogenous or autologous origin, including regulatory elements.
  • a chimeric gene construct for plant/seed transformation is typically composed of a transcriptional regulatory region (promoter) operably linked to a heterologous protein coding sequence, or, in a selectable marker heterologous nucleic acid construct, to a selectable marker gene encoding a protein conferring antibiotic resistance to transformed plant cells.
  • a typical chimeric gene of the present invention includes a transcriptional regulatory region inducible during seed development, a protein coding sequence, and a terminator sequence.
  • a chimeric gene construct may also include a second DNA sequence encoding a signal peptide if secretion of the target protein is desired.
  • a nucleic acid is "operably linked" when it is placed into a functional relationship with another nucleic acid sequence.
  • DNA for a presequence or secretory leader is operably linked to DNA for a polypeptide if it is expressed as a preprotein that participates in the secretion of the polypeptide;
  • a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of the sequence; or
  • a ribosome binding site is operably linked to a coding sequence if it is positioned so as to facilitate translation.
  • "operably linked” means that the DNA sequences being linked are contiguous, and, in the case of a secretory leader, contiguous and in reading frame.
  • operably linked' elements e.g., enhancers
  • linking is accomplished by ligation at convenient restriction sites. If such sites do not exist, the synthetic oligonucleotide adaptors or linkers are used in accordance with conventional practice.
  • gene means the segment of DNA involved in producing a polypeptide chain, which may or may not include regions preceding and following the coding region, e.g. 5' untranslated (5' UTR) or “leader” sequences and 3' UTR or “trailer” sequences, as well as intervening sequences (introns) between individual coding segments (exons).
  • sequence identity means nucleic acid or amino acid sequence identity in two or more aligned sequences, aligned using a sequence alignment program.
  • % homology is used interchangeably herein with the term “% identity” and refers to the level of nucleic acid or amino acid sequence identity between two or more aligned sequences, when aligned using a sequence alignment program.
  • 70% homology means the same thing as 70% sequence identity determined by a defined algorithm, and accordingly a homologue of a given sequence has greater than 80% sequence identity over a length of the given sequence.
  • Exemplary levels of sequence identity include, but are not limited to, 80, 85, 90 or 95% or more sequence identity to a given sequence, e.g., the coding sequence for lactoferrin, as described herein.
  • Exemplary computer programs which can be used to determine identity between two sequences include, but are not limited to, the suite of BLAST programs, e.g., BLASTN, BLASTX, and TBLASTX, BLASTP and TBLASTN, publicly available on the Internet at "www.ncbi.nih.gov/BLASTr. See, also, Altschul, S.F. et al., 1990 and Altschul, S.F. ef a/., 1997. Sequence searches are typically carried out using the BLASTN program when evaluating a given nucleic acid sequence relative to nucleic acid sequences in the GenBank DNA Sequences and other public databases.
  • the BLASTX program is preferred for searching nucleic acid sequences which have been translated in all reading frames against amino acid sequences in the GenBank Protein Sequences and other public databases. Both BLASTN and BLASTX are run using default parameters of an open gap penalty of 11.0, and an extended gap penalty of 1.0, and utilize the BLOSUM-62 matrix. [See, Altschul, et al., 1997.]
  • a preferred alignment of selected sequences in order to determine "% identity" between two or more sequences is performed using for example, the CLUSTAL-W program in MacVector version 6.5, operated with default parameters, including an open gap penalty of 10.0, an extended gap penalty of 0.1 , and a BLOSUM 30 similarity matrix.
  • a nucleic acid sequence is considered to be "selectively hybridizable" to a reference nucleic acid sequence if the two sequences specifically hybridize to one another under moderate to high stringency hybridization and wash conditions.
  • Hybridization conditions are based on the melting temperature (Tm) of the nucleic acid binding complex or probe.
  • Tm melting temperature
  • maximum stringency typically occurs at about Tm-5°C (5° below the Tm of the probe); “high stringency” at about 5-10° below the Tm; “intermediate stringency” at about 10-20° below the Tm of the probe; and “low stringency” at about 20-25° below the Tm.
  • maximum stringency conditions may be used to identify sequences having strict identity or near-strict identity with the hybridization probe; while high stringency conditions are used to identify sequences having about 80% or more sequence identity with the probe.
  • Moderate and high stringency hybridization conditions are well known in the art (see, for example, Sambrook et al, 1989, Chapters 9 and 11 , and in Ausubel et al., 1993, expressly incorporated by reference herein).
  • An example of high stringency conditions includes hybridization at about 42°C in 50% formamide, 5X SSC, 5XDenhardt's solution, 0.5% SDS and 100 ⁇ g/ml denatured carrier DNA followed by washing two times in 2X SSC and 0.5% SDS at room temperature and two additional times in 0.1 X SSC and 0.5% SDS at 42°C.
  • recombinant includes reference to a cell or vector, that has been modified by the introduction of a heterologous nucleic acid sequence or that the cell is derived from a cell so modified.
  • recombinant cells express genes that are not found in identical form within the native (non-recombinant) form of the cell or express native genes that are otherwise abnormally expressed, under expressed or not expressed at all as a result of deliberate human intervention.
  • a plant cell, tissue, organ, or plant into which a heterologous nucleic acid construct comprising the coding sequence for an anti-microbial protein or peptide has been introduced is considered transformed, transfected, or transgenic.
  • a transgenic or transformed cell or plant also includes progeny of the cell or plant and progeny produced from a breeding program employing such a transgenic plant as a parent in a cross and exhibiting an altered phenotype resulting from the presence of the coding sequence for an anti-microbial protein.
  • a plant of the invention will include any plant which has a cell containing introduced nucleic acid sequences, regardless of whether the sequence was introduced into the plant directly through transformation means or introduced by generational transfer from a progenitor cell which originally received the construct by direct transformation.
  • transgenic plant refers to a plant that has incorporated exogenous nucleic acid sequences, i.e., nucleic acid sequences which are not present in the native ("untransformed") plant or plant cell.
  • a plant having within its cells a heterologous polynucleotide is referred to herein as a "transgenic plant”.
  • the heterologous polynucleotide can be either stably integrated into the genome, or can be extra- chromosomal.
  • the polynucleotide of the present invention is stably integrated into the genome such that the polynucleotide is passed on to successive generations.
  • transgenic does not encompass the alteration of the genome (chromosomal or extra-chromosomal) by conventional plant breeding methods or by naturally occurring events such as random cross-fertilization, non- recombinant viral infection, non-recombinant bacterial transformation, non-recombinant transposition, or spontaneous mutation.
  • Transgenic is used herein to include any cell, cell line, callus, tissue, plant part or plant, the genotype of which has been altered by the presence of heterologous nucleic acids including those transgenics initially so altered as well as those created by sexual crosses or asexual reproduction of the initial transgenics.
  • transformed means the plant cell has a non-native (heterologous) nucleic acid sequence integrated into its genome which is maintained through two or more generations.
  • expression refers to the process by which the protein or peptide is produced based on the nucleic acid sequence of a gene. The process includes both transcription and translation. The term “expression” may also be used with respect to the generation of RNA from a DNA sequence.
  • the term "introduced” in the context of inserting a nucleic acid sequence into a cell means “transfection”, or “transformation” or “transduction” and includes the incorporation of a nucleic acid sequence into a eukaryotic or prokaryotic cell where the nucleic acid sequence may be incorporated into the genome of the cell (for example, chromosome, plasmid, plastid, or mitochondrial DNA), converted into an autonomous replicon, or transiently expressed (for example, transfected mRNA).
  • host cell is meant a cell which contains a vector and supports the replication, and/or transcription or transcription and translation (expression) of the expression construct.
  • Host cells for use in the present invention can be prokaryotic cells, such as E. coli, or eukaryotic cells such as yeast, plant, insect, amphibian, or mammalian cells. In general, host cells are monocotyledenous or dicotyledenous plant cells.
  • a “plant cell” refers to any cell derived from a plant, including undifferentiated tissue (e.g., callus) as well as plant seeds, pollen, progagules and embryos.
  • undifferentiated tissue e.g., callus
  • plant seeds e.g., pollen, progagules and embryos.
  • mature plant refers to a fully differentiated plant.
  • plant includes reference to whole plants, plant organs (for example, leaves, stems, roots, etc.), seeds, and plant cells and progeny of same.
  • Plant cell as used herein includes, without limitation, seeds, suspension cultures, embryos, meristematic regions, callus tissue, leaves roots shoots, gametophytes, sporophytes, pollen, and microspores.
  • the class of plants that can be used in the methods of the present invention is generally as broad as the class of higher plants amenable to transformation techniques, including both monocotyledenous and dicotyledenous plants.
  • seed is meant to encompass all seed components, including, for example, the coleoptile and leaves, radicle and coleorhiza, scutulum, starchy endosperm, aleurone layer, pericarp and/or testa, either during seed maturation and seed germination.
  • seed in a form for use as a food or food supplement includes, but is not limited to, seed fractions such as de-hulled whole seed, flour (seed that has been de-hulled by milling and ground into a powder) a seed protein extract (where the protein fraction of the flour has been separated from the carbohydrate fraction) and/or a purified protein fraction derived from the transgenic grain.
  • purifying is used interchangeably with the term “isolating” and generally refers to the separation of a particular component from other components of the environment in which it was found or produced.
  • purifying a recombinant protein from plant cells in which it was produced typically means subjecting transgenic protein containing plant material to biochemical purification and/or column chromatography.
  • animal feed refers to feed, commercial or otherwise, used as part or all of the diet of a production animal.
  • the feed is typically a mixture or grains or grain- derived components and one or more nutritional supplements, e.g., amino acids, fat, vitamins, minerals, and the like.
  • “Monocot seed components” refers to carbohydrate, protein, and lipid components extractable from monocot seeds, typically mature monocot seeds.
  • “Malted-seed components” refers to seed-derived components, predominantly carbohydrate components, after conversion of complex carbohydrates to malt sugars by malting, i.e., treating with malting enzymes such as a barley amylase and glucanases, under conditions effective to conversion seed-derived carbohydrates to malt sugars.
  • Substantially unpurified form as applied to anti-microbial proteins in a seed extract means that the protein or proteins present in the extract are present in an amount less than 50% by weight, typically between 0.25 and 2.5 percent by weight.
  • “Seed maturation” or “grain development” refers to the period starting with fertilization in which metabolizable reserves, e.g., sugars, oligosaccharides, starch, phenolics, amino acids, and proteins, are deposited, with and without vacuole targeting, to various tissues in the seed (grain), e.g., endosperm, testa, aleurone layer, and scutellar epithelium, leading to grain enlargement, grain filling, and ending with grain desiccation.
  • metabolizable reserves e.g., sugars, oligosaccharides, starch, phenolics, amino acids, and proteins
  • “Inducible during seed maturation” refers to promoters which are turned on substantially (greater than 25%) during seed maturation.
  • Heterologous DNA or “foreign DNA” refers to DNA which has been introduced into plant cells from another source, or which is from a plant source, including the same plant source, but which is under the control of a promoter or terminator that does not normally regulate expression of the heterologous DNA.
  • Heterologous protein is a protein, including a polypeptide, encoded by a heterologous DNA.
  • a “signal/targeting/transport sequence” is an N- or C-terminal polypeptide sequence which is effective to localize the polypeptide or protein to which it is attached to a selected intracellular or extracellular region, including an intracellular vacuole or other protein storage body, chloroplast, mitochondria, or endoplasmic reticulum, or extracellular space or seed region, such as the endosperm, following secretion from the cell.
  • a "product" encoded by a DNA molecule includes, for example, RNA molecules and polypeptides.
  • a DNA sequence is "derived from” a gene if it corresponds in sequence to a segment or region of that gene. Segments of genes which may be derived from a gene include the promoter region, the 5' untranslated region, and the 3' untranslated region of the gene.
  • Alpha-amylase refers to an enzyme which principally breaks starch into dextrins.
  • Beta-amylase refers to an enzyme which converts start and dextrins into maltose.
  • Cerreal adjuncts refers to cereal grains, principally barley, wheat, rye, oats, maize, sorghum and rice, or processed whole or portions thereof, especially the starch fraction, which are added to the barley mash, which allows the barley enzymes to hydrolyze both the barley starch and the starch derived from the cereal adjunct.
  • Transgenic cereal adjuncts refers to transgenic cereal grains, principally barley, wheat, rye, oats, maize, sorghum and rice, and which is expressing a recombinant molecule in a grain part, principally the endosperm (starch) layer.
  • Conversion refers to the process of starch hydrolysis, usually catalyzed by acid or enzyme action, which produces dextrose, maltose, and higher polysaccharides from starch.
  • Diastatic enzyme as used herein refers to an enzyme capable of causing the hydrolysis of starch.
  • Diastatic malt flour refers to enzyme active flour milled from germinated (malted) barley.
  • Diastatic malt syrup refers to enzyme active liquid malt syrup (barley and cereal adjuncts).
  • “Dry diastatic malt” as used herein refers to a blend of diastatic malted barley flour, wheat flour and dextrose with standardized enzyme levels at 20degrees and 60 degrees Lintner.
  • “Dry nondiastatic malt” as used herein refers to spray dried form of liquid nondiastatic malt extract or syrup.
  • “Lintner” as used herein refers to a laboratory measurement of enzyme activity strength. The higher the value, the higher activity.
  • “Dried malt” as used herein refers to the dried grain resulting form controlled germination of cereal grins, usually barley, but other cereals can be malted as well.
  • Salt extract refers to a viscous concentrate of the water extract of dried malt.
  • Maotodextrin refers to a purified, concentrated aqueous solution of nutritive saccharides, obtained form edible starch, or the dried product derived from the solution. Maotodextrins have a dextrose equivalent of less than 20 and are considered 'non-sweet soluble solids'. They are usually marketed dry, but may be obtained as a concentrated solution. Maltodextrins are usually offered as 10 to 14 D.E. products or as 15 to 19 D.E. versions. Another maltodextrin, with a D.E. of about 5, is sometimes manufactured, but currently not used widely.
  • Composition of maltodextrins is roughly 65 to 80% higher saccharides, 4 to 9% pentasaccharides, 4 to 7% tetrasaccharides, and 5 to 9% trisaccharides. Traces of mono and disaccharides are present. They are usually used as bulking agents or viscosity builders, without sweetness. "Malt syrup” as used herein refers to viscious concentrate of the water extract of dried 'malt' and other cereal grains.
  • Salt refers to a malt extract or malt syrup.
  • Nondiastatic malt syrup refers to liquid malt syrup (barley and cereal adjuncts) without enzyme activity.
  • Transgenic malt extract refers to a vicious concentrate of the water extract of dried malt which includes a recombinant protein, polypeptide and/or metabolite.
  • Transgenic malt syrup refers to vicious concentrate of the water extract of dried 'malt' and other cereal grains which includes a recombinant protein, polypeptide and/or metabolite.
  • production animals includes poultry, such as chickens, turkeys, squab, and ducks, and hoofed farm animals, such as cattle, sheep, goats, and pigs that are grown and harvested for human food consumption.
  • animal feed typically contains sub-therapeutic levels of antibiotics, which have been found to increase weight gain in animals by about 3-15% over a given feed period.
  • the antibiotics are believed to suppress the microbial flora, and hence reduce the immune responses in the animal to low-level infection. Untreated, such immune responses result in the animal eating less and therefore gaining less weight. In other words, the antibiotics help keep the animal in a "hungry" healthy state.
  • the reactions of an animal's immune system to infection is both specific against the causal agent and nonspecific, yielding predictable metabolic changes termed the "acute-phase response" (Johnson, 1997).
  • the acute phase proteins (APP) produced during this response play a major role in the inflammatory process in mammals.
  • determination of the plasma concentration of these proteins gives valuable clinical information on the infection inflammation process (See, e.g., Gruys er a/., 1994.)
  • the inflammatory response begins with release of interleukin-1 (IL-1 ) and tumor necrosis factor-alpha (TNF-alpha) by monocytes and macrophages that subsequently activates a complex cascade of other inflammatory mediators including IL- 2, IL-6 and IL-8 (Dinarello, 1994; Jensen et al., 1998).
  • IL-1 interleukin-1
  • TNF-alpha tumor necrosis factor-alpha
  • the various acute phase proteins rise in response to activation by pro- inflammatory cytokines (such as IL-1 and TNF-alpha ) that are secreted into the circulation from sites of infection or inflammatory lesions.
  • pro- inflammatory cytokines such as IL-1 and TNF-alpha
  • the infection may be subclinical and of bacterial, viral or other origin and still effect both growth and appetite in animals.
  • IL-1 interleukin-1
  • TNF tumor necrosis factor-alpha
  • IL-6 interleukin-6
  • cytokines The release of cytokines leads to both the stimulation and inhibition of protein synthesis.
  • exemplary positive acute phase proteins include C-reactive protein (CRP); lactoferrin; lysozyme; serum amyloid A (SAA); ferritin; haptoglobin (Hp); complements 2- 9, in particular complement-3; seromucoid; ceruloplasmin (Cp); 15-keto-13,14-dihydro- prostaglandin F2 alpha (PGFM); fibrinogen (Fb); alpha(1)-acid glycoprotein (AGP); alpha(1)-antitrypsin; mannose binding protein; lipoplysaccharide binding protein; alpha-2 macroglobulin and various defensins.
  • Cytokines can also inhibit the synthesis of proteins (negative acute phase proteins), e.g., serum albumin and transferrin. (See, e.g., P. D. Eckersall,
  • Acute phase proteins that are reportedly produced by the intestinal epithelium include, but are not limited to, serum amyloid a, complement-3, mannose binding protein and various defensins.
  • Cationic anti-microbial peptides are also involved in the response to infection in all mammals and may be constitutively expressed or induced by infectious organisms or their products.
  • a number of antimicrobial peptides show activity against a broad range of bacterial strains, including antibiotic-resistant isolates.
  • the antimicrobial peptides prevent cytokine induction by bacterial products in tissue culture and human blood, and they block the onset of sepsis in mouse models of endotoxemia.
  • antimicrobial peptides include, but are not limited to, animal cationic proteins such as bactericidal permeability increasing protein, lactoferrin, transferrin, cathepsin G, cystatin, CAP18, pepsinogen C, ribosomal protein S30, etc. (See, e.g., Robert E. W. Hancock et al., 2000.)
  • animal cationic proteins such as bactericidal permeability increasing protein, lactoferrin, transferrin, cathepsin G, cystatin, CAP18, pepsinogen C, ribosomal protein S30, etc.
  • Chicks raised in environments with poor sanitation have small intestines that possess high numbers of leukocytes in the villi and thickened lamina intestinal with larger Peyers patches. Chicks raised with poor sanitation also have markedly higher levels of circulation IL-1 than chicks raised with excellent sanitation.
  • the high burden of microbes, dust and dander chronically stimulate the immune system and induce the release of cytokines such as IL-1.
  • high circulating levels of inflammatory cytokines result in slower growth.
  • Feeding antibiotics to chicks in a dirty environment decreases the amount of circulation IL-1 to levels more similar to chicks raised in the clean environment. Feeding antibiotics result in little or no improvements in growth rate or changes in circulating IL-1 levels in clean environments.
  • antibiotics improve growth rates.
  • antibiotics decrease the number and severity of bacterial interactions with the animal.
  • antibiotics decrease the degree of activity of the immune system and consequently decrease the levels of IL-1 and other monokines. This normalizes the metabolic rate and results in poor feed conversion efficiency and less muscular animals.
  • antibiotics in animal feed are well known, including such issues as the development of antibiotic-resistant microbes, requiring new and higher levels of antibiotics. Of perhaps greater concern is the threat of antibiotic resistant genes being spread in the environment, potentially spreading even to human intestinal flora and/or human bacterial pathogens.
  • compositions Containing Anti-Microbial Proteins The present invention provides animal feed compositions (also termed “improved animal feed compositions") containing one or more anti-microbial proteins, and methods of making such compositions.
  • an anti-microbial protein e.g., an acute-phase milk anti-microbial protein
  • transgenic monocot seeds the transgenic seeds are processed and added to animal feed.
  • a method for maintaining healthy microflora in production animals by supplementing animal feed with transgenic grain or other plant material comprising one or more anti-microbial proteins.
  • antimicrobial proteins are the milk acute-phase anti-microbial proteins such as lysozyme and/or lactoferrin, particularly human lysozyme and/or lactoferrin.
  • the anti-microbial proteins described herein are able to regulate the microflora of an animal in such a fashion that the animal avoids the typical low-level immune responses to subclinical infection.
  • the supplemented animal feed compositions of the invention may be fed to production animals in order to regulate the animal gut microflora, thereby contributing to increased feed efficiency, and increased weight gain in the animals.
  • the invention is based on the expression at high expression levels of one or more anti-microbial proteins, exemplified by human lactoferrin (hLF) and human lysozyme, among others, under the control of a seed specific promoter in monocot seeds.
  • hLF human lactoferrin
  • the description provided herein includes a comparison of anti-microbial proteins produced by transgenic plants to the native form of the same protein, information on the stability of the recombinant protein and the advantages of using grain containing such anti-microbial proteins in animal feed products.
  • the invention relies on the use of heterologous nucleic acid constructs which include the coding sequence for one or more anti-microbial proteins.
  • anti-microbial proteins lysozyme and lactoferrin
  • lysozyme and lactoferrin are an integral part of the immune system of multicellular animals. They are found in epithelial secretions (tears, mucous, gastric juice) and blood plasma of mammals, birds, reptiles, amphibia, and a variety of invertebrates. They are also enriched in mammalian milk and avian eggs, where they serve as primary antimicrobial proteins.
  • lysozyme is a major component of the secretory granules of neutrophils and macrophages and is released at the site of infection in the earliest stages of the immune response, and lactoferrin is found at high concentrations within specific granules of polymorphonuclear leukocytes.
  • Lysozyme along with lactoferrin and immunoglobulins, e.g., IgA, are widely recognized to be the predominant immunological factors in milk that manage the establishment of a protective commensal microflora population and control the growth of pathogens in the gastrointestinal tract of mammals.
  • Anti-microbial milk proteins may be found in public gene databases, such as the GENBANK database, accessible through internet address "www.ncbi.nlm.gov/BLAST/". Group 1. Anti-microbial milk proteins
  • Lysozyme called muramidase or peptidoglycan N-acetylmuramoyl-hydrolase (EC 3.2.1.17) contains 130 amino acid residues (human lysozyme) and is a protein of 14.7 kDa in size. Human lysozyme is non-glycosylated and possesses unusual stability in vitro and in vivo due to its amino acid and secondary structure.
  • Lysozyme is one of the most abundant proteins present in human milk with a concentration of about 400 ⁇ g/ml. The concentration of lysozyme is approximately 0.13 ⁇ g/ml in cow's milk (almost 3000 times less than found in human milk), 0.25 ⁇ g/ml in goat's milk, 0.1 ⁇ g/ml in sheep's milk and almost absent in rodent's milk (Chandan RC, 1968). Lysozyme is also found in other mammalian secretions, such as tears and saliva.
  • lysozyme The protective role of lysozyme has been observed to include lysis of microbial cell walls, adjuvant activity of the end products peptidoglycan lysis, direct immunomodulating effects on leukocytes, and neutralization of bacterial endotoxins.
  • the bacteriostatic and bactericidal actions of lysozyme were originally discovered by Flemming in 1922 and have been studied in detail. Lysozyme is effective against both gram positive and gram negative bacteria, as well as some types of yeasts.
  • the antimicrobial effects of lysozyme often act synergistically with other defense molecules, including immunoglobulin and lactoferrin.
  • structural changes in the cell wall due to lysozyme render bacteria more susceptible to phagocytosis by macrophages and neutrophils.
  • microbial peptidoglycans results in the release of the cleavage product, muramyl dipeptide, which is a potent adjuvant and is the active component of Freund's complete adjuvant.
  • Muramyl dipeptide enhances IgA production, macrophage activation, and rapid clearance of a variety of bacterial pathogens in vivo.
  • Lysozyme itself is also immunomodulatory. It directly interacts with the cell membrane of phagocytes to increase their uptake of bacteria. Lysozyme also augments the proliferative response of mitogen stimulated lymphocytes to interleukin-2 and increases the rate of synthesis of IgG and IgM by more than 5-and 2- fold respectively.
  • lysozyme is not dependent upon enzymatic activity and is retained following denaturation.
  • lysozyme When lysozyme is fed to mice, it increases the number of intraepithelial and mesenteric lymph node lymphocytes that display antigens.
  • Lysozymes act as enzymes that cleave peptidoglycans, and ubiquitous cell wall component of microorganisms, in particular bacteria.
  • lysozymes are 1,4- -acetylmuramidases that hydrolyze the glycoside bond between N-acetylmuramic acid and N-acetylglucosamine.
  • Gram- positive bacteria are highly susceptible to lysozyme due to the polypeptidoglycan on the outside of the cell wall.
  • Gram-negative strains have a single polypeptidoglycan layer covered by lipopolysaccharides and are therefore less susceptible to lysis by lysozyme, however, the sensitivity can be increased by the addition of EDTA (Sch ⁇ tte and Kula, 1990). Lysozyme also exhibits antiviral activity, as exemplified by the significant reduction in recurrent occurrences of genital and labial herpes after oral treatment of patients with lysozyme (Jolles, 1996). More recently, lysozyme from chicken egg whites, human milk and human neutrophils has been shown to inhibit the growth of HIV- 1 in an in vitro assay (Lee-Huang et al., 1999).
  • Lysozyme thus functions as a broad spectrum antimicrobial agent.
  • lysozyme exhibits anti-inflammatory activity during pathogen challenges.
  • the current major commercial source for lysozyme is chicken egg whites. Sequence analysis shows that lysozyme from chicken egg whites exhibits only partial homology (60%) with that synthesized by humans. Chicken and human lysozyme do not cross-react with their respective antibodies (Faure et al., 1970), indicating significant structural differences between these two lysozymes. Human lysozyme has been purified from breast milk (Boesman-Finkelstein et al., 1982; Wang et al., 1984), neutrophills (Lollike et al., 1995), and urine of hemodialysis patients (Takai et al., 1996). Breast milk remains the main source for isolation of human lysozyme, but the supply is limited. Precautions are required for isolation of the enzyme from human sources to avoid contamination with viral and microbial pathogens.
  • human lysozyme in these organisms could be very low, and the cost of these forms may be prohibitive for food applications.
  • human lysozyme produced in microorganisms may require extensive purification before it can be used in foods, particularly for infants and children.
  • lysozyme In contrast to many other proteins, lysozyme is highly resistant to digestion in the gastrointestinal tract. In vitro studies have demonstrated that both molecules are resistant to hydrolysis by pepsin in the pH range found in the stomach. Furthermore, partial denaturation of lysozyme increases its bactericidal activity against some types of bacteria, and low pH, such as found in the stomach, increases the bactericidal effects of lysozyme.
  • a proteolytic fragment (amino acids 98-112 of chicken egg white lysozyme) completely lacking enzymatic activity has been found to be the active bactericidal component of lysozyme. Additionally, a fragment of lactoferrin, known as lactoferricin, is formed by limited proteolytic digestion and has been shown to have extremely effective antibacterial activity.
  • the rice produced human lysozyme of the present invention exhibits acid pH resistance, as well as resistance to pepsin and pancreatin to make it resistant to digestion in the gastrointestinal tract.
  • the excellent thermostability provides the feasibility to pasteurize products that include the recombinant human lysozyme.
  • Lactoferrin is an iron-binding protein found in the granules of neutrophils where it apparently exerts an antimicrobial activity by withholding iron from ingested bacteria and fungi; it also occurs in many secretions and exudates (milk, tears, mucus, saliva, bile, etc.). In addition to its role in iron transport, lactoferrin has bacteriostatic and bactericidal activities, in addition to playing a role as an anti-oxidant (Satue-Gracia et. al., 2000).
  • the mature human lactoferrin (LF) polypeptide consists of 692 amino acids, consists of a single-chain polypeptide that is relatively resistant to proteolysis, is glycosylated at two sites (N138 and N478) and has a molecular weight of about 80 kD.
  • Human lactoferrin (hLF) is found in human milk at high concentrations (at an average of 1-3 mg/ml), and at lower concentration (0.1-0.3 mg/ml), in exocrine fluids of glandular epithelium cells such as bile, tears, saliva etc.
  • lactoferrin The primary functions of lactoferrin have been described as iron regulation, immune modulation and protection from infectious microbes. Lactoferrin can bind two ferric ions and has been shown to have biological activities including bacteriostatic (Bullen et al., 1972), bactericidal (Arnold, et al., 1980) and growth factor activity in vitro. Further, lactoferrin can promote the growth of bacteria that are beneficial to the host organism by releasing iron in their presence. Additional studies have recently shown lactoferrin to have antiviral activity towards cytomegalovirus, herpes simples virus, rotovirus and HIV both in vitro and in vivo. (See, e.g., Fujihara et. al., 1995; Grover et al., 1997; and Harmsen et al., 1995.)
  • Lactoferrin like transferrin, has a strong capacity to bind free iron under physiological conditions due to its tertiary structure, which consists of two globular lobes linked by an extended alpha-helix.
  • the ability of lactoferrin to scavenge iron from the physiological environment can effectively inhibit the growth of "more than 90% of all microorganisms" by depriving them of a necessary component of their metabolism, which will inhibit their growth in vivo and in vitro.
  • lactoferrin Unrelated to iron binding, the bactericidal activity of lactoferrin stems from its ability to destabilize the outer membrane of gram-negative bacteria through the liberation of lipopolysaccaharides that constitute the cell walls of the bacteria.
  • lactoferrin has recently been shown to bind to prions, a group of molecules common in E. coli, causing permeability changes in the cell wall.
  • Studies in germfree piglets fed lactoferrin before being challenged with E. coli show significant decrease in mortality compared to the control group.
  • Recombinant LF rLF
  • rLF Recombinant LF
  • Aspergillus oryzae Ward et al., 1992
  • baculovirus expression system Saculovirus expression system
  • the ⁇ sperg///us-produced protein will require a high degree of purification as well as safety and toxicity testing prior to using it as a food additive (L ⁇ nnerdal, 1996).
  • Lactoferrin has also been expressed in tobacco (Nicotiana tabacum L. cv Bright Yellow) cell culture (Mitra and Zhang, 1994), tobacco plants (Salmon et al., 1998) and potato (Solanum tuberosum) plants (Chong and Langridge, 2000).
  • tobacco cell culture the protein was truncated, whereas in tobacco and potato plants the rLF was processed correctly, but its expression level was very low (0.1% of total soluble protein) (Chong and Langridge, 2000).
  • the expression level of recombinant human lactoferrin in these organisms could be very low, and the cost of these forms may be prohibitive for food applications.
  • human lactoferrin produced in microorganisms may require extensive purification before it can be used in foods, particularly for infants and children.
  • lactoferrin In contrast to most other proteins, lactoferrin has also been shown to be resistant to proteolytic degradation in vitro, with trypsin and chymotrypsin remarkably ineffective in digesting lactoferrin, particularly in its iron-saturated form. Some large fragments of lactoferrin were formed, but proteolysis was clearly limited.
  • Lactoperoxidase is an an enzyme which catalyzes the conversion of hydrogen peroxide to water. This enzyme is found in human milk, and plays host defensive roles through antimicrobial activity. When hydrogen peroxide and thiocyanate are added to raw milk, the SCN's oxidized by the enzyme-hydrogen peroxide complex producing bactericidal compounds which destroy Gram-negative bacteria (Shin).
  • Kappa-casein is a group of readily digested caseins, which account for almost half of the protein content in human milk, are important as nutritional protein for breast- fed infants. It has also been advocated that part of the antimicrobial activity of human milk resides in the caseins, most likely the glycosylated kappa-casein.
  • Alpha-1-antitrypsin is a protease inhibitor that acts to prevent the digestion of the milk proteins, for example lysozyme and lactoferrin, in newbown infant gut, is the presence of protease inhibitors, such as ⁇ -1-antitrypsin (AAT) in human milk.
  • AAT belongs to the class of serpin inhibitors, has a molecular mass of 52 kD, and contains about 15% carbohydrate (Carrell et al, 1983). Concentrations of AAT in human milk range from 0.1 to 0.4 mg/mL, and they appear to decrease with infant age (Davidson and L ⁇ nnerdal, 1979; McGilligan et al., 1987).
  • AAT While the binding affinity of AAT is highest for human neutrophil elastase, it also has affinity for pancreatic proteases such as chymotrypsin and trypsin (Beatty et al., 1980). The role of AAT in milk is possible that AAT may prolong the survival of other anti-microbial proteins through inhibition of pancreatic proteases. While anti-microbial proteins have been expressed in systems such as transgenic cows and Aspergillus (L ⁇ nnerdal, 1996), transgenic rice provides a more attractive vehicle for the production of recombinant human AAT for food applications. High levels of expression are possible by using the combination of regulatory elements such as promotor, signal peptide, and terminator, and optionally, transciption factors, as disclosed herein.
  • regulatory elements such as promotor, signal peptide, and terminator, and optionally, transciption factors, as disclosed herein.
  • Lactadherin is a nonimmunological component in human milk that helps can protect breast-fed infants against infection by microorganisms.
  • One of the major protective glycoproteins is lactadherin. Protection against certain virus infections by human milk is associated with lactadherin. (Newburg, 1999, 1998; Peterson; Hamosh).
  • Immunoglobulins e.g., IgA
  • IgA Immunoglobulins.
  • Group 2 Acute-phase proteins
  • CRP C-reactive protein
  • SAA Serum amyloid A
  • Ferritin is a large (480 kD) intracellular iron storage protein which converts ferrous (Fe 2+ ) iron to the ferric (Fe 3+ ) state and sequesters up to 4500 iron atoms in the ferric state per molecule of ferritin. Hepatic ferritin content and serum ferritin concentrations increase rapidly after administration of interleukin-6 to rats. Kobune et al., Hepatology (1994); 19: 1468-1475. These effects of pro-inflammatory cytokines on ferritin synthesis are part of the hypoferremic response which occurs early in inflammation. Rogers, "Genetic regulation of the iron transport and storage genes: links with the acute phase response.” In Iron and Human Disease. Lauffer, editor. (1992); CRC Press, Boca Raton, pp. 77-104.
  • Haptoglobin is a hemoglobin-binding serum protein which plays a major role in the protection against heme-driven oxidative stress (Langlois M R and Delanghe J R (1996) Clin Chem 42: 1589-1600; Delanghe J R et al. (1998) AIDS 12: 1027-1032; Gutteridge J M. (1987) Biochim Biophys Acta 917: 219-223; Miller Y I et al. (1997) Biochem 36: 12189-12198; Vercellotti G M et al. (1994) Art Cell Blood Substit Imm Biotech 22: 207-213).
  • Seromucoids are glycoproteins derived from blood serum. Ceruloplasmin (Cp) is a copper-containing glycoprotein which plays an important rold in the metabolism of copper.
  • the ceruloplasmin level in serum of a patient suffering from Wilson's disease, or an infectious disease, or of a pregnant woman is different from that of a normal human, so that quantification of human ceruloplasmin may be used for the diagnosis of these diseases and pregnancy.
  • 15-keto-13,14-dihvdro-prostaqlandin F2 alpha is a prostanoid produced by the placental.
  • Prostanoids are a family of autacoids (formed from arachidonic acid) thought to play an important role during implantation, in the progress and maintenance of pregnancy, and during the initiation and progress of labor (Angle and Johnston, 1990).
  • Fibrinogen is a large protein molecule that normally circulates in the blood plasm in the dissolved state. Under attack from the enzyme thrombin, the fibrinogen molecules link up, spontaneously aligning themselves into a long thread like polymer or network called fibrin which is the primary ingredient of blood clots. Fibrinogen itself comprises 6 chains including two copies of an alpha, beta and gamma chain.
  • Alpha-1-acid glycoprotein is a human plasma glycoprotein which is produced by the liver.
  • AGP is an acute-phase reactant, i.e., the concentration of AGP in the blood increases following inflammation.
  • AGP synthesis increases several fold during an acute phase response (Baumann, H. et al. J. Biol. Chem. 256:10145-10155 (1981 ); Ricca, G. A. et al. J. Biol. Chem. 256:11199-11202 (1981 ); Koj, A. et al. Biochem J. 206:545-553 (1982); Koj, A. et al. Biochem J. 224:505-514 (1984)).
  • the major acute phase inducers of AGP synthesis are the cytokines interleukin-1 (IL-1 ) and interleukin-6 (IL-6), which act additively to induce transcription of the AGP gene.
  • IL-1 interleukin-1
  • IL-6 interleukin-6
  • Mannose binding protein is thought to play a role in the disposal of pathogenic organisms. MBP works both by opsonisizing pathogen, and by activating the complement cascade. MBP consists of several monomers that assemble into one larger multimer.
  • LBP Lipopolvsaccharide binding protein
  • Alpha-2 macroglobulin and various defensins Alpha-2 macroglobulin is a 718 kDa homotetrameric glycoprotein and is a well characterized as an extracellular proteinase inhibitor.
  • milk proteins lysozyme and lactoferrin are also included in this group.
  • antimicrobial peptides As many as 450 antimicrobial peptides have been found from amphibians, insects, mammals, plants, microorganisms and fishes. These antimicrobial peptides are known to be different in their sizes and amino acid sequences, but similar in their antimicrobial mechanism. Representative antimicrobial peptides include cecropin, magainin, bombinin, defensin, tachyplesin, and buforin. All of these are composed of 17-24 amino acids, showing antimicrobial activity against a broad spectrum of microorganisms, including Gram-negative bacteria, Gram-positive bacteria, protozoa and fungi. Some of these peptides are effective against both cancer cells and viruses.
  • magainin consisting of 23 amino acids, was isolated from the skin of an amphibian and is reported not only to defend against pathogenic bacteria, but to kill human lung cancer cells (Zasloff, M. (1987) Proc. Natl. Acad. Sci., U.S.A. 84, 5449-5453).
  • Antimicrobial peptides comprising six conserved cysteines form the defensin family.
  • This family is composed of antimicrobial peptides which are present in numerous species, which are abundant and which are about 3-4 kDa (Ganz and Lehrer, 1994). These peptides are formed of 30 to 40 amino acids, of which six invariant cysteines which form three intramolecular disulfide linkages. They have complex conformation, are amphipathic, rich in beta antiparallel sheets but lack alpha helices (Lehrer and Ganz, 1992). The antimicrobial action of defensins is thought to result from their insertion into the membranes of the target cells, allowing the formation of voltage- dependent channels. White et al.
  • Defensins have an antimicrobial action on a broad spectrum of microorganismes in vitro (Martin et al., 1995). This activity spectrum, which is particularly broad, comprises bacteria, Gram-positive and Gram-negative bacteria, several fungi, mycobacteria, parasites including spirochetes and several enveloped viruses including the HSV and HIV viruses. They are also cytotoxic for several categories of normal and malignant cells, including cells resistant to TNF-alpha and to the cytolytic NK factor (Kagan et al., 1994).
  • Indolicidin is a peptide that has been isolated from bovine neutrophils and has antimicrobial activity, including activity against viruses, bacteria, fungi and protozoan parasites. Subbalakshmi C et al., Biochem Biophys Res Commun, 2000, 274(3):714-6.
  • Cecropin is an antimicrobial peptide that is isolated from the silkworm. Choi et al., Comp Biochem Physiol C Toxicol Pharmacol, 2000,125:287-97.
  • Magainins are a group of short peptides originally isolated from frog skin and thought to function as a natural defense mechanism against infection due to their antimicrobial properties. Li et al., Planta, 2001 , 212:635-9.
  • Tachyplesin I is a membrane-permeabilizing antimicrobial peptide discovered from horseshoe crab hemolymph. Kobayashi S et al., Biochemistry, 2001 , 40:14330-5. Parasin I (Park et al., FEBS Lett, 1998, 437:258-62 amd U.S. Patent No. 6,316,594). Parasin I is a potent antimicrobial peptide which is secreted in response to an epidermal injury by Parasilurus asotus, a catfish.
  • Buforin I is a 39-residue antimicrobial peptide derived from the N-terminal of toad histone H2A [Kim et al. (1996) Biochem. Biophys. Res. Commun. 229, 381-387].
  • PMAP-23 (Park et al., Biochem Biophys Res Commun, 2002, 290:204-12).
  • PMAP-23 is a cathelicidin-derived antimicrobial peptide identified from porcine leukocytes.
  • PMAP-23 demonstrates potent antimicrobial activity against Gram-negative and Gram-positive bacteria without hemolytic activity. Moronecidin: Lauth. et al.. J Biol Chem. 2002, 277:5030-5039. Moronecidin is a
  • a predicted 79-residue moronecidin prepropeptide consists of three domains: a signal peptide (22 amino acids), a mature peptide (22 amino acids), and a C-terminal prodomain (35 amino acids).
  • the synthetic, amidated white bass moronecidin exhibited broad spectrum antimicrobial activity that was retained at high salt concentration.
  • the moronecidin gene consists of three introns and four exons. Peptide sequence and gene organization were similar to pleurocidin, an antimicrobial peptide from winter flounder. A TATA box and several consensus-binding motifs for transcription factors were found in the region 5[prime prime or minute] to the transcriptional start site.
  • moronecidin gene expression was detected in gill, skin, intestine, spleen, anterior kidney, and blood cells by kinetic reverse transcription (RT)- PCR.
  • RT kinetic reverse transcription
  • Anoplin Konno et al. Biochim Biophys Acta, 2001, 1550:70-80.
  • Anoplin is an antimicrobial peptide which was purified from the venom of the solitary wasp Anoplius samariensis.
  • Anoplin is composed of 10 amino acid residues, Gly-Leu-Leu-Lys-Arg-lle- Lys-Thr-Leu-Leu-NH2 and is the smallest among the linear alpha-helical antimicrobial peptides hitherto found in nature.
  • Anoplin is the first antimicrobial component to be found in the solitary wasp venom and it may play a key role in preventing potential infection by microorganisms during prey consumption by their larvae.
  • gambicin is induced by natural or experimental infection in the midgut, fatbody, and hemocyte-like cell lines. Within the midgut, gambicin is predominantly expressed in the anterior part. Both local and systemic gambicin expression is induced during early and late stages of natural malaria infection. In vitro experiments showed that the 6.8-kDa mature peptide can kill both Gram-positive and Gram-negative bacteria, has a morphogenic effect on a filamentous fungus, and is marginally lethal to Plasmodium berghei ookinetes.
  • AMP-29 Shin SY et al., Biochem Biophys Res Commun 2001 Jul 27;285(4): 1046-51.
  • AMP-29 is a cathelecidin-derived antimicrobial peptide deduced from sheep myeloid mRNA.
  • CAP37 Cationic antimicrobial protein of Mr 37 kDa (CAP37) is a neutrophil- derived inflammatory mediator on endothelial cell function.
  • Granulysin A mechanism by which T cells contribute to host defense against microbial pathogens is release of the antimicrobial protein granulysin. Ochoa et al., Nat Med, 2001 , 7:174-9.
  • SLPI Secretory leukocyte protease inhibitor
  • Calprotectin Squamous mucosal epithelial cells constitutively express calprotectin in the cytoplasm. Cells expressing calprotectin resist invasion by Listeria monocytogenes and Salmonella enterica serovar Typhimurium. Nisapakultorn K et al., Infect Immun, 2001 , 69:3692-6.
  • CAP18 Cationic antimicrobial protein (CAP18) is an 18 kDa antimicrobial protein.
  • Ubiquicidin is a cationic, small (Mr 6654) protein which displays marked antimicrobial activity against Listeria monocytogenes and Salmonella typhimuriumand activity against Escherichia coli, Staphylococcus aureus, and an avirulent strain of Yersinia enterocolitica. Hiemstra et al., J Leukoc Biol, 1999, 66:423-8.
  • BAMP-1 Bovine antimicrobial protein-1 (BAMP-1 ) is a 76 amino acid residue antimicrobial protein which has been isolated from fetal calf serum.
  • BAMP-1 showed a weak growth-inhibitory activity against Escherichia coli and yeasts tested in phosphate- buffered saline (PBS).: J Biochem (Tokyo) 1998 Apr;123(4):675-9.
  • Ace-AMP1 is an antifungal protein extracted from onion seeds. This cationic protein contains 93 amino acid residues and four disulfide bridges. Tassin et al., Biochemistry, 1998, 37:3623-37.
  • Ac-AMP2 is a lectin-like small protein with antimicrobial and antifungal activity isolated from Amaranthus caudatus. Verheyden et al., FEBS Lett, 1995, 370:245-9.
  • Ah-AMP1 (Fant et al., Proteins, 1999, 37:388-403).
  • Aesculus hippocastanum antimicrobial protein 1 (Ah-AMP1 ) is a plant defensin isolated from horse chestnuts. The plant defensins have been divided in several subfamilies according to their amino acid sequence homology.
  • Ah-AMP1 is a member of subfamily A2 and inhibits growth of a broad range of fungi.
  • CAP18 (Cationic antimicrobial protein of 18 kDa) is an antimicrobial protein found in human and rabbit granulocytes.
  • Expression vectors for use in the present invention are chimeric nucleic acid constructs (or expression vectors or cassettes), designed for operation in plants, with associated upstream and downstream sequences.
  • expression vectors for use in practicing the invention include the following operably linked components that constitute a chimeric gene: (i) a transcriptional regulatory region from a monocot gene having a seed maturation-specific promoter, (ii) operably linked to said transcriptional regulatory region, a leader DNA sequence encoding a monocot seed-specific transit sequence capable of targeting a linked polypeptide to an endosperm-cell organelle, such as the leader sequence for targeting to a protein-storage body, and (iii) a protein-coding sequence encoding an anti-microbial protein
  • the chimeric gene is typically placed in a suitable plant-transformation vector having (i) companion sequences upstream and/or downstream of the chimeric gene which are of plasmid or viral origin and provide necessary characteristics to the vector to permit the vector to move DNA from bacteria to the desired plant host; (ii) a selectable marker sequence; and (iii) a transcriptional termination region generally at the opposite end of the vector from the transcription initiation regulatory region.
  • suitable plant-transformation vector having (i) companion sequences upstream and/or downstream of the chimeric gene which are of plasmid or viral origin and provide necessary characteristics to the vector to permit the vector to move DNA from bacteria to the desired plant host; (ii) a selectable marker sequence; and (iii) a transcriptional termination region generally at the opposite end of the vector from the transcription initiation regulatory region.
  • the expression construct includes a transcription regulatory region (promoter) which exhibits specifically upregulated activity during seed maturation.
  • promoters include the maturation-specific promoter region associated with one of the following maturation-specific monocot storage proteins: rice glutelins, oryzins, and prolamines, barley hordeins, wheat gliadins and glutenins, maize zeins and glutelins, oat glutelins, and sorghum kafirins, millet pennisetins, and rye secalins.
  • Exemplary regulatory regions from these genes are exemplified by SEQ ID NOS: 18-24, as identified below.
  • nucleic acid encoding an antimicrobial protein from a transcription initiation region that is preferentially expressed in plant seed tissue.
  • seed preferential transcription initiation sequences include those sequences derived from sequences encoding plant storage protein genes or from genes involved in fatty acid biosynthesis in oilseeds.
  • Exemplary preferred promoters include a glutelin (Gt-1 ) promoter, as exemplified by SEQ ID NO: 18, which effects gene expression in the outer layer of the endosperm and a globulin (Gib) promoter, as exemplfied by SEQ ID NO: 19, which effects gene expression in the center of the endosperm.
  • Promoter sequences for regulating transcription of gene coding sequences operably linked thereto include naturally-occurring promoters, or regions thereof capable of directing seed-specific transcription, and hybrid promoters, which combine elements of more than one promoter. Methods for construction such hybrid promoters are well known in the art.
  • the promoter is derived from the same plant species as the plant cells into which the chimeric nucleic acid construct is to be introduced. Promoters for use in the invention are typically derived from cereals such as rice, barley, wheat, oat, rye, corn, millet, triticale or sorghum.
  • a seed-specific promoter from one type of monocot may be used regulate transcription of a nucleic acid coding sequence from a different monocot or a non-cereal monocot.
  • the transcription regulatory or promoter region is chosen to be regulated in a manner allowing for induction under seed-maturation conditions.
  • promoters include those associated with the following monocot storage proteins: rice glutelins, oryzins, and prolamines, barley hordeins, wheat gliadins and glutelins, maize zeins and glutelins, oat glutelins, and sorghum kafirins, millet pennisetins, and rye secalins.
  • Exemplary promoter sequences are identified herein as SEQ ID NOS: 18-24.
  • promoters suitable for expression in maturing seeds include the barley endosperm-specific B1- hordein promoter (Brandt, A., et al., (1985), Glub-2 promoter, Bx7 promoter, Gt3 promoter, Glub-1 promoter and Rp-6 promoter, particularly if these promoters are used in conjunction with transcription factors.
  • B1 hordein gene from barleyis provided in Carlsberg Res. Commun. 50, 333-345).
  • the expression cassette or heterologous nucleic acid construct may encode a signal/targeting/transport peptide that allows processing and translocation of the protein, as appropriate.
  • exemplary signal/targeting/transport sequences particularly for targeting proteins to intracellular bodies, such as vacuoles, are signal/targeting sequences associated with the monocot maturation-specific genes: glutelins, prolamines, hordeins, gliadins, glutenins, zeins, albumin, globulin, ADP glucose pyrophosphorylase, starch synthase, branching enzyme, Em, and lea.
  • Exemplary sequences encoding a leader sequence for protein storage body are identified herein as SEQ ID NOS: 24-30.
  • the method is directed toward the localization of recombinant milk protein expression in a given subcellular compartment, in particular a protein-storage body, but also including the mitochondrion, endoplasmic reticulum, vacuoles, chloroplast or other plastidic compartment.
  • a given subcellular compartment in particular a protein-storage body, but also including the mitochondrion, endoplasmic reticulum, vacuoles, chloroplast or other plastidic compartment.
  • plastids such as chloroplasts
  • sequences are referred to herein as chloroplast transit peptides (CTP) or plastid transit peptides (PTP).
  • the expression construct when the gene of interest is not directly inserted into the plastid, the expression construct additionally contains a gene encoding a transit peptide to direct the gene of interest to the plastid.
  • the chloroplast transit peptides may be derived from the gene of interest, or may be derived from a heterologous sequence having a CTP.
  • Such transit peptides are known in the art. See, for example, Von Heijne et. al., 1991 ; Clark et al., 1989; della-Cioppa et al., 1987; Romer et al., 1993; and Shah et al., 1986.
  • signal/targeting/transport sequences are sequences effective to promote secretion of heterologous protein from aleurone cells during seed germination, including the signal sequences associated with ⁇ -amylase, protease, carboxypeptidase, endoprotease, ribonuclease, DNase/RNase, (1-3)- ⁇ -glucanase, (1- 3)(1-4)- ⁇ -glucanase, esterase, acid phosphatase, pentosamine, endoxylanase, ⁇ - xylopyranosidase, arabinofuranosidase, ⁇ -glucosidase, (1-6)- ⁇ -glucanase, perioxidase, and lysophospholipase.
  • the promoter and leader sequence can be isolated from a single protein-storage gene, then operably linked to a milk-protein storage protein in the chimeric gene construction.
  • One preferred and exemplary promoter-leader sequence is form the rice Gt1 gene, having an exemplary sequence identifed by SEQ ID NO:15.
  • the promoter and leader sequence may eb derived from different genes.
  • One preferred and exemplary promoter/leader sequence combination is the rice Gib promoter linked to the rice Gt1 leader sequence, as exemplified by SEQ ID NO: 16.
  • the construct also includes the nucleic acid coding sequence for a heterologous protein, under the control of a promoter, preferably a seed-specific promoter.
  • a heterologous anti-microbial protein such as lysozyme or lactoferrin
  • polynucleotide sequences which encode a heterologous anti-microbial protein include splice variants, fragments of such proteins, fusion proteins, modified forms or functional equivalents thereof, collectively referred to herein as "anti-microbial protein-encoding nucleic acid sequences”.
  • anti-microbial protein-encoding nucleic acid sequences may be used in recombinant expression vectors (also termed heterologous nucleic acid constructs), that direct the expression of an anti-microbial protein in appropriate host cells.
  • nucleic acid sequences which encode substantially the same or a functionally equivalent amino acid sequence may be generated and used to clone and express a given anti-microbial protein, as exemplified herein by the codon optimized coding sequences used to practice the invention (further described below).
  • the triplet CGT encodes the amino acid arginine.
  • Arginine is alternatively encoded by CGA, CGC, CGG, AGA, and AGG. Therefore such substitutions in the coding region fall within the range of sequence variants covered by the present invention. Any and all of these sequence variants can be utilized in the same way as described herein for a "reference" anti-microbial- encoding nucleic acid sequence.
  • a "variant" anti-microbial protein-encoding nucleic acid sequence may encode a "variant” human anti-microbial amino acid sequence which is altered by one or more amino acids from the native anti-microbial protein sequence, both of which are included within the scope of the invention.
  • the term "modified form of, relative to a given anti-microbial protein means a derivative or variant form of an anti-microbial protein or the coding sequence therefor. That is, a "modified form of a anti-microbial protein has a derivative sequence containing at least one nucleic acid or amino acid substitution, deletion or insertion.
  • nucleic acid or amino acid substitution, insertion or deletion may occur at any residue within the sequence, as long as the encoded amino acid sequence maintains the biological activity of the native anti-microbial protein, e.g., the bactericidal effect of lysozyme.
  • a "variant" anti-microbial protein-encoding nucleic acid sequence may encode a "variant” anti-microbial protein sequence which contains amino acid insertions or deletions, or both. Furthermore, a variant anti-microbial protein coding sequence may encode the same polypeptide as the reference polynucleotide or native sequence but, due to the degeneracy of the genetic code, has a nucleic acid coding sequence which is altered by one or more bases from the reference or native polynucleotide sequence.
  • the variant nucleic acid coding sequence may encode a variant amino acid sequence which contains a "conservative" substitution, wherein the substituted amino acid has structural or chemical properties similar to the amino acid which it replaces and physicochemical amino acid side chain properties and high substitution frequencies in homologous proteins found in nature (as determined, e.g., by a standard Dayhoff frequency exchange matrix or BLOSUM matrix).
  • the variant nucleic acid coding sequence may encode a variant amino acid sequence which contains a "non-conservative" substitution, wherein the substituted amino acid has dissimilar structural or chemical properties to the amino acid which it replaces.
  • Standard substitution classes include six classes of amino acids based on common side chain properties and highest frequency of substitution in homologous proteins in nature, as is generally known to those of skill in the art and may be employed to develop variant anti-microbial protein-encoding nucleic acid sequences.
  • a "variant" anti-microbial protein-encoding nucleic acid sequence may encode a "variant” antimicrobial protein sequence which contains a combination of any two or three of amino acid insertions, deletions, or substitution.
  • Anti-microbial protein-encoding nucleotide sequences also include "allelic variants" defined as an alternate form of a polynucleotide sequence which may have a substitution, deletion or addition of one or more nucleotides, which does not substantially alter the function of the encoded polypeptide.
  • the polynucleotides for use in practicing the invention include sequences which encode anti-microbial proteins and splice variants thereof, sequences complementary to the protein coding sequence, and novel fragments of the polynucleotide.
  • the polynucleotides may be in the form of RNA or in the form of DNA, and include messenger RNA, synthetic RNA and DNA, cDNA, and genomic DNA.
  • the DNA may be double-stranded or single-stranded, and if single-stranded may be the coding strand or the non-coding (anti-sense, complementary) strand.
  • Codons preferred by a particular eukaryotic host can be selected, for example, to increase the rate of heterologous protein expression or to produce recombinant RNA transcripts having desirable properties, such as a longer half-life, than transcripts produced from naturally occurring sequence. Codon-optimized sequences for use in practicing the invention are further described below.
  • An anti-microbial protein-encoding nucleotide sequence may be engineered in order to alter the protein coding sequence for a variety of reasons, including but not limited to, alterations which modify the cloning, processing and/or expression of the protein by maturing seeds.
  • Heterologous nucleic acid constructs may include the coding sequence for a given anti-microbial protein, a variant, fragment or splice variant thereof: (i) in isolation; (ii) in combination with additional coding sequences; such as fusion protein or signal peptide, in which the anti-microbial protein coding sequence is the dominant coding sequence; (iii) in combination with non-coding sequences, such as introns and control elements, such as promoter and terminator elements or 5' and/or 3' untranslated regions, effective for expression of the coding sequence in a suitable host; and/or (iv) in a vector or host environment in which the anti-microbial protein coding sequence is a heterologous gene.
  • an expression construct may contain the nucleic acid sequence which encodes the entire anti-microbial protein, or a portion thereof.
  • an expression construct may contain the nucleic acid sequence which encodes the entire anti-microbial protein, or a portion thereof.
  • anti-microbial protein sequences are used in constructs for use as a probe, it may be advantageous to prepare constructs containing only a particular portion of the anti-microbial protein encoding sequence, for example a sequence which is discovered to encode a highly conserved anti-microbial protein region.
  • Codon-optimized coding sequences for human milk anti-microbial proteins are identified herein by SEQ ID NOS; 1, 3, and 7-14.
  • An expression vector used to practice the invention has at least 70%, preferably 80%, 85%, 90% or 95% or more sequence identity to the codon-optimized sequences.
  • Coding sequences for exemplary non-human acute-phase proteins are identified herein by SEQ ID NOS: 36, and 46-56.
  • An expression vector used to practice the invention has at least 70%, preferably 80%, 85%, 90% or 95% or more sequence identity to the identified sequences.
  • Coding sequences for exemplary anti-microbial peptides are identified herein by
  • SEQ ID NOS: 34-68, 40-41 , and 43 SEQ ID NOS: 34-68, 40-41 , and 43.
  • An expression vector used to practice the invention has at least 70%, preferably 80%, 85%, 90% or 95% or more sequence identity to the identified sequences. codon-optimized sequence.
  • Coding sequences for other anti-microbial proteins are identified herein by SEQ ID NO: 1
  • An expression vector used to practice the invention has at least 70%, preferably 80%, 85%, 90% or 95% or more sequence identity to the identified sequences. Additional codon sequences for anti-microbuial proteins are available from public gene databases, such as GENBANK, accessible through "www.ncbi.nlm.gov/GENBANK/".
  • the coding sequence was codon optimized. The G + C content was thus increased from 46% to 68%.
  • the codon optimized lysozyme coding sequence for use in practicing the invention is presented as SEQ ID NO:1.
  • the native hLF coding sequence was codon optimized. Out of 693 codons used in the lactoferrin gene, 413 codons were changed by one or two nucleotides. The amino acid sequence of LF was unchanged.
  • the codon optimized lactoferrin coding sequence for use in practicing the invention is presented as SEQ ID NO:3.
  • Codon optimized sequences for other human milk proteins are given as follows: for lactoferricin, SEQ ID NO: 7; for EGF, SEQ ID NO: 8; for IGF-1 , SEQ ID NO: 9; for lactohedrin, SEQ ID NO: 10; for kappa-casein, SEQ ID NO: 11 ; for haptocorrin, SEQ ID NO: 12; for lactoperoxidase, SEQ ID NO: 13; for and for alpha-1-antitrypsin, SEQ ID NO: 14.
  • the transgenic plant is also transformed with the coding sequence of one or more transcription factors capable of stimulating the expression of a maturation-specific promoter.
  • the embodiment involves the use of the maize Opaque 2 (02) and prolamin box binding factor (PBF) together with the rice endosperm bZip (Reb) protein as transcriptional activators of monocot storage protein genes.
  • PPF prolamin box binding factor
  • Reb rice endosperm bZip
  • Exemplary sequence for these three transcription factors are given identified below as SEQ ID NOS: 31-33. Transcription factor sequences and constructs applicable to the present invention are detailed in co-owned PCT application No. PCT/US01/14234, International Publication number WO 01/83792 A1 , published November 8, 2001 , which is incorporated herein by reference.
  • Transcription factors are capable of sequence-specific interaction with a gene sequence or gene regulatory sequence.
  • the interaction may be direct sequence- specific binding in that the transcription factor directly contacts the gene or gene regulatory sequence or indirect sequence-specific binding mediated by interaction of the transcription factor with other proteins.
  • the binding and/or effect of a transcription factor is influenced (in an additive, synergistic or inhibitory manner) by another transcription factor.
  • the gene or gene regulatory region and transcription factor may be derived from the same type (e.g., species or genus) of plant or a different type of plant.
  • the binding of a transcription factor to a gene sequence or gene regulatory sequence may be evaluated by a number of assays routinely employed by those of skill in the art, for example, sequence-specific binding may be evaluated directly using a label or through gel shift analysis.
  • the transcription factor gene is introduced into the plant in a chimeric gene containing a suitable promoter, preferably a maturation-specific seed promoter operably linked to the transcription factor gene. Plants may be stably transformed with a chimeric gene containing the transcription factor by methods similar to those described with respect to the milk-protein gene(s).
  • Plants stably transformed with both exogeneous trancription factor(s) and milk-protein genes may be prepared by co-transforming plant cells or tissue with both gene constructs, selecting plant cells or tissue that have been co-transformed, and regenerating the transformed cells or tissue into plants. Alternativiely, different plants may be spearately transformed with exogeneous transcription factor genes and milk-protein genes, then crossed to produce plant hybrids containing by added genes.
  • Expression vectors or heterologous nucleic acid constructs designed for operation in plants comprise companion sequences upstream and downstream to the expression cassette.
  • the companion sequences are of plasmid or viral origin and provide necessary characteristics to the vector to permit the vector to move DNA from bacteria to the plant host, such as, sequences containing an origin of replication and a selectable marker.
  • Typical secondary hosts include bacteria and yeast.
  • the secondary host is E. coli
  • the origin of replication is a colE1-type
  • the selectable marker is a gene encoding ampicillin resistance.
  • sequences are well known in the art and are commercially available as well (e.g., Clontech, Palo Alto, Calif.; Stratagene, La Jolla, CA).
  • the transcription termination region may be taken from a gene where it is normally associated with the transcriptional initiation region or may be taken from a different gene.
  • exemplary transcriptional termination regions include the NOS terminator from Agrobactenum Ti plasmid and the rice ⁇ -amylase terminator.
  • Polyadenylation tails may also be added to the expression cassette to optimize high levels of transcription and proper transcription termination, respectively.
  • Polyadenylation sequences include, but are not limited to, the Agrobactenum octopine synthetase signal, Gielen, et al., 1984 or the nopaline synthase of the same species, Depicker, et al., 1982.
  • Suitable selectable markers for selection in plant cells include, but are not limited to, antibiotic resistance genes, such as, kanamycin (npt ⁇ ), G418, bleomycin, hygromycin, chloramphenicol, ampicillin, tetracycline, and the like. Additional selectable markers include a bar gene which codes for bialaphos resistance; a mutant EPSP synthase gene which encodes glyphosate resistance; a nitrilase gene which confers resistance to bromoxynil; a mutant acetolactate synthase gene (ALS) which confers imidazolinone or sulphonylurea resistance; and a methotrexate resistant DHFR gene.
  • antibiotic resistance genes such as, kanamycin (npt ⁇ ), G418, bleomycin, hygromycin, chloramphenicol, ampicillin, tetracycline, and the like.
  • Additional selectable markers include a bar gene which codes for bialaphos resistance; a mutant EP
  • the particular marker gene employed is one which allows for selection of transformed cells as compared to cells lacking the DNA which has been introduced.
  • the selectable marker gene is one which facilitates selection at the tissue culture stage, e.g., a kanamyacin, hygromycin or ampicillin resistance gene.
  • the vectors of the present invention may also be modified to include intermediate plant transformation plasmids that contain a region of homology to an Agrobactenum tumefaciens vector, a T-DNA border region from Agrobactenum tumefaciens, and chimeric genes or expression cassettes (described above). Further, the vectors of the invention may comprise a disarmed plant tumor inducing plasmid of Agrobactenum tumefaciens.
  • a selected nucleic acid sequence is inserted into an appropriate restriction endonuclease site or sites in the vector.
  • Standard methods for cutting, ligating and E. coli transformation known to those of skill in the art, are used in constructing vectors for use in the present invention.
  • Plant cells or tissues are transformed with expression constructs (heterologous nucleic acid constructs, e.g., plasmid DNA into which the gene of interest has been inserted) using a variety of standard techniques. Effective introduction of vectors in order to facilitate enhanced plant gene expression is an important aspect of the invention. It is preferred that the vector sequences be stably integrated into the host genome.
  • the method used for transformation of host plant cells is not critical to the present invention.
  • the transformation of the plant is preferably permanent, i.e. by integration of the introduced expression constructs into the host plant genome, so that the introduced constructs are passed onto successive plant generations.
  • the skilled artisan will recognize that a wide variety of transformation techniques exist in the art, and new techniques are continually becoming available.
  • the constructs can be introduced in a variety of forms including, but not limited to, as a strand of DNA, in a plasmid, or in an artificial chromosome.
  • the introduction of the constructs into the target plant cells can be accomplished by a variety of techniques, including, but not limited to calcium- phosphate-DNA co-precipitation, electroporation, microinjection, Agrobacterium- mediated transformation, liposome-mediated transformation, protoplast fusion or microprojectile bombardment.
  • the skilled artisan can refer to the literature for details and select suitable techniques for use in the methods of the present invention. Exemplary methods for plant transformation are given in Example 2.
  • a vector is introduced into the Agrobactenum host for homologous recombination with T-DNA or the Ti- or Ri- plasmid present in the Agrobactenum host.
  • the Ti- or Ri-plasmid containing the T-DNA for recombination may be armed (capable of causing gall formation) or disarmed (incapable of causing gall formation), the latter being permissible, so long as the vir genes are present in the transformed Agrobactenum host.
  • the armed plasmid can give a mixture of normal plant cells and gall.
  • the expression or transcription construct bordered by the T-DNA border region(s) is inserted into a broad host range vector capable of replication in E. coli and Agrobactenum, examples of which are described in the literature, for example pRK2 or derivatives thereof. See, for example, Ditta et al., 1980 and EPA 0 120 515, expressly incorporated by reference herein.
  • a vector containing separate replication sequences one of which stabilizes the vector in E.
  • coli and the other in Agrobactenum See, for example, McBride et al., 1990, wherein the pRiHRI (Jouanin, et al., 1985, origin of replication is utilized and provides for added stability of the plant expression vectors in host Agrobactenum cells.
  • Included with the expression construct and the T-DNA is one or more selectable marker coding sequences which allow for selection of transformed Agrobacterium and transformed plant cells.
  • selectable marker coding sequences which allow for selection of transformed Agrobacterium and transformed plant cells.
  • a number of markers have been developed for use with plant cells, such as resistance to chloramphenicol, kanamycin, the aminoglycoside G418, hygromycin, or the like.
  • the particular marker employed is not essential to this invention, with a particular marker preferred depending on the particular host and the manner of construction.
  • explants are incubated with Agrobacterium for a time sufficient to result in infection , the bacteria killed, and the plant cells cultured in an appropriate selection medium. Once callus forms, shoot formation can be encouraged by employing the appropriate plant hormones in accordance with known methods and the shoots transferred to rooting medium for regeneration of plants. The plants may then be grown to seed and the seed used to establish repetitive generations and for isolation of the recombinant protein produced by the plants. There are a number of possible ways to obtain plant cells containing more than one expression construct.
  • plant cells are co-transformed with a first and second construct by inclusion of both expression constructs in a single transformation vector or by using separate vectors, one of which expresses desired genes.
  • the second construct can be introduced into a plant that has already been transformed with the first expression construct, or alternatively, transformed plants, one having the first construct and one having the second construct, can be crossed to bring the constructs together in the same plant.
  • Host cells of the present invention include plant cells, both monocotyledenous and dicotyledenous.
  • the plants used in the methods of the present invention are derived from monocots, particularly the members of the taxonomic family known as the Gramineae. This includes all members of the grass family of which the edible varieties are known as cereals.
  • the cereals include a wide variety of species such as wheat (Triticum sps.), rice (Oryza sps.) barley (Hordeum sps.) oats, (Avena sps.) rye (Secale sps.), corn (maize) (Zea sps.) and millet (Pennisettum sps.).
  • preferred grains are rice, wheat, maize, barley, rye, triticale.
  • dicots exemplified by soybean (Glycine spp.)
  • transgenic plants that express anti-microbial protein
  • monocot plant cells or tissues derived from them are transformed with an expression vector comprising the coding sequence for a anti-microbial protein.
  • Transgenic plant cells obtained as a result of such transformation express the coding sequence for a anti- microbial protein, such as lysozyme or lactoferrin.
  • the transgenic plant cells are cultured in medium containing the appropriate selection agent to identify and select for plant cells which express the heterologous nucleic acid sequence. After plant cells that express the heterologous nucleic acid sequence are selected, whole plants are regenerated from the selected transgenic plant cells. Techniques for regenerating whole plants from transformed plant cells are generally known in the art.
  • Transgenic plant lines e.g., rice, wheat, corn or barely, can be developed and genetic crosses carried out using conventional plant breeding techniques.
  • Transformed plant cells are screened for the ability to be cultured in selective media having a threshold concentration of a selective agent. Plant cells that grow on or in the selective media are typically transferred to a fresh supply of the same media and cultured again. The explants are then cultured under regeneration conditions to produce regenerated plant shoots. After shoots form, the shoots are transferred to a selective rooting medium to provide a complete plantlet. The plantlet may then be grown to provide seed, cuttings, or the like for propagating the transformed plants.
  • the method provides for efficient transformation of plant cells with expression of a gene of autologous or heterologous origin and regeneration of transgenic plants, which can produce a recombinant anti-microbial protein.
  • the expression of the recombinant anti-microbial protein may be confirmed using standard analytical techniques such as Western blot, ELISA, PCR, HPLC, NMR, or mass spectroscopy, together with assays for a biological activity specific to the particular protein being expressed.
  • Example 3 describes the characterization of human lysozyme produced in the seeds of transgenic rice plants. Analyses used to confirm that recombinant lysozyme produced in transgenic rice is essentially the same as the native form of the protein both in physical characteristics and biological activity included, SDS-PAGE, reverse IEF gel electrophoresis, Western blot analysis, enzyme linked immunosorbant assay (ELISA), enzymatic activity assay and bactericidal activity assay using indicator strains, Micrococcus luteus and E.coli strain JM109.
  • ELISA enzyme linked immunosorbant assay
  • Example 4 describes the characterization of human lactoferrin produced in the seeds of transgenic rice plants. Analyses used to confirm that recombinant lactoferrin produced in transgenic rice is essentially the same as the native form of the protein both in physical characteristics and biological activity included, Southern blot, Western blot, ELISA, N-Terminal Amino Acid Sequencing, analysis of glycosylation and determination of sugar content, a determination of the isoelectric point, pH dependent iron release of rLF, bacteriostatic activity assay of rLF using enteropathogenic E. coli as the indicator strain.
  • the invention provides, in one aspect, an improved feed containing a flour, extract, or malt seed composition obtained from mature monocot seeds and one or more seed-produced anti-microbial proteins in substantially unpurified form.
  • exemplary anti- microbial proteins are lysozyme and lactoferrin, where lysozyme is preferably present in an amount between about 0.05 and 0.5 grams protein/kg feed, and lactoferrin, in an amount between 0.2 to 2 grams/protein/kg feed.
  • the feed to which the seed composition is added may be any standard feed suitable for a given production animals, e.g., chickens or cattle, and typically includes plant-produced composnents, such as grains or grain flour from corn, rice, barley and/or wheat.
  • Example 7 Exemplary feed for chickens is given in Example 7.
  • the animal feed to which the seed composition is added contains little or no small-molecule antibiotic(s), i.e., antibiotic levels that are themselves ineffective to optimize weight gain in the production animal.
  • the amount of seed composition to be added to the feed one first determines the approximate desired weight percent or concentration of the given antimicrobial protein or proteins in the final feed material.
  • the amount of protein anti-microbial protein effective for optimal weight gain in production animals will be in the range 0.05 to 5 mg protein/ gram dry weight of feed, e.g., between about 0.005 to 0.5 weight percent of the anti-microbial protein. Effective levels can be determined, for example, by feed studies of the type reported in Example 7, where increasing amounts of anti-microbial protein, in the range indicated above, are added to feed, and weight gain and intestinal characteristics determined after several days-weeks of feeding.
  • the amount of seed composition added to the feed will, of course, depend on the concentration of the anti-microbial protein in the seed composition, and this concentration can be readily determined by standard protein assay methods, as described in Examples 3 and 4 below.
  • concentration of the anti-microbial protein in the seed composition the concentration of the anti-microbial protein in the seed composition, and this concentration can be readily determined by standard protein assay methods, as described in Examples 3 and 4 below.
  • the level of heterologous protein present will be roughly that produced in seeds, e.g., between 0.1 to 1 % of total seed weight.
  • the final amount of grain composition added to the feed may be in the range 1-30%, depending on the final required level of anti-microbial protein.
  • the heterologous protein may be concentrated to form up to 5-40% or more of the total extract weight, so a much smaller percentage of extract composition will be required to achieve the desired level of anti-microbial protein, for example, between 0.1 to 10% by weight, typically, 1 -5% of the total feed weight.
  • a malt concentration which will contain a significant percent of malt sugars, in addition to native and heterologous proteins, will typically contain an amount of anti-microbial protein that is intermediate between that of grain and the extract, and the amount added to feed will, accordingly, typically fall within the ranges of the other two compositions.
  • lysozyme between about 0.05 and 0.5 grams protein/kg feed, and lactoferrin, in an amount between 0.2 to 2 grams/protein/kg feed.
  • a seed composition is found to contain 10g/kg lysozyme, about 20 grams of the composition would be added to make up a liter of formula with a final lysozyme concentration of about 0.2 g/liter.
  • the flour composition is prepared by milling mature monocot plant seeds, using standard milling and, optionally, flour purification methods, e.g., in preparing refined flour. Briefly, mature seeds are dehusked, and the dehusked seeds then ground into a fine flour by conventional milling equipment.
  • the flour may be added to feed in powdered, particulate, or liquid form, in an amount typically between 1 to 30% or more of the dry weight of the feed, depending on the desired final amount of anti-microbial protein needed, as described above.
  • One exemplary flour composition includes at least lactoferrin and/or lysozyme, where lysozyme is preferably present in an amount between about 0.05 and 0.5 grams protein/kg feed, and lactoferrin, in an amount between 0.2 to 2 grams/protein/kg feed, in addition to other anti-microbial proteins.
  • Flour containing two or more anti-microbial proteins may be prepared by combining flour from seeds that separately produce the different proteins, for example, equal amounts of a flour containing lysozyme and a flour containing lactoferrin.
  • a multi-protein composition can be prepared as seed flour from plants monocot plants co-transformed with chimeric genes expressing different milk proteins, e.g., lactoferrin and lysozyme.
  • This composition is prepared by milling flour to form a flour, extracting the flour with am aqueous buffered solution, and optionally, further treating the water-soluble extract to partially concentrate the extract and/or remove unwanted components. Details of exemplary methods for producing the extract composition are given in Example 6. Briefly, rhature monocot seeds, such as rice seeds, are milled to a flour, and the flour then suspended in a buffered solution. The flour suspension is incubated with shaking for a period typically between 30 minutes and 4 hours, at a temperature between 20- 55°C. The resulting homogenate is clarified either by filtration or centrifugation.
  • the clarified filtrate or supernatant may be further processed, for example by untrafiltration or dialysis or both to remove contaminants such as lipids, sugars and salt. Finally, the material may dried, e.g., by lyophilization, to form a dry cake or powder.
  • aqueous media are suitable for the extraction buffer, including phosphate buffered saline (PBS) and ammonium bicarbonate, as demonstrated in Example 6. Volatile buffers like ammonium bicarbonate, in which the salt components of the buffer are volatilized on drying, may obviate an additional salt removal step, and thus offer a significant processing advantage.
  • the extract combines advantages of high protein yields, essentially limiting losses associated with protein purification.
  • the anti-microbial proteins are in a form readily usable and available upon ingestion of the animal feed.
  • One feature for use in a feed product is the low amount of seed starch present in the extract.
  • the extract may increase the concentration of recombinant protein from about 0.5% in conventional approaches to over about 25% in the extract approach. Some extract approach even reached 40% depending on the expression level of recombinant protein.
  • the extract approach removes starch granules, which require high gelling temperature, for example above about 75°C. Consequently, the extract approach provides more flexibility in processing the rice grain and the recombinant proteins into feed.
  • the amount of anti-microbial protein present may be in the range 70-95% of the extract.
  • the extract can be formulated and added to animal feed in powdered, or dry particleized or tabletized or powder form, In one embodiment, the extract is added to feed in an amount between about 0.5 to 10% by weight, preferably 1-5% by dry weight of the feed.
  • An exemplary feed contains both lactoferrin and lysozyme, where lysozyme is preferably present in an amount between about 0.05 and 0.5 grams protein/kg feed, and lactoferrin, in an amount between 0.2 to 2 grams/protein/kg feed.
  • the extract may alternatively, or in addition, include one or more of the other anti-microbial proteins noted above.
  • extract containing two or more milk proteins may be prepared by combining extracts from seeds that separately produce the different proteins, or by processing seeds from plants co-transformed with chimeric genes expressing different milk proteins, e.g., lactoferrin and lysozyme.
  • the invention provides a malt extract or malt syrup ("malt") in which seed starches have been largely reduced to malt sugars, and the anti-microbial protein(s) are in an active, bioavailable form.
  • malt a malt extract or malt syrup
  • a variety of feed products can be produced, depending on the type of malt used, the mashing program and the ways in which the wort is subsequently handled. If materials other than barley malt are used in the mash (such as starch from other grains), the resulting product is referred to herein as a sweetened malt.
  • Malt extracts which may have a syrupy consistency or may be powders, are made by mashing ground malt, usually barley malt, in conventional brewery equipment, collecting the wort and concentrating it or drying it. Modern production of food malt extracts and malt syrups has evolved into three basic grain stages: steeping, germination, and drying of the germinated seed, followed by three more steps involving liquefaction of the germinated grain, mashing of the germinated grain, lautering (filtering), and evaporation. Many variations of malt extracts or syrups are possible. Flavor, color, solids, enzymatic activity, and protein are the basic characteristics that can be adjusted during production to provide malts specific for given food applications. (See, generally, Eley; Hickenbottom, 1996, 1997a, 1997b, 1983; Lake; Moore; Moe; Sfat; Doncheck; Briggs, 1981 , 1998; and Hough). C1. Steeping
  • the steeped barley is moved to germination floors or rooms depending on the particular malt house's capabilities and allowed to germinate under controlled temperature, air, and moisture conditions.
  • Total germination varies from four to seven days, depending on the barley type, density end use of the malt, and the controls or germination method used. All aspects of germination must be kept in constant balance to ensure proper kernel modification and yield.
  • Drying or kilning when done at the proper time and optimum degree of starch modification, stops the germination.
  • the heat also catalyzes additional reactions, notably flavor and color development.
  • the heating step is carried out at conventional kilning time and temperature conditions well known to those in the field.
  • malted barley (kernel) is coarsely ground in crushers and fed into mash tuns where it is mixed with water. During a series of time and temperature changes, some of the starch is converted into fermentable sugars by action of the natural alpha- and beta- amylases, better known as the diastatic system. If cereal adjuncts are to be added, which result in malt syrups with mellower and sweeter flavors than the extracts, they are added at this stage usually derived from the cereal grains, corn and rice, although barley, wheat, rye, millet and sorghum are sometimes used, derived from mature seeds that produce the desired recombinant milk proteins.
  • the mash batch Once the mash batch has achieved the correct degree of hydrolysis, it is transferred to lauter tuns.
  • the lauter tun has a slotted or false bottom a few inches above the real bottom to allow for filtration and is also equipped with some means of agitation.
  • the amylytic enzymes liquefy additional insoluble starches, converting them to maltose and dextrins.
  • the proteolytic enzymes attach certain proteins converting them into simpler, soluble forms.
  • the liquid phase, or wort is drawn from the lauter tuns into evaporators.
  • Evaporation of the wort is conducted under vacuum where it is converted into a syrup of about 80% solids.
  • malt extracts or syrups of high, medium, or zero enzymatic activity can be produced.
  • Color and flavor also can be controlled during this stage.
  • the finishing steps of filtering, cooling, and packaging complete the malt extract/syrup process.
  • the starting barley is a transgenic barley engineered to produce on or more anti-microbial proteins in the endosperm either in grain maturation or in the malting process, or at both times. Malting and processing times and conditions are adjusted so that the bioactivity of the target recombinant molecules is preserved and the bioavailability of the target recombinant molecule is maximized.
  • the resulting malt extract may be added directly to animal feed, in a desired weight ratio.
  • Studies conducted in support of the present invention demonstrate that recombinant anti-microbial proteins lysozyme and lactoferrin retain activity after malting for up to 288 hrs.
  • the malting procedure is useful in that it allows for extraction of microbial proteins in bioavailable form, with little loss of protein activity, and in a final composition that can serve as a source of sugar in the feed.
  • the starting barley can be a non- transgenic barley, or a transgenic barley, or a mixture of both.
  • the barley is processed as described, except that during the mashing process, a cereal adjunct is added in a form that it is converted during the mashing process with the concurrent retention and generation of bioavailability and bioactivity of the target recombinant molecule fond within the transgenic cereal adjunct.
  • a transgenic cereal adjunct enables the production in the malt syrup of the target recombinant molecule expressed in the transgenic grain endosperm.
  • Preferred malt extracts or syrups contain lactoferrin and/or lysozyme.
  • the malt may alternatively, or in addition, include one or more of the antimicrobial proteins noted above, such as the antimicrobial milk proteins lactohedrin, kappa-casein, haptocorrin, lactoperoxidase, and alpha-1-antitrypsin.
  • malt containing two or more antimicrobial proteins may be prepared by combining or preparing malts from seeds that separately produce the different proteins, or by preparing a malt from the seeds of plants co-transformed with chimeric genes expressing different milk proteins, e.g., lactoferrin and lysozyme.
  • the nutritionally enhanced feed of the invention provides the same or improved intestinal health and weight gain as feed supplemented with small-molecule antibiotics.
  • the improved method includes substituting conventional feed with a feed supplemented with one or more small-molecule antibiotics or a feed that has been nutritionally enhanced by addition of the seed composition of present invention, containing one or more anti-microbial proteins in substantially unpurified form.
  • conventional feed is substituted with feed nutritionally enhanced by the addition of lysozyme or lactoferrin in the seed composition.
  • the feed may be supplemented with antibiotics such as roxarsone and bactiracin methylene disalicylate.
  • the protein- containing grain of the invention finds utility in improved animal feed that may be fed to production animals.
  • the improved animal feed of the invention find utility in increasing the growth rate and feed conversion efficiency of the animals, particularly for animals in a typical production environment (i.e., a low-sanitation environment), thereby reducing or eliminating the need for administration of ST antibiotics.
  • the production of high levels of anti-microbial proteins in grains, exemplified herein by rice, provides the distinct advantage that feed supplements may be prepared with little or no purification.
  • the transgenic grain is ground (e.g., into flour) and directly added to a production-animal feed, without additional processing.
  • Transgenic seeds are ideal bioreactors, combining low production costs and low or minimal downstream processing costs prior to use.
  • Seed grain proteins can accumulate to 9-19% of grain weight (Lasztitym 1996); the endosperm proteins are synthesized during grain maturation and stored in protein bodies for use in the germination and seedling growth of the next plant generation; grains can be stored for years without loss of functionality, and therefore the downstream processing can be conducted independently of growing seasons.
  • compositions from mature monocot seeds containing seed-produced milk proteins.
  • the composition is added to a feed or feed product in powdered, liquid, or particulate form, in an amount sufficient to bring the amount of added milk protein to effective levels.
  • expression vectors for Generation of transgenic Plants
  • expression vectors were constructed using standard molecular biological techniques as described in Ausubel et al., 1987.
  • the vectors contain a heterologous protein coding sequence for lactoferrin or lysozyme under the control of a rice tissue-specific promoter, as further described below.
  • Plasmid pAPI137 contains the RAmy3D promoter (Huang et al., 1993), the codons for the RAmyZ ⁇ signal peptide and the RAmyZ ⁇ terminator.
  • the RAmy3D promoter isolated, from the rice amylase gene family, is activated in rice calli by sugar starvation (Huang et. al., 1993).
  • the human lysozyme gene was placed between the sequences of the RAmy3D signal peptide and the RAmy3D terminator to give plasmid pAPI156 (Fig. 1) having a size of 4829 bp. Plasmid, pAPI76 carrying the bacterial hygromycin B phosphotransferase (hpt) gene was used for co-transformation of the calli to allow selection of the transformants.
  • pAPI176 was created as following: A DNA fragment was amplified from a rice alpha-amylase gene RAmy ⁇ A (Huang et al, 1990b) and cloned into pBluescript KS+ at the Sma ⁇ IEcoR ⁇ restriction sites and the resulting plasmid was called p1AT. The PCR amplified fragment contained 297 bp of RAmy A terminator. A BamHI DNA fragment from pGL2 (Shimamoto et al., 1989) was cloned into the SamHI site of p1AT and the resulting plasmid was called pAPI174.
  • pAPI176 Sac ⁇ /Xba ⁇ fragment amplified from glucanase gene, Gns9 (Romero et al., 1998) was inserted into pAPI174 using the same restriction sites. The PCR generated, Gns9 promoter fragment was confirmed by DNA sequencing. The resulting plasmid was named as pAPI176.
  • the plasmid containing the codon-optimized gene was called Lac-ger. Lac-ger was digested with Sma ⁇ lXho ⁇ and the fragment containing the lactoferrin gene was cloned into pAPI141 that was partially digested with ⁇ /ael and completely digested with Xho ⁇ . The resulting plasmid was named pAP1 164.
  • the codon optimized gene was operably linked to the rice endosperm specific glutelin (Gt1) promoter and NOS terminator (Fig. 7).
  • the Gt1 promoter was cloned based on the published DNA sequence (Okita ef al., 1989). Genomic DNA was isolated from a rice variety called M202 and the Gt1 promoter isolated by PCR. The primers used to amplify the fragment were MV-Gt1-F1 : 5' ATC GAA GCT TCA TGA GTA ATG TGT GAG CAT TAT GGG ACC ACG 3' (SEQ ID NO:5) and Xba-Gt1-R1 : 5' CTA GTC TAG ACT CGA GCC ATG GGG CCG GCT AGG GAG CCA TCG CAC AAG AGG AA 3' (SEQ ID NO:6).
  • the PCR amplifications were carried out using the GeneAmp PCR system (model 2400, Perkin-Elmer) operated according to the manufacturers instructions.
  • Basic cycling conditions were 30 cycles, after a 2 minute pre-denaturing step at 95 °C, with a 30 second denaturing step at 95 °C, a 30 second annealing step at specific temperature, and a 2 minute extension step at 72 °C.
  • the final extension step was 5 minutes at 72 °C, followed by 4 °C soaking step.
  • Reaction components per 50 ⁇ l volume were 1 ⁇ g of genomic DNA or 1 ng of plasmid DNA, 2.5 ⁇ l of 5 ⁇ M primer mixture, 5 ⁇ l of 10 mM dNTP, 2.5 units of Taq polymerase (Perkin-Elmer), 5 ⁇ l of 10X PCR buffer (Perkin-Elmer).
  • pCRGTI was digested with HindttUXba I and the fragment cloned into pAP1 135 containing the kanamycin gene.
  • the resulting plasmid was named as pAPI141.
  • a GUS gene and NOS terminator was obtained from pRAJ275 (ClonTech, USA) and digested with EcoRI/ ⁇ col. The fragment was inserted into pAPI141 and the resulting plasmid designated pAPI142.
  • the plasmid pAPI176 was constructed in three steps. A DNA fragment was amplified from a rice alpha-amylase gene, RamylA, (Huang et al., 1990b) and cloned into pBluescript KS+ at the Smal/EcoRI restriction sites. The PCR amplified fragment contained 297 bp of RamylA terminator.
  • the resulting plasmid was called p1 AT.
  • a SamHI DNA fragment from pGL2 (Shimamoto et al., 1989) was cloned in to SamHI site of p1 AT.
  • the SamHI fragment contained most of the hygromycin phosphotransferase (Hph) gene with deletion of four amino acids at C-terminus.
  • This plasmid was called as pAPI174.
  • a Sac ⁇ /Xba ⁇ fragment amplified from glucanase gene, Gns9 (17) was inserted into pAPI174 using same restriction sites.
  • the PCR generated, Gns9, promoter fragment was confirmed by DNA sequencing.
  • the resulting plasmid was named as pAP1176.
  • the selected calli were transferred to pre-regeneration and regeneration media.
  • the plantlets were transferred to rooting media consisting of half concentration of MS and 0.05 mg/l NAA.
  • rooting media consisting of half concentration of MS and 0.05 mg/l NAA.
  • plantlets with developed roots and shoots were transferred to soil and kept under the cover of plastic container for a week. The plants were allowed to grow about 12 cm tall and shifted to the green house where they were grown up to maturity.
  • the synthetic human lysozyme (hLys) gene under the control of the RAmyZO promoter and terminator in the pAPI156 plasmid was used to generate sixty independent transformants by particle bombardment-mediated transformation.
  • Particle bombardment mediated transformation of rice was carried out as described above. (See Chen et al., 1998.) Briefly, rice calli derived from TP309 were bombarded with gold particles coated with plasmids pAPI156 and pAPI76 in a ratio of 6:1 using the helium biolistic particle delivery system, PDS 1000 (Bio-Rad, CA). Transformed calli were selected in the presence of hygromycin B (35 mg/L) on N6 (Sigma, MO).
  • Transformed calli were selected as described above, then transferred to pre- regeneration and regeneration media. When regenerated plants became 1-3 cm in height, the plantlets were transferred to rooting media which consisted of half concentration of MS and 0.05 mg/l NAA. After two weeks, plantlets with developed roots and shoots were transferred to soil and kept under the cover of plastic container for a week. The plants were allowed to grow about 12 cm tall and shifted to the green house where they were grown up to maturity (R0 plants).
  • Figure 2 illustrates the seed specific expression of human lysozyme in transgenic plants and Fig. 6 shows the expression level of human lysozyme in powdered R3 seeds taken from transgenic rice plants.
  • the human lysozyme in powdered R3 seeds was extracted by mixing rice powder (prepared by grinding with a Kitchen Miller) with phosphate buffer saline (PBS) containing 0.35 N NaCl at 1 gm/40 mL for one hour. The whole homogenate was allowed to settle, 1 mL homogenate was removed and centrifuged at 4 ° C and 14000 rpm for 15 min. The supernatant was removed and diluted as needed for lysozyme assay by ELISA. Embryos from individual R1 seed (derived from R0 plants) that showed a level of lysozyme expression that was greater than 10 ⁇ g/seed were saved and used to generate R1 plants.
  • PBS phosphate buffer saline
  • Embryos were sterilized in 50% commercial bleach for 25 minutes and washed with sterile H 2 0 three times for 5 minutes each. Sterilized embryos were placed in a tissue culture tube that contained MS solid medium. Embryos germinated and plantlets having about three inches shoots and healthy root systems were obtained in two weeks. The plantlets were then transferred to pots to obtain mature plants (R1 ).
  • the synthetic human lysozyme gene under the control of the Gt1 promoter in the pAPI164 plasmid was used to generate over 100 independent transformants by particle bombardment-mediated transformation.
  • Particle bombardment mediated transformation of rice was carried out as described in (Chen et al., 1998). Briefly, rice calli derived from TP309 were bombarded with gold particles coated with plasmids pAPI164 and pAPI76 in a ratio of 6:1 using the helium biolistic particle delivery system, PDS 1000 (Bio-Rad, CA). Two day old bombarded calli were then transferred to N6 selection media supplemented with 20 mg/l hygromycin B and allowed to grow in the dark at 26°C for 45 days. The selected calli were then transferred to pre-regeneration and regeneration media.
  • SDS-PAGE was carried out using an 18% precast gel (Novex, CA). The resulting gel was stained with 0.1% Coomassie brilliant blue R-250 at 45% methanol and 10% glacial acetic acid for three hours. Gel destaining was conducted with 45% methanol and 10% glacial acetic acid until the desired background was reached.
  • Reverse IEF gel electrophoresis was carried out using a precast Novex pH 3-10 IEF gel according to the manufacturer's instructions (Novex, CA). About 30 ⁇ g of lysozyme was loaded onto the gel and electrophoresed at 100 V for 50 minutes followed by application of 200 V for 20 minutes. The gel was then fixed in 136 mM sulphosalicylic acid and 11.5% TCA for 30 minutes and stained in 0.1% Coomassie brilliant blue R-250, 40% ethanol, 10% glacial acetic acid for 30 minutes. The destaining solution contained 25% ethanol and 8% acetic acid.
  • a SDS-PAGE gel was electroblotted to a 0.45 ⁇ m nitrocellulose membrane using a Mini Trans-Blot Electrophoretic Transfer Cell (Bio-Rad, CA) and subsequently subjected to immuno-blotting analysis.
  • the blot was blocked with 5% non-fat dry milk in PBS, pH 7.4 for at least two hours followed by three washes with PBS, pH 7.4 for 10 minutes each.
  • the primary rabbit polyclonal antibody against human lysozyme (Dako A/S, Denmark) was diluted at 1:2000 in the blocking buffer and the blot was incubated in the solution for at least one hour. The blot was then washed with PBS three times for 10 minutes each.
  • the secondary goat anti-rabbit IgG (H+L)-alkaline phosphatase conjugate (Bio-Rad, CA) was diluted in the blocking buffer at 1:4000. The membrane was then incubated in the secondary antibody solution for one hour and then washed three times. Color development was initiated by adding the substrate system BCIP-NBT (Sigma) and the process was stopped by rinsing the blot with H2O once the desirable intensity of the bands had been achieved.
  • An indirect sandwich ELISA was developed to quantify total lysozyme expressed in rice calli or cells and used as an alternative assay to determine the lysozyme expression yield.
  • a direct sandwich ELISA for lysozyme quantification has been previously reported (Lollike et al., 1995, Taylor, 1992), however an alternate assay was developed as a key reagent used in the assay is no longer commercially available.
  • rabbit anti-human lysozyme antibody (Dako D/K, Denmark) was used to coat a 96 well plate at 1:5000 diluted in PBS overnight at room temperature.
  • the plate After washing with PBS, the plate was blocked with 5% normal donkey serum (Jackson ImmunoResearch Laboratories, PA) in PBS for one hour. The plate was washed again with PBS. Lysozyme samples were diluted in 0.05% Tween in PBS and captured by adding to the plate and incubating for one hour. After washing the plate with PBS, sheep anti-human lysozyme at 1 :1000 diluted with 0.05% Tween in PBS was added and incubated for one hour. The plate was washed again with PBS.
  • normal donkey serum Jackson ImmunoResearch Laboratories, PA
  • Peroxidase-conjugated affinipure donkey anti-sheep IgG diluted in 0.05% Tween in PBS at 1 : 10,000 was added and incubated for one hour. After a final wash of the plate with PBS, color was developed by incubating the plate with TMB substrate (Sigma, MO) for 5-15 minutes and the absorbance read at 655 nm.
  • rabbit anti-human lysozyme antibody (Dako D/K, Denmark) was used to coat the plate at 1 :5000 diluted in PBS overnight at room temperature. After washing with PBS, the plate was blocked with 5% normal donkey serum (Jackson ImmunoResearch Laboratories, PA) in PBS for one hour. The plate was washed again with PBS. Lysozyme samples were then diluted in 0.05% Tween in PBS and captured by incubating for one hour. After washing the plate with PBS, sheep anti-human lysozyme at 1 :1000 diluted with 0.05% Tween in PBS was added and incubated for one hour. The plate was washed again with PBS.
  • a reliable and quantitative method was developed to analyze the expression level of enzymatically active lysozyme.
  • the turbidimetric assay was developed using a 96-well microtiter plate format and based on the standard lysozyme assay that is carried out spectrophotometrically in cuvettes.
  • a microtiter plate based method previously described for the detection of lysozyme release from human neutrophils had a detection range of 1-100 ng/ml (Moreira-Ludewig and Healy, 1992).
  • the assay conditions were modified to maintain the linearity of detection up to 3.0 ⁇ g/ml.
  • the enzymatic activity of lysozyme was routinely determined by spectrophotometric monitoring of the decrease in turbidity at 450 nm of a suspension of Micrococcus luteus (M. lysodeikticus) cells (Shugar, 1952). Specifically, 250 ⁇ l of a 0.015% (w/v) Micrococcus leteus cell suspension was prepared in 66 mM potassium phosphate, pH 6.24 (buffer A). Cell suspensions were equilibrated at room temperature and the reaction was initiated by adding 10 ⁇ l samples containing lysozyme with concentrations from 0 to 2.4 ⁇ g/ml. Lysozyme activity was determined in a kinetic mode for 5 minutes at 450 nm.
  • the concentration of lysozyme was then calculated by reference to the standard curve constructed with human milk-derived lysozyme.
  • the enzymatic activity of human milk lysozyme and the rice calli derived lysozyme of the invention was compared. As shown in Figure 3, the lysozyme effected reduction of the turbidity of Micrococcus leteus cell suspensions at 450 nm was very similar for lysozyme from the two sources, while buffer alone did not have any effect on the reduction of turbidity.
  • a bactericidal assay was carried out using an E.coli strain (JM109) as a test organism (data not shown). In carrying out the assay, an aliquot of overnight JM109 culture was grown in LB medium until mid log phase. A standard inoculum of mid-log phase JM109 at 2 x 10 ⁇ CFU (colony forming units)/ml was used in the bactericidal assay.
  • Buffer (20 mM Sodium phosphate, pH 7.0, 0.5 mM EDTA) alone, buffer containing human milk lysozyme or rice cell culture derived lysozyme at about 30 ⁇ g/ml were sterilized by filtration. The mixture of cells and lysozyme solution was then incubated at 37 C for the specified length of time. One-fifth of the mixture volume was plated onto the LB agar plates and incubated overnight at 37 C in order to determine the number of colony forming units. At the concentration of 30 ⁇ g/ml, recombinant human lysozyme exhibited a similar bactericidal effect as lysozyme from human milk. There was no reduction of colony forming units using an extract from the non-transgenic control.
  • the supernatant was loaded onto a 200 ml SP Sepharose fast flow column (XK26/40, Pharmacia) equilibrated with the loading buffer (50 mM sodium phosphate, pH 8.5) at a flow rate of four ml/min. The column was then washed with the same buffer until a baseline of A280 was achieved. Lysozyme was eluted by 0.2 M NaCl in the loading buffer and fractions containing lysozyme activity were pooled, concentrated and reapplied to a Sephacryl-100 column equilibrated and run with PBS at a flow rate of one ml/min. Proteins were eluted and separated by using PBS at a flow rate of one ml/min.
  • the loading buffer 50 mM sodium phosphate, pH 8.5
  • the column was then washed with the same buffer until a baseline of A280 was achieved. Lysozyme was eluted by 0.2 M NaCl in the loading buffer and fractions
  • lysozyme fractions were identified by activity assay and total protein assay (Bradford). Finally the purity of lysozyme was confirmed by SDS-PAGE. The five lines with the highest lysozyme expression level were selected and propagated continuously in petri dishes or shake flasks for lysozyme isolation and purification.
  • a crude extract from rice callus contains both recombinant human lysozyme and large amounts of native rice proteins. Since the calculated pi of lysozyme is approximately 11 , a strong cation exchange column, SP-Sepharose fast flow (Pharmacia), was chosen as the first column to separate the rice proteins from recombinant human lysozyme.
  • rice proteins did not bind to the column when equilibrated with 50 mM sodium phosphate, pH 8.5.
  • the recombinant human lysozyme on the other hand, bound to the column and was eluted by 0.2 M NaCl.
  • Rice proteins that co-eluted with recombinant human lysozyme were separated from lysozyme by gel filtration through a Sephacryl S-100 column and highly purified recombinant human lysozyme was obtained.
  • R2 rice seeds from transgenic plants were dehusked and milled to flour using conventional methods. Lysozyme was extracted by mixing the rice flour with 0.35 N NaCl in PBS at 100 grams/liter at room temperature for one hour. The resulting mixture was subjected to filtration through 3 ⁇ m of a pleated capsule, then through 1.2 ⁇ m of a serum capsule and finally through a Suporcap 50 capsule with a 0.8 ⁇ m glass filter on top of 0.45 ⁇ m filter (Pall, Ml).
  • the clear rice extract (1 liter) was then dialyzed against 50 mm sodium phosphate, pH 8.5 at 4°C overnight and the dialyzed sample was loaded onto a cation exchange resion SP-Sepharose (Pharmacia Amersham), which was pre-conditioned with 50 mm sodium phosphate, pH 8.5 before loading. After loading, the column was washed with the same buffer until a base line A280 reading was achieved, then lysozyme was eluted with 0.2 N NaCl in 50 mm sodium phosphate, pH 8.5. Fractions containing lysozyme were pooled and reapplied to a Sephacryl S-100 column (Bio-Rad; equilibrated and run with PBS). Pure lysozyme fractions were identified by enzymatic assay and total protein assay (Bradford) and the purity of lysozyme was confirmed by SDS-PAGE.
  • rLys Recombinant human lysozyme isolated from mature rice seed as described above, was separated by 18% SDS-PAGE followed by electroblotting to a PVDF membrane (Bio-Rad, CA).
  • the lysozyme band was identified by staining the membrane with 0.1% Coomassie Brilliant Blue R-250 in 40% methanol and 1% glacial acetic acid for 1 minute.
  • the stained PVDF membrane was immediately destained in 50% methanol until the band was clearly visible. After the blot was thoroughly washed with H2O and air-dried, it was sequenced with a sequencer ABI 477 by Edman degradation chemistry at the Protein Structure Laboratory of the University of California at Davis.
  • the results showed that the rLys produced in transgenic rice seed had an identical N-terminal sequences to the human lysozyme, as follows:
  • a human lysozyme standard and lysozyme from rice were diluted to a final concentration of 50 ⁇ g/ml in PBS and subjected to the following thermal treatment in a sequential mode: (1): 62 C for 15 minutes; (2): 72 C for 20 seconds; (3): 85 C for 3 minutes and finally; (4): 100 C for 8 seconds.
  • Studies were conducted with 100 ⁇ l per tube and repeated three times. Aliquots were saved at the end of each treatment and the remaining lysozyme activity was measured by activity assay.
  • lysozyme was dissolved in 0.9% NaCl at 100 ⁇ g/ml at pH 7.3, 5, 4, 3 and 2. The solutions were incubated at 24°C for one hour. Experiments were conducted with 200 ⁇ l per tube and repeated three times. Remaining lysozyme was detected by lysozyme activity assay.
  • Nucleotides encoding the rice RamyZO signal peptide were attached to the human lysozyme gene in the expression vector pAPH 56. Determination of the N- terminal amino acid sequence of the purified recombinant human lysozyme revealed an N-terminal sequence identical with that of native human lysozyme, as detailed above. Rice cells thus cleave the correct peptide bond to remove the RAmy3D signal peptide, when it is attached in the human lysozyme precursor. The overall charge of recombinant and native human lysozyme were compared by isoelectric-focusing (IEF) gel electrophoresis and pi values determined.
  • IEEE isoelectric-focusing
  • lysozyme is a basic protein with a calculated pi of 10.20
  • the pi comparison studies were carried out by reverse IEF gel electrophoresis.
  • Recombinant and native human lysozyme displayed identical pi, indicating the same overall charge (data not shown).
  • Recombinant human lysozyme derived from transgenic rice had a specific activity similar to the native lysozyme (200,000 units/mg (Sigma, MO), whereas, lysozyme from chicken egg whites had the expected 3-4 fold lower specific activity (Sigma, MO).
  • results described above demonstrate the ability to use rice calli or cell suspension cultures as a production system to express human lysozyme from milk. Over 60 individual transformants were screened by immunoblot, enzymatic activity assay and ELISA. Yields of recombinant human milk lysozyme reached 4% of soluble cell proteins. Although the mechanism is not part of the invention, the high expression level may be explained by the utilization of the strong RAmy3D promoter (Huang et. al., 1993) and the codon-optimized gene.
  • the plant derived human milk lysozyme obtained by the methods of the present invention was identical to endogenous human lysozyme in electrophoretic mobility, molecular weight, overall surface charges and specific bactericidal activity.
  • Rice Plants A. Southern blot analysis. About three grams of young leaf were collected and ground with liquid nitrogen into a very fine powder. The DNA was isolated according to the procedure as described in Dellaporta SL et al., 1983, and purified by phenol-chloroform extraction. Approximately 5 ⁇ g of ECoRI and H/ ' ndlll digested DNA from each line was used to make blot for Southern analysis. The ECLTM direct nucleic acid labeling and detection system (Amersham, USA) was used for analysis.
  • the lactoferrin gene copy number was estimated to be from 2 to 10 as determined by Southern blot hybridization using EcoRI and H/ndlll digested genomic DNA.
  • the AP1164-12-1 (Ro) transgenic plant line was subjected to Southern analysis together with ten Western blot positive, field grown R* lines.
  • a typical Southern blot shows that there are at least three fragments above the original plasmid derived plant transformation unit (3156 bp). All the LF inserts appear to be inherited from the original Ro transgenic plant event (lane 2) to R1 (lane 3 - 11 ) generation.
  • Rice seeds were ground with 1 ml of 0.35 N NaCl in phosphate buffer saline (PBS), pH 7.4 using an ice-cold mortar and pestle and the resulting homogenate was centrifuged at 15000 rpm for 15 min at 4°C. The supernatant was used as a protein extract and about 1/25 or 1/50 of the salt soluble content was loaded onto a 10% pre cast gel (Novex, USA) and electrophoresis was carried according to the manufacturer's instructions.
  • PBS phosphate buffer saline
  • the polyacyramide gel was stained with 0.1% Coomassie brilliant blue R-250 (dissolved in 45% methanol and 10% glacial acetic acid) for at least three hours and destained with 45% methanol and 10% glacial acetic acid until the desired background was achieved.
  • Coomassie brilliant blue R-250 dissolved in 45% methanol and 10% glacial acetic acid
  • For Western blot analysis SDS-PAGE gels were electroblotted onto a 0.45 ⁇ m nitrocellulose membrane with a Mini-Trans-Blot Electrophoretic Transfer Cell System (Bio-Rad, USA) and subsequently subjected to immuno-blotting analysis. The blot was blocked with 5% non-fat dry milk in PBS for at least two hours followed by three washes with PBS for 10 minutes each.
  • the primary rabbit polyclonal antibody against hLF (Daka A/S, Denmark) was diluted at 1 :2500 in the blocking buffer and the blot was incubated in the solution for one hour. The blot was washed with PBS for three times with 10 minutes each.
  • the secondary goat anti-rabbit IgG (H+L)-alkaline phosphatase conjugated (Bio-Rad, USA) was diluted in the blocking buffer at 1:5000 ratio.
  • the membrane was incubated in the secondary antibody solution for one hour and followed by three washes with PBS. Color development was initiated by adding the substrate system BCIP-NBT (Sigma, USA) and the process was stopped by rinsing the blot with
  • the clear protein solution was loaded onto a ConA Sepharose column (Pharmacia, XK 26) which had been equilibrated with 0.5 N NaCl in 20 mM Tris, pH 7.4 (binding buffer) at a flow rate at 4 ml/min. After the loading was complete, the column was washed with binding buffer until the baseline at A 280 nm was achieved. Lactoferrin was eluted with 0.1 N mannoside in the binding buffer.
  • ELISA D. Enzyme Linked Immunosorbant Assay
  • Recombinant lactoferrin produced in rice is glycosylated as evident from the binding to Con A resin, the positive staining by glycoprotein detection kit as well as the larger detected mass as compared to the calculated mass (76.2 kDa) based on the peptide backbone.
  • MALDI-MS showed that seed derived recombinant lactoferrin has molecular weight of 78.5 kD while human milk lactoferrin is 80.6 kDa (Table 5). The difference could be due to the lesser degree of glycosylation in the rice seed-derived lactoferrin.
  • the iron content of R 2 homozygous seeds was determined. Two grams of dry mature seeds from each transformed and non transformed line were weighed and wet- ashed with HN0 3 and H 2 0 2 solution at 110 ° C (Goto et al., 1999). The ash was dissolved in 1N HCI solution. The iron content was then measured by absorbance of Fe-O-phenanthrolin at 510 nm, using a Sigma kit (Sigma, USA) per instructions of manufacturer.
  • the different values of nutrient facts of homozygous transgenic seeds and non transgenic seeds were measured by standard procedure at A & L Western Agricultural Laboratories (Modesto, CA, USA).
  • the different values of nutrient facts of homozygous transgenic seeds and non transgenic seeds were measured by standard procedure at A & L Western Agricultural Laboratories (Modesto, CA, USA).
  • An endosperm specific rice glutelin promoter was used to express recombinant lactoferrin in maturing or matured seeds.
  • protein was extracted from root, shoot, leaf beside mature seed and subjected to Western blot and the results indicated that there was no detectable expression of rLF except in the seed/endosperm (results not shown).
  • the presence of rLF in 5 day old germinated seeds showed the stability of stored rLF within the plant cell during germination.
  • LF proteins were dissolved in PBS at 1 mg/ml, and either left untreated, pepsin treated (0.08mg/ml at 37°C for 30 min), or pepsin/pancreatin treated (0.016 mg/ml at 37°C for 30 min).
  • LF proteins were sterilized by passing through a membrane filter with a pore size of 0.2 ⁇ m [Rudloff, 1992]. The filter sterilized LF (0.5 ⁇ g/ml) was incubated with 10 4 colony forming unit (CFU) enteropathogenic E.
  • CFU colony forming unit
  • E. coli EEC/ ⁇ l in 100 ⁇ l sterile synthetic broth (1.7% : AOAC) containing 0.1% dextrose and 0.4 ppm ferrous sulfate at 37°C for 12h and colony forming units (CFU) were determined. Starting with an enteropathogenic E. coli (EPEC) concentration of 10 4 CFU
  • nHLf native human lactoferrin standard
  • rLf recombinant rice-derived lactoferrin
  • lysozyme and lactoferrin require that they survive in a biologically active form following passage through the stomach and into the small intestine and both human lysozyme and lactoferrin are known to possess sufficient protection against denaturation and hydrolysis to be efficacious in humans.
  • the pH gradients and the digestive enzymes in chickens and humans are similar suggesting that the molecules should survive passage through the chicken's digestive tract.
  • the survival of lysozyme and lactoferrin at 2 ages: 3 days of age and 21 days of age was evaluated. At 3 days of age, the digestive tract of chicks is immature and levels of digestive enzymes are low. At 21 days, the rate of digestive enzyme production is at adult levels and digestibility of proteins is maximal; providing a maximal challenge to the survival of the target molecules.
  • soluble proteins can be tested for activity.
  • lysozyme the test is a measurement of hydrolysis of Micrococcus lysodeiciticus (Sigma Chemical Company) using chicken lysozyme as a standard.
  • lactoferrin the material is tested using published protocols for determining lactoferrin binding to CACO-2 cells. Human lactoferrin (Sigma Chemical Company) is used as a standard.
  • Chromium marker concentration can be determined by flame atomic absorption spectrophotometry, with concentrations expressed as ⁇ g/ ⁇ g of chromium.
  • rLys concentrations are based on 2 g/kg lysozyme in the transgenic rice and each of the experimental diets also contains a non-absorbable marker (chromium) in order to follow passage of the non-absorbed digesta.
  • the control diet Diet #1 is a standard reference chicken diet recommended by the National Academy of Science, with the exception that 10% ground rice is used in place of ground corn.
  • the cages used for the study had previously been used for 3 production cycles of chickens. They were not cleaned or disinfected between cycles of chicken production, permitting the build up of feces, dust, and dander. The rate of air-turnover in the room housing the chickens was reduced to levels similar to that seen in a commercial broiler production barn. These sanitation practices were intended to mimic commercial conditions where antibiotics are proven to provide increased growth and feed conversion efficiency. The results demonstrate that feeding growing chickens a diet containing recombinant lysozyme results in a feed conversion efficiency that is better than sub- therapeutic antibiotics.
  • the growth rate of chickens as measured in grams of weight gained per chick per day is comparable, even at the level of just 0.2% added transgenic grain, to that seen with antibiotic or chicken lysozyme controls.
  • growth as a factor of feed efficiency, or grams of weight gained per gram of feed was on the order of that seen in antibiotic and chicken lysozyme controls.
  • Table 8 Weight and Feed Intake and Feed Efficiency of Chickens Fed Various Diets
  • Taipei 309 which is the conventional rice (CONV) that served as the host for transgenic plant production, served as a control. All rice was dehusked to yield brown rice and then ground using a comminuting machine (Fitzpatrick Inc, Chicago, IL).
  • Petersime brooder batteries located in an environmentally controlled room (25 C) with 24 hrs of light.
  • Chicks were provided water and commercial chick starter for ad libitum consumption. The batteries had not been cleaned after their previous use in order to provide a level of sanitation conducive for an antibiotic response.
  • experimental chicks were selected for uniform body weight from a two-fold larger population and randomly assigned to dietary treatments. Chicks had ad libitum access to both feed and water and were exposed to a 24-hour light cycle. All experiments and procedures were approved by the Campus Animal Care and Use Committee.
  • Corn-soy-rice basal diets were formulated to meet or exceed the nutrient needs of young growing broiler chicks suggested by NRC (1994). All experimental diets were formulated to contain the same amount of rice by substituting transgenic rice for CONV rice as shown in Tables 1 and 2. A range of levels of each test rice was chosen for study in order to determine a minimally efficacious level. The 10.0% LZ diet used in study 1 was analyzed to contain 176 mg/kg lysozyme. Following 6 months of storage at room temperature, it contained 152 mg/kg lysozyme, indicating that this protein was stable to storage.
  • Study 1 compared 10 corn-soy diets containing 20% of various LF, LZ or conventional rice (CONV). 300 3-day old chicks were randomly assigned to one of 10 dietary treatments as shown in Table 2. Each dietary treatment consisted of six replicates, with five chicks per replicate. Chick and feeder weights were determined on day 1 and 17.
  • Intestinal samples were taken on the last day of study 1 and 2. Sections (2.5 cm) from one chick per replicate were obtained from the duodenum at the apex of the pancreas, the jejunum at a position midway between Meekel's diverticulum and the entrance of the bile ducts, the ileum at a position midway between Meekel's diverticulum and the ileum-cecal junction, and the ceca at a point midway along its length (study 2 only).
  • Sections were incubated with rabbit anti-mouse Ig tagged with peroxidase with 0.5% bovine serum albumin for 1 hour and rinsed. Peroxidase activity was developed by incubating sections with 0.01% H 2 0 2 and 3,3'-diamino-benzidine-tetrahydrachloride. The slides were counterstained with hematoxylin-eosin. The number of leukocytes in 10 villi per section and the number of leukocytes in the lamina intestinal underneath and within these 10 villi were enumerated. Cells with endogenous peroxidase activity (primarily heterophils) were also enumerated as described by Vervelde and Jeurissen (Vervelde, L.
  • Study 2 compared 5 corn-soy diets containing experimental rice combinations totaling 155 rice. 360 3-day old chicks were randomly assigned to one of 5 dietary treatments (Table 2) with 12 replicates per treatment and 6 chicks per replicate (42 chicks per treatment). Chick and feeder weights were determined on day 1 and 19. Chicks fed the corn soy diet, which was devoid of rice, did not differ from chicks fed CONV in any of the parameters measured. There was no significant difference (P>0.05) in body weight gain due to dietary treatments and averaged 37.89 g/chick/day.
  • Codon optimized lysozyme coding sequence 1
  • Amino acid sequence based on codon optimized lysozyme coding sequence KVFERCELARTLKRLG DGYRGISLANWMCLAKWESGYNTRATNYNAGDRST DYGIFQINSRYWCNDGKTPGAVNACHLSCSALLQDNIADAVACAKRWRDPQG IRAWVAWRNRCQNRDVRQYVQGCGV
  • Codon optimized lactoferrin coding sequence GGGCGGCGGCGGCGCTCGGTGCAGTGGTGCGCCGTGTCCCAG

Landscapes

  • Life Sciences & Earth Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Organic Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Zoology (AREA)
  • Molecular Biology (AREA)
  • Polymers & Plastics (AREA)
  • Biochemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Wood Science & Technology (AREA)
  • Biotechnology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Biophysics (AREA)
  • Food Science & Technology (AREA)
  • General Engineering & Computer Science (AREA)
  • Biomedical Technology (AREA)
  • Microbiology (AREA)
  • Toxicology (AREA)
  • Mycology (AREA)
  • Nutrition Science (AREA)
  • Botany (AREA)
  • Animal Husbandry (AREA)
  • Physiology (AREA)
  • Endocrinology (AREA)
  • Diabetes (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Cell Biology (AREA)
  • Physics & Mathematics (AREA)
  • Plant Pathology (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Feed For Specific Animals (AREA)
  • Fodder In General (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)

Abstract

L'invention concerne des compositions alimentaires animales améliorées comprenant une ou plusieurs protéines de lait produites dans les graines d'une plante transgénique, ainsi que leurs procédés de préparation et d'utilisation.
EP02719019A 2001-02-14 2002-02-14 Compositions d'additif alimentaire et methodes associees Withdrawn EP1389903A4 (fr)

Applications Claiming Priority (5)

Application Number Priority Date Filing Date Title
US26918801P 2001-02-14 2001-02-14
US269188P 2001-02-14
US847232 2001-05-02
US09/847,232 US20030172403A1 (en) 2000-05-02 2001-05-02 Plant transcription factors and enhanced gene expression
PCT/US2002/004919 WO2002063975A2 (fr) 2001-02-14 2002-02-14 Compositions d'additif alimentaire et methodes associees

Publications (2)

Publication Number Publication Date
EP1389903A2 true EP1389903A2 (fr) 2004-02-25
EP1389903A4 EP1389903A4 (fr) 2006-09-06

Family

ID=26953552

Family Applications (1)

Application Number Title Priority Date Filing Date
EP02719019A Withdrawn EP1389903A4 (fr) 2001-02-14 2002-02-14 Compositions d'additif alimentaire et methodes associees

Country Status (4)

Country Link
EP (1) EP1389903A4 (fr)
AU (1) AU2002250126A1 (fr)
CA (1) CA2437819A1 (fr)
WO (1) WO2002063975A2 (fr)

Families Citing this family (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20030172403A1 (en) 2000-05-02 2003-09-11 Ning Huang Plant transcription factors and enhanced gene expression
US6991824B2 (en) 2000-05-02 2006-01-31 Ventria Bioscience Expression of human milk proteins in transgenic plants
US7417178B2 (en) 2000-05-02 2008-08-26 Ventria Bioscience Expression of human milk proteins in transgenic plants
AR047658A1 (es) 2004-02-03 2006-02-01 Cargill Inc Concentrado de proteinas y corriente acuosa con carbohidratos hidrosolubles
EP1940454A4 (fr) * 2005-09-28 2012-01-04 Ventria Bioscience Preparation orale pour troubles enteriques et/ou rehydratation
CN110272501B (zh) * 2019-07-12 2020-04-10 东北农业大学 猪源杂合防御肽pl-5及其制备方法和应用
US10947552B1 (en) 2020-09-30 2021-03-16 Alpine Roads, Inc. Recombinant fusion proteins for producing milk proteins in plants
US10894812B1 (en) 2020-09-30 2021-01-19 Alpine Roads, Inc. Recombinant milk proteins
CA3191387A1 (fr) 2020-09-30 2022-04-07 Nobell Foods, Inc. Proteines de lait recombinantes et compositions les comprenant
CN114480351B (zh) * 2022-04-07 2022-07-05 中国农业科学院作物科学研究所 ZmAMP1基因的突变等位基因及其应用

Citations (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4320116A (en) * 1976-03-08 1982-03-16 Astra-Ewos Ab Foodstuffs, animal feeding stuffs and pharmaceutical preparations containing an antibacterial system
WO1989004371A1 (fr) * 1987-11-02 1989-05-18 Louisiana State University Agricultural And Mechan Plantes ameliorees genetiquement pour resister aux maladies
WO1991014772A1 (fr) * 1990-03-23 1991-10-03 Gist-Brocades N.V. Production d'enzymes dans des semences et utilisation de telles enzymes
EP0591530A1 (fr) * 1992-03-24 1994-04-13 Rice Breeding Research Laboratories Procede de reduction de proteines de stockage de semences et procede de transformation de plantes
WO1998046775A1 (fr) * 1997-04-16 1998-10-22 Btg International Limited Gene resistant au stress oxydatif
WO1998050543A1 (fr) * 1997-05-02 1998-11-12 Meristem Therapeutics S.A. Lactoferrines recombinantes, leurs procedes de production par les plantes ainsi que leurs utilisations
WO2000004146A1 (fr) * 1998-07-17 2000-01-27 Plantechno Srl Polynucleotide synthetique codant pour la lactoferrine humaine, et vecteurs, cellules, et vegetaux transgeniques contenant ce polynucleotide
WO2000021381A1 (fr) * 1998-10-15 2000-04-20 Dsm N.V. Utilisation d'enzymes antimicrobiennes dans des aliments pour animaux
US6160202A (en) * 1994-10-07 2000-12-12 University Of Maryland Baltimore County Modification of seed crops with transcription factors

Family Cites Families (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5543576A (en) * 1990-03-23 1996-08-06 Mogen International Production of enzymes in seeds and their use
US5693506A (en) * 1993-11-16 1997-12-02 The Regents Of The University Of California Process for protein production in plants

Patent Citations (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4320116A (en) * 1976-03-08 1982-03-16 Astra-Ewos Ab Foodstuffs, animal feeding stuffs and pharmaceutical preparations containing an antibacterial system
WO1989004371A1 (fr) * 1987-11-02 1989-05-18 Louisiana State University Agricultural And Mechan Plantes ameliorees genetiquement pour resister aux maladies
WO1991014772A1 (fr) * 1990-03-23 1991-10-03 Gist-Brocades N.V. Production d'enzymes dans des semences et utilisation de telles enzymes
EP0591530A1 (fr) * 1992-03-24 1994-04-13 Rice Breeding Research Laboratories Procede de reduction de proteines de stockage de semences et procede de transformation de plantes
US6160202A (en) * 1994-10-07 2000-12-12 University Of Maryland Baltimore County Modification of seed crops with transcription factors
WO1998046775A1 (fr) * 1997-04-16 1998-10-22 Btg International Limited Gene resistant au stress oxydatif
WO1998050543A1 (fr) * 1997-05-02 1998-11-12 Meristem Therapeutics S.A. Lactoferrines recombinantes, leurs procedes de production par les plantes ainsi que leurs utilisations
WO2000004146A1 (fr) * 1998-07-17 2000-01-27 Plantechno Srl Polynucleotide synthetique codant pour la lactoferrine humaine, et vecteurs, cellules, et vegetaux transgeniques contenant ce polynucleotide
WO2000021381A1 (fr) * 1998-10-15 2000-04-20 Dsm N.V. Utilisation d'enzymes antimicrobiennes dans des aliments pour animaux

Non-Patent Citations (14)

* Cited by examiner, † Cited by third party
Title
HIEMSTRA P S ET AL: "Ubiquicidin, a novel murine microbicidal protein present in the cytosolic fraction of macrophages." JOURNAL OF LEUKOCYTE BIOLOGY. SEP 1999, vol. 66, no. 3, September 1999 (1999-09), pages 423-428, XP002390344 ISSN: 0741-5400 *
HORVATH HENRIETTE ET AL: "The production of recombinant proteins in transgenic barley grains" PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF THE UNITED STATES, NATIONAL ACADEMY OF SCIENCE, WASHINGTON, DC, US, vol. 97, no. 4, 15 February 2000 (2000-02-15), pages 1914-1919, XP002173225 ISSN: 0027-8424 *
HOUGH J S ET AL: "OUTLINE OF MALTING AND BREWING" MALTING AND BREWING SCIENCE, LONDON, CHAPMAN AND HALL, GB, 1972, pages 95-105, XP002020869 *
HUANG JIANMIN ET AL: "Expression and purification of functional human alpha-1-antitrypsin from cultured plant cells" BIOTECHNOLOGY PROGRESS, vol. 17, no. 1, January 2001 (2001-01), pages 126-133, XP002367520 ISSN: 8756-7938 *
LARRICK J W ET AL: "Anti-microbial activity of human CAP18 peptides" IMMUNOTECHNOLOGY, ELSEVIER SCIENCE PUBLISHERS BV, NL, vol. 1, no. 1, May 1995 (1995-05), pages 65-72, XP004052685 ISSN: 1380-2933 *
LINKO M ET AL: "Recent advances in the malting and brewing industry" JOURNAL OF BIOTECHNOLOGY, ELSEVIER SCIENCE PUBLISHERS, AMSTERDAM, NL, vol. 65, no. 2-3, 27 October 1998 (1998-10-27), pages 85-98, XP004144915 ISSN: 0168-1656 *
MENA MONTANA ET AL: "An endosperm-specific DOF protein from barley, highly conserved in wheat, binds to and activates transcription from the prolamin-box of a native B-hordein promoter in barley endosperm" PLANT JOURNAL, BLACKWELL SCIENTIFIC PUBLICATIONS, OXFORD, GB, vol. 16, no. 1, October 1998 (1998-10), pages 53-62, XP002165470 ISSN: 0960-7412 *
NAKASE M ET AL: "Cloning of the rice seed alpha-globulin-encoding gene: sequence similarity of the 5'-flanking region to those of the genes encoding wheat high-molecular-weight glutenin and barley D hordein" GENE, ELSEVIER, AMSTERDAM, NL, vol. 170, no. 2, 8 May 1996 (1996-05-08), pages 223-226, XP004042830 ISSN: 0378-1119 *
NAKASE MASAYUYI ET AL: "Characterization of a novel rice bZIP protein which binds to the alpha-globulin promoter" PLANT MOLECULAR BIOLOGY, SPRINGER, DORDRECHT, NL, vol. 33, no. 3, 1997, pages 513-522, XP002195306 ISSN: 0167-4412 *
See also references of WO02063975A3 *
STENGER S ET AL: "An Antimicrobial Activity of Cytolytic T Cells Mediated by Granulysin" SCIENCE, AMERICAN ASSOCIATION FOR THE ADVANCEMENT OF SCIENCE, US, vol. 282, 2 October 1998 (1998-10-02), pages 121-125, XP002920630 ISSN: 0036-8075 *
VON WETTSTEIN DITER ET AL: "Improved barley broiler feed with transgenic malt containing heat-stable (1,3-1,4)-beta-glucanase" PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF THE UNITED STATES, NATIONAL ACADEMY OF SCIENCE, WASHINGTON, DC, US, vol. 97, no. 25, 5 December 2000 (2000-12-05), pages 13512-13517, XP002173224 ISSN: 0027-8424 *
WU C-Y ET AL: "The GCN4 motif in a rice glutelin gene is essential for endosperm-specific gene expression and is activated by Opaque-2 in transgenic rice plants" PLANT JOURNAL, BLACKWELL SCIENTIFIC PUBLICATIONS, OXFORD, GB, vol. 14, no. 6, June 1998 (1998-06), pages 673-683, XP001079181 ISSN: 0960-7412 *
ZASLOFF M: "Antibiotic peptides as mediators of innate immunity." CURRENT OPINION IN IMMUNOLOGY. FEB 1992, vol. 4, no. 1, February 1992 (1992-02), pages 3-7, XP002390343 ISSN: 0952-7915 *

Also Published As

Publication number Publication date
WO2002063975A2 (fr) 2002-08-22
EP1389903A4 (fr) 2006-09-06
AU2002250126A1 (en) 2002-08-28
CA2437819A1 (fr) 2002-08-22
WO2002063975A3 (fr) 2003-12-11

Similar Documents

Publication Publication Date Title
US6991824B2 (en) Expression of human milk proteins in transgenic plants
US7718851B2 (en) Expression of human milk proteins in transgenic plants
US20030056244A1 (en) Feed additive compositions and methods
US20100119691A1 (en) Expression of human milk proteins in transgenic plants
JP2008237220A (ja) トランスジェニック植物におけるヒト乳タンパク質の発現
Conesa et al. Recombinant human lactoferrin: a valuable protein for pharmaceutical products and functional foods
JP5096152B2 (ja) フィターゼ活性を有するポリペプチド及びそれをコードするポリヌクレオチド
AU2002250127A1 (en) Expression of human milk proteins in transgenic plants
US20160076048A1 (en) Non-glycosylated transferrin expressed in monocots
WO2002064750A2 (fr) Systeme d'expression de proteines de graines
EP1389903A2 (fr) Compositions d'additif alimentaire et methodes associees
JP2004528022A5 (fr)
Li et al. High-level expression of maize γ-zein protein in transgenic soybean (Glycine max)
AU2018261600B2 (en) Animal feed compositions and methods of use
AU2007216827B2 (en) Expression of human milk proteins in transgenic plants
KR101536963B1 (ko) 식물에서 tev 프로테아제를 대량생산하는 방법 및 상기 방법에 의해 제조된 tev 프로테아제
AU2012202697B2 (en) Expression of human milk proteins in transgenic plants
ES2467155T3 (es) Expresión de proteínas de leche humana en plantas transgénicas
EP1280920B1 (fr) Polypeptides a activite phytase
Holding et al. Genetic engineering of seed storage proteins
JPH10323137A (ja) ラクトフェリン機能を食用植物に付与する方法、及びラクトフェリン機能を有する食用植物
Adkins et al. Proteins and peptides
Erickson et al. The Production and Delivery of Therapeutic Peptides in Plants
Moloney Seeds as repositories of recombinant proteins in molecular farming
Adkins et al. University of California, Davis, Davis, California, USA

Legal Events

Date Code Title Description
PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

17P Request for examination filed

Effective date: 20030901

AK Designated contracting states

Kind code of ref document: A2

Designated state(s): AT BE CH CY DE DK ES FI FR GB GR IE IT LI LU MC NL PT SE TR

AX Request for extension of the european patent

Extension state: AL LT LV MK RO SI

RTI1 Title (correction)

Free format text: FEED ADDITIVE COMPOSITIONS AND METHODS

RIC1 Information provided on ipc code assigned before grant

Ipc: C12N 15/82 20060101ALI20060727BHEP

Ipc: A01H 5/10 20060101ALI20060727BHEP

Ipc: A23L 1/185 20060101ALI20060727BHEP

Ipc: A23L 1/105 20060101ALI20060727BHEP

Ipc: A23L 1/10 20060101ALI20060727BHEP

Ipc: A23L 1/09 20060101AFI20060727BHEP

A4 Supplementary search report drawn up and despatched

Effective date: 20060809

17Q First examination report despatched

Effective date: 20061218

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN

18D Application deemed to be withdrawn

Effective date: 20130903