EP0550465A1 - Antigenes de surface immunodominants d'entamoeba histolytica - Google Patents

Antigenes de surface immunodominants d'entamoeba histolytica

Info

Publication number
EP0550465A1
EP0550465A1 EP91915391A EP91915391A EP0550465A1 EP 0550465 A1 EP0550465 A1 EP 0550465A1 EP 91915391 A EP91915391 A EP 91915391A EP 91915391 A EP91915391 A EP 91915391A EP 0550465 A1 EP0550465 A1 EP 0550465A1
Authority
EP
European Patent Office
Prior art keywords
sequence
aat
tat
gga
asn
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Withdrawn
Application number
EP91915391A
Other languages
German (de)
English (en)
Other versions
EP0550465A4 (fr
Inventor
Nina Martha Agabian
Ursula Edman
Isaura Meza Gomez-Palacio
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
University of California
Original Assignee
University of California
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by University of California filed Critical University of California
Publication of EP0550465A1 publication Critical patent/EP0550465A1/fr
Publication of EP0550465A4 publication Critical patent/EP0550465A4/xx
Withdrawn legal-status Critical Current

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/44—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from protozoa
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/20—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans from protozoa
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
    • C12Q1/68—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
    • C12Q1/6876—Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes
    • C12Q1/6888—Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for detection or identification of organisms
    • C12Q1/6893—Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for detection or identification of organisms for protozoa
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
    • Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change

Definitions

  • the present invention relates generally to
  • Entamoeba histolytica is a common human pathogenic protozoa. ⁇ moebiasis, or infection by E. histolytica, causes a spectrum c. disease ranging from a commensal state in asymptomatic carriers to fulminant diarrhea or extra-intestinal abscess formation in invasive
  • Entamoeba histolytica exists in two forms, a motile trophozoite or a dormant cyst. Virulent amoebae
  • the infection rate in the United States is about 1%, but the carrier rate may exceed 50% in certain areas of the world.
  • pathogenesis is not understood. Until recently, it was unclear whether invasiveness is a stable or a variable genotypic characteristic of a particular strain.
  • PGM phosphoglucomutase
  • HK hexokinase
  • PPI phosphoglucoisomerase
  • pathogenic infections caused by a mixture of strains or infections which may have interconverted phenotypically from pathogenic to non-pathogenic strains.
  • new reagents for treatment and prevention of infection by amoeba are always valuable.
  • the present invention provides these and other important reagents and methods for their effective use.
  • Figure 1 Western blot of whole Entamoeba extract fractionated by 5-15% SDS-PAGE; lanes 2, 7, and 12, polyxenic pathogenic E. histolytica isolate SD-4, lanes 3, 8, and 13, polyxenic non-pathogenic E. histolytica isolate SD116, lanes 4, 9, and 14, E. histolytica-like Laredo, lanes 5, 10, and 15, E. histolytica HK-9, lanes 6, 11, and 16, E.
  • E histolytica HM1:IMSS trophozoites labeled in vivo with primary antibodies.
  • histolytica immune sera at 1:500 dilution B: pool of human anti-E. histolytica immune sera purified by
  • C monoclonal FA7 harvest fluid at 1:1000 dilution
  • D monoclonal anti-E.
  • histolytica actin antibody at 1:1000 dilution secondary antibodies, fluorescein isothiocyanate goat-anti-human and fluorescein isothiocyanate goat-anti-mouse.
  • FIG. 3 Transfer blot of E. histolytica HM1:IMSS RNA probed with cDNA clone ⁇ cM17 indicates a single hybridizing band migrating at ⁇ 3 kb. Hybridization conditions were 50% formamide, 0. 2 X SSC, 42oC.
  • the present invention provides novel compositions and methods for diagnosing, treating and vaccinating Entamoeba parasitic infections.
  • the present invention is based, in part, on the discovery of a class of highly immunogenic, or immunodominant, 125 kDa
  • M17 proteins which are localized on the membrane of the trophozoite form of E. histolytica. Particular allelic forms of this 125 kDa antigen have been isolated and found to be characteristic of
  • compositions including vaccines, polypeptides, and polypeptide fragments.
  • compositions according to the present invention include nucleic acids encoding the various surface antigens and homologous polypeptides, nucleic acids homologous to those encoding peptides, as well as antibodies raised against the proteins, fragments, and homologous
  • polypeptides are provided. Methods for the use of these compositions are provided in view of the discoveries related to biological function.
  • the genus Entamoeba is defined by a number of cellular and biological markers. These markers define a genus Entamoeba, which exhibit common characteristics, but which may vary as better detection methods and functional tests are developed. However, the term
  • Entamoeba as used herein, is intended to include
  • E tamoeba strains often invade the body causing amoebiasis.
  • An invasiv infection includes infection within the intestines, or into the body through the intestinal wall.
  • the reagents provided herein are useful for both types of infections.
  • An immunodominant 125 kDa surface antigen has been isolated from various strains of Entamoeba. Table I sets forth the genomic sequences and corresponding amino acid sequences of two alleles of the 125 kDa
  • immunodominant surface antigen from a pathogenic strain designated HM1:IMSS and a non-pathogenic strain
  • compositions may be derived from such other alleles or the nucleic acid or amino acid sequences of such alleles, as described in more detail herein after.
  • Table I Inferred amino acid sequence and nucleotide sequence of coding region and flanking region obtained from genomic clone pBSgM17-1. The sequence of the internal EcoRI fragment was identical in both genomic clones (pBSgM17-1/2) and the cDNA clone ⁇ cM17. Shown aligned below is the partial nucleotide sequence of PCR amplification products derived from non-pathogenic isolate REF291. Nucleotide substitutions are underlined and amino acid substitutions are indicated below the partial sequence derived from REF291. Two boundaries are marked between Gly186 and Ile187 (corresponding to A558 and A559) and between Phe825 and Gln826 (corresponding to C2475 and C2476). These boundaries separate region I (amino or 5' proximal of the former boundary) from region II (between the boundaries) and region II from region III (carboxy or 3' proximal of the latter boundary).
  • N-terminal (n) region with a single positively charged residue an 8 amino acid long hydrophobic core (h) region and a 7 amino acid long polar C-terminal (c) region with an amino acid composition similar to those seen in other signal sequences.
  • the antigen is either a peripheral membrane protein or it may be anchored in the membrane by other means such as a glycophospholipid anchor.
  • the hydrophobic amino terminal itself may serve to anchor the antigen in the membrane with the C-terminal externally exposed as no additional trans membrane domains could be discerned.
  • Asp Thr Asn Ser lie Tyr Val Pro Asp Val Ile Thr Asn Asp Pro Gln Met Thr Asn Glu
  • M17 protein has been determined to be membrane associated. When these proteins are cross-linked with multivalent antibody molecules, live
  • the immunodominant antigen is determined to be a surface antigen and attachment by antibodies is likely to cause significant disruption of the infective cycle of the trophozoites.
  • the present invention in one embodiment, provides polypeptides which are related to the 125 kDa surface antigen and which will usually be either haptenic or antigenic, typically including at least about 6 amino acids, usually at least about 9 amino acids, and more usually about 12 or more amino acids found contiguously within a natural form of the 125 kDa immunodominant surface antigen protein.
  • Longer polypeptides will also find use, up to and including substantially full length of the natural protein and larger.
  • the contiguous amino acids may be located within any region of the
  • polypeptide but preferably in regions I or III of Table I, and will correspond to at least one epitope site which is characteristic of the particular immunodominant surface antigen protein.
  • epitope site it is meant that the epitope site will allow immunologic detection of the exposed polypeptide segment in a cell sample with reasonable assurance, in most cases allowing
  • polypeptides such as an immunodominant surface antigen from non-pathogenic strains.
  • the polypeptides will also be capable of inducing an immune response in a host when used in vaccines, in therapeutic compositions, and for preparing polyclonal and monoclonal antibodies.
  • compositions and methods of the present invention are particularly useful for identifying and treating pathogenic amoebic infection, but it will also be possible to identifying epitopes of the surface antigen which are conserved among pathogenic and non-pathogenic amoeba.
  • Use of polypeptides and nucleic acid probes based on the sequences of such conserved epitopes allows detection and treatment of both pathogenic and non-pathogenic amoeba.
  • compositions based on epitopes found in pathogenic forms only allows specific detection and treatment of pathogenic amoeba.
  • epitopes found in non-pathogenic forms only allow specific detection and treatment of non-pathogenic amoeba. Regions of particular importance for
  • pathogenic strains from non-pathogenic strains will be those located at the sites of difference between the amino acid or nucleotide differences, as indicated in Table III.
  • polypeptide In a preferred aspect, the polypeptide
  • compositions will be either identical or equivalent to a sequence set forth in Table I.
  • equivalent it is meant for the purposes of defining polypeptides that a substantial identity of amino acid sequences exists over a stretch of at least about 10 residues, where each position of the corresponding sequences is either
  • immunodominant surface antigen protein i.e., IL-12 immunodominant surface antigen protein
  • immunological analogs may be produced by either of at least two general approaches.
  • polypeptides having fewer than about 50 amino acids, more usually fewer than about 20 amino acids can be synthesized by the
  • amino acid sequences of such synthetic polypeptides will usually be based on the sequences described in Table I, preferably regions I or III.
  • a second and preferred method for synthesizing the polypeptides of the present invention involves the expression in cultured cells of recombinant DNA molecules encoding a desired portion of an immunodominant surface antigen gene.
  • the gene may itself be natural or
  • the natural gene is obtainable from cDNA or genomic libraries, as described herein. Using such segments or genes, additional
  • homologous gene sequences might be isolated from other related strains or sequences which encode peptides equivalent to those described above. Such genes
  • epitopic similarity can serve as a means for selecting equivalent peptides.
  • the polypeptides are usually obtained in substantially pure form, that is, typically about 50% w/w or more purity, substantially free of interfering proteins and contaminants.
  • the immunodominant surface antigen polypeptides are isolated or synthesized in a purity of at least about 80% w/w and, more
  • the proteins may be purified by use of the antibodies described hereinafter using immunoadsorbent affinity chromatography. Such affinity chromatography is performed by first linking antibodies or appropriate affinity reagents to the solid support and then
  • the linked antibodies or affinity reagents with the source of the immunodominant surface antigen proteins, e.g., lysates of protozoa which naturally produce immunodominant surface antigen or which produce immunodominant surface antigen as a result of
  • Useful production cultures include the insect
  • polypeptide sequence of distinct forms of immunodominant surface antigens have been isolated and characterized. Isolated DNA segments encoding the immunodominant surface antigens can be expressed to provide isolatable
  • nucleic acids are substantially homologous to encoding sequences, either natural or artificial. These homologous
  • polynucleotides will find use as probes or primers for locating or characterizing natural or artificial nucleic acids encoding the surface antigen peptides.
  • Substantial homology or substantial identity of a nucleic acid sequence indicates either that: a) there is greater than about 65%, typically greater than about 75%, more typically greater than about 85%, preferably greater than about 95%, and more preferably greater than about 98% homology with a disclosed segment of at least about 10 contiguous nucleotides; or b) the homologous nucleic acid sequence will hybridize to the consensus sequence or its complementary strand under stringent conditions of temperature and salt concentration. These stringent conditions will generally be at temperatures greater than about 22oC, usually greater than about 30oC and more usually greater than about 45oC. Salt
  • concentrations are generally less than about 1 M, usually less than about 500 mM, and preferably less than about 200 mM.
  • the combined conditions will be more important than either the salt concentration or the temperature alone.
  • stringency include GC content of the sequence, extent of complementarity of the sequences and length of segments involved in the hybridization, besides composition of buffer solutions used in the hybridization mixture.
  • Nucleic acids can be synthesized based directly on the DNA sequences reported in Table I.
  • Polynucleotides may be synthesized by known techniques, for example, short single-stranded DNA fragments may be prepared by the phosphoramidite method described by
  • a double-stranded fragment may then be obtained either by synthesizing the complementary strand and annealing the strands together under appropriate
  • Polymerase chain reaction techniques may be used for production of probes or amplification of
  • DNA constructs capable of introduction to and expression in an in vitro cell culture will often be incorporated in DNA constructs capable of introduction to and expression in an in vitro cell culture.
  • the DNA constructs will be suitable for replication in a unicellular host, such as yeast or bacteria, but may also be intended for introduction and integration within the genome of cultured mammalian, protozoa, or other eucaryotic cell lines.
  • DNA constructs prepared for introduction into bacteria or yeast will usually include a replication system recognized by the host, the appropriate immunodominant surface antigen DNA fragment encoding the desired polypeptide product, transcriptional and translational initiation regulatory sequences joined to the 5'-end of the immunodominant surface antigen DNA sequence, and transcriptional and translational termination regnlatory sequences joined to the 3'-end of the immunodominant surface antigen
  • the transcriptional regulatory sequences will typically include a heterologous promoter which is recognized by the host. Conveniently, available
  • expression vectors which include the replication system and transcriptional and translational regulatory
  • immunodominant surface antigen DNA sequence may be employed.
  • iiinfection may be achieved.
  • pathogenic infection is characterized by
  • Non-pathogenic infection is likewise
  • infection may use epitopes common to both pathogenic and non-pathogenic strains, but distinguishing will usually be directed to epitopes involving amino acids which differ and are indicated in Table I.
  • immunodominant surface antigen protein can be produced by in vitro or in vivo techniques.
  • In vitro techniques involve in vitro exposure of lymphocytes to the antigenic polypeptides or fragments, while in vivo techniques require the injection of the polypeptides or fragments into any of a wide variety of target immune systems, such as vertebrates. Suitable vertebrates are typically non- human, including mice, rats, rabbits, sheep, goats, and the like.
  • Polypeptides having more than about 5 to 30 amino acids, particularly more than about 50 to 100 amino acids, may serve directly as immunogens. if the
  • polypeptide is smaller than about 10 kD, particularly less than about 6 kD, it may be necessary to join the polypeptide to a larger molecule to elicit the desired immune response.
  • the immunogens are then injected into the animal according to a predetermined schedule, and the animals are bled periodically with successive bleeds generally having improved titer and specificity.
  • the injections may be made intramuscularly,
  • an adjuvant such as incomplete Freund's
  • monoclonal antibody also defines a class of proteins which are targets for specific binding.
  • monoclonal antibodies can be obtained by preparing immortalized cell lines capable of producing antibodies having the desired specificity.
  • the FA7 monoclonal antibody is produced by such a cell line.
  • Such immortalized cell lines may be produced in a variety of ways depending upon the target immune system.
  • a small vertebrate such as a mouse
  • the vertebrate is then killed, usually several days after the final immunization, the spleen removed, and the spleen cells immortalized.
  • the manner of immortalization is not critical.
  • the most common technique is fusion with a myeloma cell fusion partner, as first described by Kohler and Milstein (1976) Eur. J. Immunol. 6:511-519.
  • Other techniques include EBV transformation, transformation with bare DNA, e.g., oncogenes, retroviruses, etc., or any other method which provides for stable maintenance of the cell line and production of monoclonal antibodies. Common techniques are described, e.g., in Lane and Harlow, (1988)
  • the manner of fusion is usually not critical and various techniques may be employed.
  • the spleen cells and myeloma cells are combined in the presence of a nonionic detergent, usually polyethylene glycol, and other additives such as Dulbecco's Modified Eagle's
  • the nonionic detergent is rapidly removed by washing the cells.
  • the fused cells are promptly dispensed in small culture wells (usually in a microtiter plate) at
  • the myeloma cell line has been mutated to be sensitive to a lethal agent, typically being HAT
  • the cell line can be maintained as viable cultures and/or by lyophilization or frozen storage.
  • Hybridomas providing high titers are
  • cytotoxic antibodies e.g., IgG 2a , IgG 2b , IgG 3 and IgM, may be selected for use in therapeutic treatment of pathogenic infections.
  • antibodies having very high specificity fsr the antigenic site are desirable.
  • monoclonal antibodies may be isolated from the desired hybridomas.
  • the yield of antibodies obtained is usually low.
  • the yield may be enhanced by various techniques, such as injection of the hybridoma cell line into the peritoneal cavity of a vertebrate host which will accept the cells.
  • Monoclonal antibodies may then be harvested from the ascites fluid or the blood. Proteinaceous and other contaminants will usually be removed from the monoclonal antibodies prior to use by conventional technique, e.g., chromatography, gel filtration, precipitation,
  • the polypeptide selected should represent one or more epitopic sites which are unique to the desired immunodominant surface antigen protein and which can distinguish immunodominant surface antigen from closely related proteins.
  • Such unique epitopes are found on polypeptides expressed by cells containing sequences disclosed in Table I.
  • One particular example of such is the FA7 monoclonal antibody.
  • polypeptides and antibodies of the present invention may be used with or without modification.
  • the polypeptides and antibodies will be labelled by joining, either covalently or non-covalently, a substance which provides for a detectable signal.
  • labels and conjugation techniques are known and are reported extensively in both the scientific and patent literature. Suitable labels include
  • tissue samples including tissue samples, sputum, and lung lavage samples.
  • a tissue sample may be fixed in formalin, B-5, or other standard histological preservative, dehydrated and embedded in paraffin as is routine in any hospital pathology laboratory. Sections may then be cut from the paraffinized tissue block and mounted on glass slides.
  • the immunodominant surface antigen proteins if present, may then be detected in the cytoplasm or extracellular space by exposure with labeled immunodominant surface antigen antibody or exposure to unlabelled anti- immunodominant surface antigen antibody and a labeled secondary antibody. Because the antigen is a surface antigen and exposed extracellularly, it is unnecessary to denature a sample, allowing assay of non-denatured target sample. This may also allow further live
  • Sputum and lavage samples are typically prepared in a similar manner where the sample is first dehydrated by exposure to a dehydrating agent, typically a low molecular weight alcohols
  • a dehydrating agent typically a low molecular weight alcohols
  • Liquid phase immunoassays or Western blot analysis will also find use in the detection of the immunodominant surface antigen proteins particularly in body fluids when the proteins are shed into such fluids, e.g., blood or stool.
  • Solid tissue and sputum samples may also be assayed in liquid phase systems by lysing the cellular sample in order to release the protein. Once the protein is released, the sample will be placed in a suitable buffer, the sample buffer subjected to a
  • kits for using them are also provided. Similar kits may be prepared using particular nucleic acid probes.
  • the kits will typically have at least one compartment comprising the detection reagent to be applied to an appropriate sample.
  • the reagent may be attached to a dipstick or similar physical entity.
  • the reagent may be contained in a liquid solution to which a sample is added.
  • a compartment containing the active ingredient may be a sealed envelope, a plastic bag, a vial, a bottle, a jar, an ampule, a well, or any other protective package.
  • immunodominant surface antigen antibodies may be coupled to toxins, such as diphtheria toxin and the ricin A chain, and administered to patients, or hosts, suffering from pathogenic Entamoeba infections.
  • toxins such as diphtheria toxin and the ricin A chain
  • the use of antibody conjugated toxins in cancer therapy is described generally in U.S. Patent Nos. 4,093,607;
  • Antibodies alone may also find use in treatment, particularly by blocking or interrupting some functional activity of immunodominant surface antigen protein which contributes to the pathogenic phenotype.
  • the binding fragments will be joined to active substances, such as proteolytic enzymes or glycosidases, in order to enhance interference with amoeba infection.
  • active substances such as proteolytic enzymes or glycosidases.
  • the binding fragments will specifically bind to the trophozoites and the active substances will act to destroy the protozoa.
  • Vaccines against Entamoeba infections are producible using the compositions of the present
  • vaccines may be passive, consisting of Ig supplementation which interferes with amoeba growth or toxicity.
  • vaccines may be active
  • a vaccine prepared utilizing the immunodominant surface antigen or immunogenic equivalents thereof can consist of: (a) fixed cells either recombinantly altered to produce these antigen proteins or cells from the
  • Entamoeba itself; (b) a crude cell extract; (c) a
  • immunodominant surface antigen preparation partially or completely purified immunodominant surface antigen preparation. Fusion proteins combining a segment of the immunodominant surface antigen will be readily prepared.
  • a multiple vaccination may be achieved by fusing these antigens with other target antigens on a single protein, inducing protection against multiple infectant vectors.
  • a "cocktail" of different immunogens may be simultaneously administered or inoculated.
  • These immunogens can be prepared in vaccine dose form by well-known procedures. These vaccines can be in the form of an injectable dose and may be administered intramuscularly, intravenously, or subcutaneously. These vaccines can also be
  • these immunogens can be combined with a suitable physiologically acceptable carrier, for example, it can be administered in water, saline,
  • alcohol alcohol, fats, waxes, or buffered vehicles with or without various adjuvants or immunomodulating agents.
  • Suitable immunological adjuvants or agents include, but are not limited to, aluminum hydroxide, aluminum
  • phosphate aluminum potassium sulfate (alum), beryllium sulfate, silica, kaolin, carbon, water-in-oil emulsions, oil-in-water emulsions, muramyl dipeptide, bacterial endotoxin, lipid X, Corynebacterium parvum
  • polyribonucleotides sodium alginate, lanolin,
  • lysolecithin lysolecithin, vitamin A, saponin, liposomes, levamisole, DEAE-dextran, blocked copolymers or other synthetic adjuvants.
  • adjuvants are available commercially from various sources, for example, Merck Adjuvant 65 (Merck and Company, Inc., Rahway, N.J.) or Freund's
  • adjuvants are Amphigen (oil-in-water), Alhydrogel
  • the proportion of xmmunogen and adjuvant can be varied over a broad range so long as both are present in effective amounts.
  • the amount of the immunogen can range broadly from about l.o pg to about 100 mg per kg of host, usually at least about 10 pg, typically at least about 100 pg, and preferably at least about l ng per kg of host weight, and usually less than about 1 mg, typically less than about 10 ⁇ g, and more typically less than about 1 ⁇ g, and preferably less than about 100 ng per kg of host.
  • a preferable range is from about 10 pg to about 100 ng per dose.
  • a suitable dose size will usually be between about .01 and 5 ml, preferably about 0.5 ml for a 20-59 kg organism.
  • Comparable dose forms can also be prepared for parenteral administration to smaller or larger animals, but the amount of immunogen per dose will usually be smaller, for a smaller animal.
  • a regiment of between 1 and 4 doses can be used with the injections spaced out over a 2 to 6-week period.
  • a two-dose regimen is used.
  • the second dose of the vaccine then should be administered some weeks after the first dose, for example, about 2 to 4 weeks later.
  • Animals that have been previously exposed to Entamoeba or have received colostral antibodies from the mother may require booster injections.
  • the booster injection is preferably timed to coincide with the vulnerable point in the life cycle of the Entamoeba.
  • Periodic revaccination is advisable under certain conditions.
  • the vaccine may also be combined with other vaccines for other diseases to produce multivalent vaccines. It may also be combined with other agents.
  • medicaments for example, antibiotics.
  • pharmaceutically effective amount of the vaccine can be employed with a pharmaceutically acceptable carrier such as viral capsid protein complex or diluent understood to be useful for the vaccination of animals.
  • a pharmaceutically acceptable carrier such as viral capsid protein complex or diluent understood to be useful for the vaccination of animals.
  • vaccines may be prepared according to methods well-known to those skilled in the art as set forth, for example, in Tizard, L., An Introduction to Veterinary Immunology, 2nd Ed (1982), which is
  • cM17 cDNA clone encoding this antigen (M17) was isolated from a ⁇ gtll expression library of the virulent strain E.
  • HMI:IMSS histolytica HMI:IMSS. Monospecific antibodies, purified by binding to phage lysate of cM17, and monoclonal
  • glycosylation sites and is unusually rich in tyrosine and asparagine residues.
  • a distinctly hydrophobic amino terminal region may serve as membrane anchor or signal sequence.
  • Laredo were grown in TYI-S-33 media as described by
  • Polyxenic isolates were grown in liquid Robinson's medium supplemented with 10% bovine serum and containing 5 ⁇ g per ml of medium of each of the following antibiotics: kanamycin, erythromycin, and ampicillin. Amoebae were pelleted by centrifugation at 900 rpm and washed twice with phosphate buffered saline, pH 7.5 (PBS). Polyxenic amoebae were further purified by centrifugation through a Percoll/PBS cushion at 3000 rpm in a refrigerated
  • a membrane fraction was prepared as described in Aley, et al. (1980) J. EXP. Med. 152: 391-404, and diluted 1:1 with PBS and complete Freund's adjuvant.
  • mice were immunized intraperitoneally with 300 ⁇ g every two weeks until titers reached 1:5000 as assayed by
  • the 220 kDa antigens represents an N-acetyl-glu ⁇ osamine adherence lectins
  • the 160 kDa antigen represents an N-acetyl-D-galactosamine adherence lectin
  • the 96 kDa antigen represents an integral membrane protein.
  • Human immune serum, hyb ⁇ doma harvest fluid from clone FA7, and purified monospecific antiserum was added to live trophozoites at 1:500, 1:2000, and
  • Antibody-antigen caps were induced in HM1:IMSS trophozoites by incubation with the pooled patient serum, monoclonal antibody FA7, or monospecific antibody recovered after specific binding and elution of pooled patient sera to phage lysates of cDNA clone ⁇ cM17. See Fig. 2.
  • a negative control antibody monoclonal anti-actin antibody
  • histolytica HM1:IMSS has been described previously. See, e.g. Edman, et al. (1987) Proc. Natl. Acad. Sci. USA. 84: 3024-3028.
  • a genomic library from E. histolytica has been described previously. See, e.g. Edman, et al. (1987) Proc. Natl. Acad. Sci. USA. 84: 3024-3028.
  • HM1:IMSS was made by adding 600 ⁇ l of Nal (GeneClean kit;
  • BiolOl to 200 ⁇ l (approximately 20 ⁇ g DNA) of agarose embedded nuclei in an Eppendorf tube and melted by incubation at 60oC for 5 min. Twenty ⁇ l of glassmilk was added, and suspended well and the mixture incubated at room temperature for 5 min. The sample was vortexed for 1 min to shear the DNA and spun in a microfuge for 5 sec. After removal of the supernatant the pellet was suspended in 1 ml wash buffer by vortexing for 30 sec. The
  • the ⁇ gtll cDNA library (3 ⁇ 10 5 phage) was screened with the pool of 29 patient sera at a 1:200 dilution.
  • the genomic library was screened with the 32 P- ⁇ -dCTP labeled EcoRI fragment of ⁇ cM17.
  • oligonucleotide primers derived from the cDNA sequence.
  • the nucleotide sequence of the cDNA was identical in both genomic clones.
  • An additional 556 bp of 5' and 870 bp of 3' sequence yielded an ORF of 3345 bp which was also identical in both genomic clones.
  • the size of this ORF (gene M17) is in reasonable agreement with the mRNA size of ⁇ 3000 bp determined by Northern blot analysis.
  • the inferred amino acid sequence predicts a 125 kDa protein.
  • the 5' flanking sequence of gene M17 shares striking similarities with the 5' flanking region of both actin and ferredoxin genes, the only other genes of E. histolytica where sequence has been determined. See Table II.
  • the transcriptional start site of M17 was mapped to an adenine residue 17 bp 5' of the start codon by primer extension sequence analysis using an
  • sequence motif shared amongst these genes is YATTTAAA present at -29, -31, -32, and -32 for the M17, actin*, actin ⁇ , and ferredoxin gene flanking sequences, respectively. This sequence motif does not conform with the Goldberg-Hogness promoter consensus sequence
  • TATAAATA which in eukaryotic genes is located 25-30 bp upstream of the transcriptional start site.
  • Table II Alignment of the 5' flanking sequences from genes M17, actin* (one reported sequence), actin ⁇ (a second reported sequence) and ferredoxin ⁇ ; a likely Goldberg-Hogness consensus sequence at -29, -31, -32, and -32, respectively, is bracketed.
  • the 5' end of the mRNA is in bold face and follows the ⁇ symbol, and the initial ATG methionine codon is indicated. Sequence similarities around the cap site are ATTCA or ATTAA.
  • Southern blot and sequence analysis of the M17 gene and limited flanking regions indicate that this surface antigen is encoded by a single copy gene.
  • the nucleotide sequence of both genomic clones and the cDNA clone is identical.
  • histolytica isolates as well as E. histolytica-like
  • reaction mixtures 50 ⁇ l contained 25 pmol of each of the two oligonucleotide primer pairs SRO18 [5-GCAACTAGTGTTAGTTATAC3'] with SRO21
  • PCR parameters were 35 thermal cycles consisting of a 1 min denaturation at 94•c followed by a 3 min annealing period at 42oC, a 3 min ramp and a 4-min extension period at 72oC
  • the amplification products were restricted with Eco RI and Spe I endonucleases and purified for
  • SRO18/SRO21 as primers on genomic template DNA derived from non-pathogenic isolate REF 291.
  • REF 291 had 145 nucleotide substitutions over 1410 residues (10.3%) as compared to the sequence of ⁇ cM17 (HM1:IMSS) See Table I. These substitutions result in 57 amino acid differences per 470 residues (12.1%).
  • a computer search of published protein sequences with the entire 3345 bp M17 gene sequence revealed that the internal gene fragment represented by the ⁇ cM17 insert encoded a protein sequence similar to that deduced for a DNA fragment isolated from non-pathogenic and pathogenic strains, of E.
  • histolytica HM1:IMSS laboratory strains must have arisen from more than one nucleotide substitution and are therefore unlikely to represent cDNA synthesis or sequencing artifacts.
  • 470 amino acid sequence derived from the PCR product of non-pathogenic isolate REF291 was compared to isolate SAW 1734, six amino acid substitutions (1.3%) were detected. Over the same 470 amino acids, 61 amino acid residues (12.9%) differ among the pathogenic HM1:IMSS and non-pathogenic SAW 1734 strains. Overall there are 65 variable residues over a stretch of 470 amino acids (13.8%) when these four isolates were compared. See Table III.
  • Table III Alignment of the amino acid sequences inferred from nucleotide sequences of cDNA and genomic clones (HM1:IMSS*) and of PCR amplification products (REF291*) with those published by Tannich et al.
  • HM1 IMSS* PITLNFDORVDAGAAVAYVGRWFTONPSDWAAACVGKDGLINYGNWGPLHEMN
  • HM1 IMSS# PITINFDORVDAGAAVAYVDRWFTONPSDWAAACVGKDGLINYGNWGPLHEMN
  • HM1 IMSS* lJHMQGTYLKGGNWGISNPGEETNNVMTSINYILYTNIAGHRNQGLSGWNYVSD
  • HM1 IMSS* GYSTIYKILKGENDQPHLRSYVNMAHAFGTDTLIALVKSYYGLWYENNFESKY
  • HM1 IMSS# GYSTIYKILKGENDOPHLRSYVNMAHAFGTDTLIALVKSYYGLWYENNFESKY
  • HM1 IMSS* SIKRDSTSAFCLLAALVTKRDTRYLCSLFKYDIOSNVSEAIKNMNYPTYYPFF
  • HM1 IMSS# SIKRDSTSAFCLLAALVTKRDTRYLCSLFKYDIQSNVSEAIKNMNYPTYYPFF
  • HM1 :IMSS* NLYAMSYNGNYYGRPYKIPYGRTRLNFTATTAIDPKATSVSYTIKSGLTKGKL
  • HM1 IMSS# NLYAMSYNGNYYGRPYKIPYGRTRLNFTATCSIDPKATSVSYTIKSGLTKGKL
  • HM1 IMSS* ERVEDNVYDYTPFFGIEENDTFVLNIDCWNGEKVHIEOEGGTFELDPHOVEY
  • HM1 IMSS# ERVEDNVYDYTPFFGIEENDTFVLNIDCWNGEKVHIEOEGGTFELDPHOVEY
  • HM1 IMSS* EVYKDVOTRDMAOAINIIQNKTRNDTGRASFFGIGTYNDGSMOSMLVEKGKLI
  • HM1 IMSS# EVYKDVQTRDMAQAINIIQNKTRNDTGRASFFDIGTYNDGSMQSMLVEKGKLI
  • HM1 IMSS* VPKSGYYTLFMKADDLGRLLLNITGEYEOLLDVKTYLGGYSKTLNGSYATVKL
  • HM1 IMSS# VPKSGYYTLFMKADDLGRLLLNITGEYEQLLDVKTYLGGYSKTLNGSYATVKL
  • HM1 IMSS* EKDVGYPFILYNLNTGGOGFIRIGYCYHGTEESSVDVSKCSVSDIGS
  • HM1 IMSS# EKDVGYPFILYNLNTGGOGFIRIGYCYHGTEESSVDVSKCSVSDIGS

Landscapes

  • Chemical & Material Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • General Health & Medical Sciences (AREA)
  • Analytical Chemistry (AREA)
  • Biophysics (AREA)
  • Medicinal Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • Biochemistry (AREA)
  • Zoology (AREA)
  • Molecular Biology (AREA)
  • Wood Science & Technology (AREA)
  • Immunology (AREA)
  • Engineering & Computer Science (AREA)
  • Biotechnology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Physics & Mathematics (AREA)
  • Oncology (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Veterinary Medicine (AREA)
  • Microbiology (AREA)
  • Public Health (AREA)
  • Communicable Diseases (AREA)
  • Animal Behavior & Ethology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Engineering & Computer Science (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Toxicology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)

Abstract

Un gène codant un antigène de surface immunodominant de 125 kDa provenant de Entamoeba histolytica est identifié et caractérisé. Le gène et la protéine permettent de produire des réactifs de vaccination et de traitement contre l'amibiase.
EP91915391A 1990-08-24 1991-08-21 Antigenes de surface immunodominants d'entamoeba histolytica Withdrawn EP0550465A1 (fr)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US57291690A 1990-08-24 1990-08-24
US572916 1990-08-24

Publications (2)

Publication Number Publication Date
EP0550465A1 true EP0550465A1 (fr) 1993-07-14
EP0550465A4 EP0550465A4 (fr) 1994-04-06

Family

ID=24289889

Family Applications (1)

Application Number Title Priority Date Filing Date
EP91915391A Withdrawn EP0550465A1 (fr) 1990-08-24 1991-08-21 Antigenes de surface immunodominants d'entamoeba histolytica

Country Status (6)

Country Link
EP (1) EP0550465A1 (fr)
JP (1) JPH06500548A (fr)
AU (1) AU8445491A (fr)
BR (1) BR9106968A (fr)
MX (1) MX9100808A (fr)
WO (1) WO1992003457A1 (fr)

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6727223B2 (en) 2000-08-04 2004-04-27 Urex Biotech, Inc. Treatment of microbial infections with bacterial proteins and peptides

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1986002361A1 (fr) * 1984-10-19 1986-04-24 Technology Licence Company Limited Anticorps monoclonaux et leur utilisation
US5004608A (en) * 1988-01-13 1991-04-02 The University Of Virginia Alumni Patents Foundation Amebiasis vaccine

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1986002361A1 (fr) * 1984-10-19 1986-04-24 Technology Licence Company Limited Anticorps monoclonaux et leur utilisation
US5004608A (en) * 1988-01-13 1991-04-02 The University Of Virginia Alumni Patents Foundation Amebiasis vaccine

Non-Patent Citations (4)

* Cited by examiner, † Cited by third party
Title
EXPERIMENTAL PARASITOLOGY vol. 61, no. 3 , June 1986 pages 390 - 397 LIBRADO ORTIZ-ORTIZ ET AL. 'Entamoeba histolytica: specific antigen recognized by a monoclonal antibody' *
J. EXP. MED. vol. 172, no. 3 , September 1990 pages 879 - 888 URSULA EDMAN ET AL. 'Characterization of an immuno-dominant variable surface antigen from pathogenic and nonpathogenic Entamoeba histolytica' *
See also references of WO9203457A1 *
THE JOURNAL OF INFECTIOUS DISEASES vol. 156, no. 2 , August 1987 pages 334 - 343 BRUCE E. TORIAN ET AL. 'Use of monoclonal antibodies to identify, characterize , and purify a 96,000-Dalton surface antigen of pathogenic Entamoeba histolytica' *

Also Published As

Publication number Publication date
EP0550465A4 (fr) 1994-04-06
AU8445491A (en) 1992-03-17
MX9100808A (es) 1992-11-01
WO1992003457A1 (fr) 1992-03-05
JPH06500548A (ja) 1994-01-20
BR9106968A (pt) 1993-09-21

Similar Documents

Publication Publication Date Title
US5324630A (en) Methods and compositions for diagnosing lyme disease
Ree et al. Determination and geographical distribution of Orientia tsutsugamushi serotypes in Korea by nested polymerase chain reaction.
US6172192B1 (en) Toxoplasma gondii antigen Tg20
EP0153188B1 (fr) Production de vaccins contre le paludisme
US5633139A (en) Toxoplasma gondii P28 gene and methods for its use
AU778791B2 (en) DNA encoding structural protein-1 of infectious salmon anaemia virus and uses thereof
US5549898A (en) Immunogenic anaplasma marginale surface antigens, compositions, and methods of use
US5215917A (en) Nucleotide sequence encoding the Toxoplasma gondii P22 gene
WO1992003457A1 (fr) Antigenes de surface immunodominants d'entamoeba histolytica
US6277973B1 (en) Cloning and expression of a DNA sequence encoding a 41 kDa cryptosporidium parvum oocyst wall protein
US6808714B2 (en) Detection of sarcocystis neurona
EP0656063A1 (fr) Sequences nucleotidiques codant les proteines de cryptosporidius, polypeptides codes par lesdites sequences et leurs materiels d'utilisation
US6296855B1 (en) 17-KDA Brucella abortus antigen, recombinant polypeptides, nucleic acids coding for the same and use thereof in diagnostic and prophylactic methods and kits
WO1994020536A1 (fr) Methodes, compositions et trousses pour le diagnostic de la maladie de lyme
CA2313609C (fr) Antigene de trypanosoma cruzi, gene codant pour celui-ci, et methodes de detection et de traitement de la maladie de chagas
AU710439B2 (en) Recombinant 170 KD subunit lectin of Entamoeba histolytica and methods of use
US5820864A (en) Trypanosoma cruzi antigen, gene encoding therefor and methods of detecting and treating chagas disease
US6204003B1 (en) Methods for the diagnosis of feline infectious anemia
US5422428A (en) Immunization against babesiosis using purified surface antigens of Babesia bigemina and similar immunogens
US6514697B1 (en) Methods for detection of Crytosporidium species and isolates and for diagnosis of Cryptosporidium infections
JP4727059B2 (ja) ＢａｂｅｓｉａｇｉｂｓｏｎｉＰ５０抗原をコードする核酸分子とその発現産物の利用
JPS61501267A (ja) マラリアワクチンの構造におけるまたは関する改良
MXPA00005473A (en) Trypanosoma cruzi

Legal Events

Date Code Title Description
PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

17P Request for examination filed

Effective date: 19930305

AK Designated contracting states

Kind code of ref document: A1

Designated state(s): AT BE CH DE DK ES FR GB GR IT LI LU NL SE

RHK1 Main classification (correction)

Ipc: C12N 15/30

A4 Supplementary search report drawn up and despatched

Effective date: 19940215

AK Designated contracting states

Kind code of ref document: A4

Designated state(s): AT BE CH DE DK ES FR GB GR IT LI LU NL SE

17Q First examination report despatched

Effective date: 19960102

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN

18D Application deemed to be withdrawn

Effective date: 19960715