EA044061B1 - NEW FUSION PROTEINS BASED ON HUMAN FERRITIN AND PROTEASE CLEAVABLE PEPTIDES AND THEIR APPLICATION AS CARRIERS OF CHEMOTHERAPEUTICS - Google Patents
NEW FUSION PROTEINS BASED ON HUMAN FERRITIN AND PROTEASE CLEAVABLE PEPTIDES AND THEIR APPLICATION AS CARRIERS OF CHEMOTHERAPEUTICS Download PDFInfo
- Publication number
- EA044061B1 EA044061B1 EA202090897 EA044061B1 EA 044061 B1 EA044061 B1 EA 044061B1 EA 202090897 EA202090897 EA 202090897 EA 044061 B1 EA044061 B1 EA 044061B1
- Authority
- EA
- Eurasian Patent Office
- Prior art keywords
- hft
- seq
- amino acid
- pase
- fusion protein
- Prior art date
Links
- 102000037865 fusion proteins Human genes 0.000 title claims description 44
- 108020001507 fusion proteins Proteins 0.000 title claims description 44
- 108090000765 processed proteins & peptides Proteins 0.000 title claims description 33
- 102000004196 processed proteins & peptides Human genes 0.000 title claims description 29
- 102000008857 Ferritin Human genes 0.000 title claims description 18
- 108050000784 Ferritin Proteins 0.000 title claims description 18
- 238000008416 Ferritin Methods 0.000 title claims description 18
- 239000000969 carrier Substances 0.000 title description 4
- 108091005804 Peptidases Proteins 0.000 title description 2
- 239000004365 Protease Substances 0.000 title description 2
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 title 1
- HBTBNXFVJYRYGI-UHFFFAOYSA-M hexadecane-1-sulfinate Chemical compound CCCCCCCCCCCCCCCCS([O-])=O HBTBNXFVJYRYGI-UHFFFAOYSA-M 0.000 title 1
- 108090000623 proteins and genes Proteins 0.000 claims description 55
- 102000004169 proteins and genes Human genes 0.000 claims description 51
- 235000018102 proteins Nutrition 0.000 claims description 50
- 229960001156 mitoxantrone Drugs 0.000 claims description 45
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 claims description 44
- KKZJGLLVHKMTCM-UHFFFAOYSA-N mitoxantrone Chemical compound O=C1C2=C(O)C=CC(O)=C2C(=O)C2=C1C(NCCNCCO)=CC=C2NCCNCCO KKZJGLLVHKMTCM-UHFFFAOYSA-N 0.000 claims description 44
- 239000002105 nanoparticle Substances 0.000 claims description 36
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 claims description 30
- 235000018417 cysteine Nutrition 0.000 claims description 30
- 229920001184 polypeptide Polymers 0.000 claims description 26
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 claims description 24
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 claims description 24
- 206010028980 Neoplasm Diseases 0.000 claims description 21
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 claims description 21
- 229960004679 doxorubicin Drugs 0.000 claims description 21
- 229930195712 glutamate Natural products 0.000 claims description 21
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 claims description 19
- 108010000684 Matrix Metalloproteinases Proteins 0.000 claims description 19
- 102000002274 Matrix Metalloproteinases Human genes 0.000 claims description 19
- BAORCAMWLWRZQG-UHFFFAOYSA-N genz 644282 Chemical compound COC1=C(OC)C=C2C(=O)N(CCNC)C3=C(C=C4C(OCO4)=C4)C4=NC=C3C2=C1 BAORCAMWLWRZQG-UHFFFAOYSA-N 0.000 claims description 17
- 150000001413 amino acids Chemical group 0.000 claims description 16
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 claims description 15
- 101001002987 Homo sapiens Ferritin heavy chain Proteins 0.000 claims description 14
- 102000054087 human FTH1 Human genes 0.000 claims description 14
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 claims description 13
- 235000001014 amino acid Nutrition 0.000 claims description 13
- 230000001225 therapeutic effect Effects 0.000 claims description 13
- 239000004480 active ingredient Substances 0.000 claims description 12
- 229940009098 aspartate Drugs 0.000 claims description 12
- 239000000178 monomer Substances 0.000 claims description 12
- 238000003776 cleavage reaction Methods 0.000 claims description 11
- PEZPMAYDXJQYRV-UHFFFAOYSA-N pixantrone Chemical compound O=C1C2=CN=CC=C2C(=O)C2=C1C(NCCN)=CC=C2NCCN PEZPMAYDXJQYRV-UHFFFAOYSA-N 0.000 claims description 11
- 229960004403 pixantrone Drugs 0.000 claims description 11
- 230000007017 scission Effects 0.000 claims description 11
- 125000000539 amino acid group Chemical group 0.000 claims description 10
- 229940024606 amino acid Drugs 0.000 claims description 8
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 claims description 7
- 235000004279 alanine Nutrition 0.000 claims description 7
- 238000011282 treatment Methods 0.000 claims description 7
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 claims description 6
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 claims description 5
- 102000000424 Matrix Metalloproteinase 2 Human genes 0.000 claims description 4
- 108010016165 Matrix Metalloproteinase 2 Proteins 0.000 claims description 4
- CKLJMWTZIZZHCS-REOHCLBHSA-L aspartate group Chemical class N[C@@H](CC(=O)[O-])C(=O)[O-] CKLJMWTZIZZHCS-REOHCLBHSA-L 0.000 claims description 4
- BASFCYQUMIYNBI-UHFFFAOYSA-N platinum Chemical compound [Pt] BASFCYQUMIYNBI-UHFFFAOYSA-N 0.000 claims description 4
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 claims description 3
- SDUQYLNIPVEERB-QPPQHZFASA-N gemcitabine Chemical compound O=C1N=C(N)C=CN1[C@H]1C(F)(F)[C@H](O)[C@@H](CO)O1 SDUQYLNIPVEERB-QPPQHZFASA-N 0.000 claims description 3
- 229960005277 gemcitabine Drugs 0.000 claims description 3
- 150000002306 glutamic acid derivatives Chemical class 0.000 claims description 3
- -1 linker amino acid Chemical group 0.000 claims description 3
- 102000004318 Matrilysin Human genes 0.000 claims description 2
- 108090000855 Matrilysin Proteins 0.000 claims description 2
- 102000000422 Matrix Metalloproteinase 3 Human genes 0.000 claims description 2
- 108010016160 Matrix Metalloproteinase 3 Proteins 0.000 claims description 2
- 229930012538 Paclitaxel Natural products 0.000 claims description 2
- 239000003795 chemical substances by application Substances 0.000 claims description 2
- 229960001592 paclitaxel Drugs 0.000 claims description 2
- 229910052697 platinum Inorganic materials 0.000 claims description 2
- 125000001500 prolyl group Chemical group [H]N1C([H])(C(=O)[*])C([H])([H])C([H])([H])C1([H])[H] 0.000 claims description 2
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 claims description 2
- 239000008194 pharmaceutical composition Substances 0.000 claims 2
- 238000003745 diagnosis Methods 0.000 claims 1
- 239000003085 diluting agent Substances 0.000 claims 1
- 239000003937 drug carrier Substances 0.000 claims 1
- 239000000546 pharmaceutical excipient Substances 0.000 claims 1
- 239000003814 drug Substances 0.000 description 61
- 229940079593 drug Drugs 0.000 description 58
- 125000003275 alpha amino acid group Chemical group 0.000 description 26
- 210000004027 cell Anatomy 0.000 description 26
- 239000004472 Lysine Substances 0.000 description 10
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 10
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 9
- WHUUTDBJXJRKMK-VKHMYHEASA-L glutamate group Chemical group N[C@@H](CCC(=O)[O-])C(=O)[O-] WHUUTDBJXJRKMK-VKHMYHEASA-L 0.000 description 9
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 8
- 241000699670 Mus sp. Species 0.000 description 8
- 206010061902 Pancreatic neoplasm Diseases 0.000 description 8
- 238000013461 design Methods 0.000 description 8
- 201000002528 pancreatic cancer Diseases 0.000 description 8
- 201000011510 cancer Diseases 0.000 description 7
- 150000001875 compounds Chemical class 0.000 description 7
- 201000010099 disease Diseases 0.000 description 7
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 7
- 230000003211 malignant effect Effects 0.000 description 7
- 206010009944 Colon cancer Diseases 0.000 description 6
- 241001465754 Metazoa Species 0.000 description 6
- 125000003295 alanine group Chemical group N[C@@H](C)C(=O)* 0.000 description 6
- 230000027455 binding Effects 0.000 description 6
- 238000002474 experimental method Methods 0.000 description 6
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 description 6
- 150000007523 nucleic acids Chemical class 0.000 description 6
- 208000008443 pancreatic carcinoma Diseases 0.000 description 6
- 229920000642 polymer Polymers 0.000 description 6
- 238000001542 size-exclusion chromatography Methods 0.000 description 6
- 125000000174 L-prolyl group Chemical group [H]N1C([H])([H])C([H])([H])C([H])([H])[C@@]1([H])C(*)=O 0.000 description 5
- 150000001945 cysteines Chemical class 0.000 description 5
- 238000005538 encapsulation Methods 0.000 description 5
- 238000001727 in vivo Methods 0.000 description 5
- 238000000034 method Methods 0.000 description 5
- 108020004707 nucleic acids Proteins 0.000 description 5
- 102000039446 nucleic acids Human genes 0.000 description 5
- 238000006467 substitution reaction Methods 0.000 description 5
- 238000012360 testing method Methods 0.000 description 5
- 210000001519 tissue Anatomy 0.000 description 5
- 102000005741 Metalloproteases Human genes 0.000 description 4
- 108010006035 Metalloproteases Proteins 0.000 description 4
- 102000002131 PAS domains Human genes 0.000 description 4
- 108050009469 PAS domains Proteins 0.000 description 4
- 102100026144 Transferrin receptor protein 1 Human genes 0.000 description 4
- 230000001028 anti-proliverative effect Effects 0.000 description 4
- 230000015572 biosynthetic process Effects 0.000 description 4
- 238000006243 chemical reaction Methods 0.000 description 4
- 208000029742 colonic neoplasm Diseases 0.000 description 4
- 238000002296 dynamic light scattering Methods 0.000 description 4
- 238000005516 engineering process Methods 0.000 description 4
- 108010050848 glycylleucine Proteins 0.000 description 4
- 238000000338 in vitro Methods 0.000 description 4
- 230000004807 localization Effects 0.000 description 4
- 230000000873 masking effect Effects 0.000 description 4
- 239000000243 solution Substances 0.000 description 4
- 238000003786 synthesis reaction Methods 0.000 description 4
- CXISPYVYMQWFLE-VKHMYHEASA-N Ala-Gly Chemical compound C[C@H]([NH3+])C(=O)NCC([O-])=O CXISPYVYMQWFLE-VKHMYHEASA-N 0.000 description 3
- 206010006187 Breast cancer Diseases 0.000 description 3
- 208000026310 Breast neoplasm Diseases 0.000 description 3
- HFPVRZWORNJRRC-UWVGGRQHSA-N Gly-Pro-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)CN HFPVRZWORNJRRC-UWVGGRQHSA-N 0.000 description 3
- 239000004471 Glycine Substances 0.000 description 3
- 241000282412 Homo Species 0.000 description 3
- 206010039491 Sarcoma Diseases 0.000 description 3
- 230000035508 accumulation Effects 0.000 description 3
- 238000009825 accumulation Methods 0.000 description 3
- 108010047495 alanylglycine Proteins 0.000 description 3
- 238000004458 analytical method Methods 0.000 description 3
- 239000002246 antineoplastic agent Substances 0.000 description 3
- 230000004888 barrier function Effects 0.000 description 3
- 230000008901 benefit Effects 0.000 description 3
- 210000000481 breast Anatomy 0.000 description 3
- 230000000694 effects Effects 0.000 description 3
- 238000010828 elution Methods 0.000 description 3
- 239000013604 expression vector Substances 0.000 description 3
- 238000011534 incubation Methods 0.000 description 3
- 238000010253 intravenous injection Methods 0.000 description 3
- 230000036210 malignancy Effects 0.000 description 3
- 201000001441 melanoma Diseases 0.000 description 3
- 239000002539 nanocarrier Substances 0.000 description 3
- 238000002360 preparation method Methods 0.000 description 3
- 230000004845 protein aggregation Effects 0.000 description 3
- 229940124597 therapeutic agent Drugs 0.000 description 3
- 108010075016 Ceruloplasmin Proteins 0.000 description 2
- 102100023321 Ceruloplasmin Human genes 0.000 description 2
- 206010008342 Cervix carcinoma Diseases 0.000 description 2
- 208000001333 Colorectal Neoplasms Diseases 0.000 description 2
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 2
- 241000588724 Escherichia coli Species 0.000 description 2
- 201000008808 Fibrosarcoma Diseases 0.000 description 2
- 101001003584 Homo sapiens Prelamin-A/C Proteins 0.000 description 2
- XEEYBQQBJWHFJM-UHFFFAOYSA-N Iron Chemical compound [Fe] XEEYBQQBJWHFJM-UHFFFAOYSA-N 0.000 description 2
- 206010025323 Lymphomas Diseases 0.000 description 2
- PEEHTFAAVSWFBL-UHFFFAOYSA-N Maleimide Chemical compound O=C1NC(=O)C=C1 PEEHTFAAVSWFBL-UHFFFAOYSA-N 0.000 description 2
- 102100026531 Prelamin-A/C Human genes 0.000 description 2
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 2
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 2
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 2
- 239000004473 Threonine Substances 0.000 description 2
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 description 2
- 230000002776 aggregation Effects 0.000 description 2
- 238000004220 aggregation Methods 0.000 description 2
- 210000003855 cell nucleus Anatomy 0.000 description 2
- 201000010881 cervical cancer Diseases 0.000 description 2
- 230000009918 complex formation Effects 0.000 description 2
- 238000010276 construction Methods 0.000 description 2
- 229940127089 cytotoxic agent Drugs 0.000 description 2
- 230000001419 dependent effect Effects 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 230000018109 developmental process Effects 0.000 description 2
- 238000009826 distribution Methods 0.000 description 2
- 238000001962 electrophoresis Methods 0.000 description 2
- YBMRDBCBODYGJE-UHFFFAOYSA-N germanium dioxide Chemical compound O=[Ge]=O YBMRDBCBODYGJE-UHFFFAOYSA-N 0.000 description 2
- 210000004907 gland Anatomy 0.000 description 2
- 230000002147 killing effect Effects 0.000 description 2
- 208000032839 leukemia Diseases 0.000 description 2
- 230000000670 limiting effect Effects 0.000 description 2
- 230000014759 maintenance of location Effects 0.000 description 2
- 238000004519 manufacturing process Methods 0.000 description 2
- 239000003550 marker Substances 0.000 description 2
- 239000000463 material Substances 0.000 description 2
- 230000001404 mediated effect Effects 0.000 description 2
- 230000004048 modification Effects 0.000 description 2
- 238000012986 modification Methods 0.000 description 2
- 210000000633 nuclear envelope Anatomy 0.000 description 2
- 230000036470 plasma concentration Effects 0.000 description 2
- 230000008569 process Effects 0.000 description 2
- BOLDJAUMGUJJKM-LSDHHAIUSA-N renifolin D Natural products CC(=C)[C@@H]1Cc2c(O)c(O)ccc2[C@H]1CC(=O)c3ccc(O)cc3O BOLDJAUMGUJJKM-LSDHHAIUSA-N 0.000 description 2
- 230000004044 response Effects 0.000 description 2
- 125000003607 serino group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C(O[H])([H])[H] 0.000 description 2
- 210000002966 serum Anatomy 0.000 description 2
- 239000002904 solvent Substances 0.000 description 2
- 238000010186 staining Methods 0.000 description 2
- 238000003860 storage Methods 0.000 description 2
- 230000004083 survival effect Effects 0.000 description 2
- 208000024891 symptom Diseases 0.000 description 2
- 238000011191 terminal modification Methods 0.000 description 2
- 210000004881 tumor cell Anatomy 0.000 description 2
- 239000013598 vector Substances 0.000 description 2
- MDNSLPICAWKNAG-UHFFFAOYSA-N 2-(2,5-dioxopyrrol-1-yl)propanoic acid Chemical compound OC(=O)C(C)N1C(=O)C=CC1=O MDNSLPICAWKNAG-UHFFFAOYSA-N 0.000 description 1
- AZKSAVLVSZKNRD-UHFFFAOYSA-M 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide Chemical compound [Br-].S1C(C)=C(C)N=C1[N+]1=NC(C=2C=CC=CC=2)=NN1C1=CC=CC=C1 AZKSAVLVSZKNRD-UHFFFAOYSA-M 0.000 description 1
- 102100026802 72 kDa type IV collagenase Human genes 0.000 description 1
- 101710151806 72 kDa type IV collagenase Proteins 0.000 description 1
- 206010005003 Bladder cancer Diseases 0.000 description 1
- 206010005949 Bone cancer Diseases 0.000 description 1
- 208000018084 Bone neoplasm Diseases 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 208000011691 Burkitt lymphomas Diseases 0.000 description 1
- 241000282472 Canis lupus familiaris Species 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- 206010007275 Carcinoid tumour Diseases 0.000 description 1
- 201000009030 Carcinoma Diseases 0.000 description 1
- 108091026890 Coding region Proteins 0.000 description 1
- 108020004705 Codon Proteins 0.000 description 1
- 102000008186 Collagen Human genes 0.000 description 1
- 108010035532 Collagen Proteins 0.000 description 1
- LBOLGUYQEPZSKM-YUMQZZPRSA-N Cys-Gly-Leu Chemical compound CC(C)C[C@@H](C(=O)O)NC(=O)CNC(=O)[C@H](CS)N LBOLGUYQEPZSKM-YUMQZZPRSA-N 0.000 description 1
- 108020004414 DNA Proteins 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 241000283086 Equidae Species 0.000 description 1
- 208000000461 Esophageal Neoplasms Diseases 0.000 description 1
- 102000010834 Extracellular Matrix Proteins Human genes 0.000 description 1
- 108010037362 Extracellular Matrix Proteins Proteins 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- 208000022072 Gallbladder Neoplasms Diseases 0.000 description 1
- 206010018338 Glioma Diseases 0.000 description 1
- DKEXFJVMVGETOO-LURJTMIESA-N Gly-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)CN DKEXFJVMVGETOO-LURJTMIESA-N 0.000 description 1
- 206010073073 Hepatobiliary cancer Diseases 0.000 description 1
- 208000017604 Hodgkin disease Diseases 0.000 description 1
- 208000021519 Hodgkin lymphoma Diseases 0.000 description 1
- 208000010747 Hodgkins lymphoma Diseases 0.000 description 1
- 101000952234 Homo sapiens Sphingolipid delta(4)-desaturase DES1 Proteins 0.000 description 1
- 208000005016 Intestinal Neoplasms Diseases 0.000 description 1
- 208000008839 Kidney Neoplasms Diseases 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- 125000000773 L-serino group Chemical group [H]OC(=O)[C@@]([H])(N([H])*)C([H])([H])O[H] 0.000 description 1
- WNGVUZWBXZKQES-YUMQZZPRSA-N Leu-Ala-Gly Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](C)C(=O)NCC(O)=O WNGVUZWBXZKQES-YUMQZZPRSA-N 0.000 description 1
- 208000032271 Malignant tumor of penis Diseases 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 206010027406 Mesothelioma Diseases 0.000 description 1
- 208000029725 Metabolic bone disease Diseases 0.000 description 1
- 206010027476 Metastases Diseases 0.000 description 1
- 241000699660 Mus musculus Species 0.000 description 1
- KZNQNBZMBZJQJO-UHFFFAOYSA-N N-glycyl-L-proline Natural products NCC(=O)N1CCCC1C(O)=O KZNQNBZMBZJQJO-UHFFFAOYSA-N 0.000 description 1
- 208000015914 Non-Hodgkin lymphomas Diseases 0.000 description 1
- 108091028043 Nucleic acid sequence Proteins 0.000 description 1
- 206010030155 Oesophageal carcinoma Diseases 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 206010049088 Osteopenia Diseases 0.000 description 1
- 208000001132 Osteoporosis Diseases 0.000 description 1
- 206010033128 Ovarian cancer Diseases 0.000 description 1
- 206010061535 Ovarian neoplasm Diseases 0.000 description 1
- 208000000821 Parathyroid Neoplasms Diseases 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 208000002471 Penile Neoplasms Diseases 0.000 description 1
- 206010034299 Penile cancer Diseases 0.000 description 1
- 102000035195 Peptidases Human genes 0.000 description 1
- FXGIMYRVJJEIIM-UWVGGRQHSA-N Pro-Leu-Gly Chemical compound OC(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@@H]1CCCN1 FXGIMYRVJJEIIM-UWVGGRQHSA-N 0.000 description 1
- 206010060862 Prostate cancer Diseases 0.000 description 1
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 1
- 239000012980 RPMI-1640 medium Substances 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 208000015634 Rectal Neoplasms Diseases 0.000 description 1
- 206010038389 Renal cancer Diseases 0.000 description 1
- 201000000582 Retinoblastoma Diseases 0.000 description 1
- 208000000453 Skin Neoplasms Diseases 0.000 description 1
- 206010041067 Small cell lung cancer Diseases 0.000 description 1
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 1
- 102100037416 Sphingolipid delta(4)-desaturase DES1 Human genes 0.000 description 1
- 208000005718 Stomach Neoplasms Diseases 0.000 description 1
- 210000001744 T-lymphocyte Anatomy 0.000 description 1
- 208000024313 Testicular Neoplasms Diseases 0.000 description 1
- 206010057644 Testis cancer Diseases 0.000 description 1
- 208000024770 Thyroid neoplasm Diseases 0.000 description 1
- 102000007238 Transferrin Receptors Human genes 0.000 description 1
- 108010033576 Transferrin Receptors Proteins 0.000 description 1
- UYKREHOKELZSPB-JTQLQIEISA-N Trp-Gly Chemical compound C1=CC=C2C(C[C@H](N)C(=O)NCC(O)=O)=CNC2=C1 UYKREHOKELZSPB-JTQLQIEISA-N 0.000 description 1
- 206010046431 Urethral cancer Diseases 0.000 description 1
- 206010046458 Urethral neoplasms Diseases 0.000 description 1
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 description 1
- 208000002495 Uterine Neoplasms Diseases 0.000 description 1
- 238000002835 absorbance Methods 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 208000009956 adenocarcinoma Diseases 0.000 description 1
- 201000005188 adrenal gland cancer Diseases 0.000 description 1
- 208000024447 adrenal gland neoplasm Diseases 0.000 description 1
- 239000011543 agarose gel Substances 0.000 description 1
- 238000000246 agarose gel electrophoresis Methods 0.000 description 1
- 230000033115 angiogenesis Effects 0.000 description 1
- 230000000259 anti-tumor effect Effects 0.000 description 1
- 238000011319 anticancer therapy Methods 0.000 description 1
- 229940041181 antineoplastic drug Drugs 0.000 description 1
- 108010040443 aspartyl-aspartic acid Proteins 0.000 description 1
- 238000000429 assembly Methods 0.000 description 1
- 230000000712 assembly Effects 0.000 description 1
- 230000001363 autoimmune Effects 0.000 description 1
- 230000033558 biomineral tissue development Effects 0.000 description 1
- 230000001851 biosynthetic effect Effects 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 210000000988 bone and bone Anatomy 0.000 description 1
- 208000002458 carcinoid tumor Diseases 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 230000015861 cell surface binding Effects 0.000 description 1
- 230000003833 cell viability Effects 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 210000003679 cervix uteri Anatomy 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 229920001436 collagen Polymers 0.000 description 1
- 210000001072 colon Anatomy 0.000 description 1
- 230000000052 comparative effect Effects 0.000 description 1
- 238000013329 compounding Methods 0.000 description 1
- 238000004624 confocal microscopy Methods 0.000 description 1
- 238000010168 coupling process Methods 0.000 description 1
- 239000013078 crystal Substances 0.000 description 1
- 210000000805 cytoplasm Anatomy 0.000 description 1
- 230000006378 damage Effects 0.000 description 1
- 230000003247 decreasing effect Effects 0.000 description 1
- 238000010511 deprotection reaction Methods 0.000 description 1
- 239000002552 dosage form Substances 0.000 description 1
- 238000012377 drug delivery Methods 0.000 description 1
- 230000001516 effect on protein Effects 0.000 description 1
- 230000002124 endocrine Effects 0.000 description 1
- 201000004101 esophageal cancer Diseases 0.000 description 1
- 210000002744 extracellular matrix Anatomy 0.000 description 1
- 239000012467 final product Substances 0.000 description 1
- 230000004927 fusion Effects 0.000 description 1
- 201000010175 gallbladder cancer Diseases 0.000 description 1
- 206010017758 gastric cancer Diseases 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 208000005017 glioblastoma Diseases 0.000 description 1
- 125000000291 glutamic acid group Chemical group N[C@@H](CCC(O)=O)C(=O)* 0.000 description 1
- KZNQNBZMBZJQJO-YFKPBYRVSA-N glyclproline Chemical compound NCC(=O)N1CCC[C@H]1C(O)=O KZNQNBZMBZJQJO-YFKPBYRVSA-N 0.000 description 1
- 108010077515 glycylproline Proteins 0.000 description 1
- 201000010536 head and neck cancer Diseases 0.000 description 1
- 208000014829 head and neck neoplasm Diseases 0.000 description 1
- 239000013628 high molecular weight specie Substances 0.000 description 1
- 210000005260 human cell Anatomy 0.000 description 1
- 230000003463 hyperproliferative effect Effects 0.000 description 1
- 238000003384 imaging method Methods 0.000 description 1
- 230000028993 immune response Effects 0.000 description 1
- 238000002513 implantation Methods 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 239000004615 ingredient Substances 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 230000000977 initiatory effect Effects 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 201000002313 intestinal cancer Diseases 0.000 description 1
- 230000009545 invasion Effects 0.000 description 1
- 229910052742 iron Inorganic materials 0.000 description 1
- 201000010982 kidney cancer Diseases 0.000 description 1
- 230000003902 lesion Effects 0.000 description 1
- 210000004185 liver Anatomy 0.000 description 1
- 230000033001 locomotion Effects 0.000 description 1
- 210000004072 lung Anatomy 0.000 description 1
- 108010071673 magnetoferritin Proteins 0.000 description 1
- 208000026045 malignant tumor of parathyroid gland Diseases 0.000 description 1
- 230000035800 maturation Effects 0.000 description 1
- 239000002609 medium Substances 0.000 description 1
- 230000009401 metastasis Effects 0.000 description 1
- 229930182817 methionine Natural products 0.000 description 1
- 230000003278 mimic effect Effects 0.000 description 1
- 239000000203 mixture Substances 0.000 description 1
- 238000012544 monitoring process Methods 0.000 description 1
- 230000035772 mutation Effects 0.000 description 1
- VMGAPWLDMVPYIA-HIDZBRGKSA-N n'-amino-n-iminomethanimidamide Chemical compound N\N=C\N=N VMGAPWLDMVPYIA-HIDZBRGKSA-N 0.000 description 1
- 230000001613 neoplastic effect Effects 0.000 description 1
- 208000002154 non-small cell lung carcinoma Diseases 0.000 description 1
- 230000004942 nuclear accumulation Effects 0.000 description 1
- 210000004940 nucleus Anatomy 0.000 description 1
- 238000011580 nude mouse model Methods 0.000 description 1
- 238000005457 optimization Methods 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 230000003204 osmotic effect Effects 0.000 description 1
- 210000000963 osteoblast Anatomy 0.000 description 1
- 210000001672 ovary Anatomy 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- 230000004962 physiological condition Effects 0.000 description 1
- 239000002244 precipitate Substances 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 239000002243 precursor Substances 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 230000035755 proliferation Effects 0.000 description 1
- 108700042769 prolyl-leucyl-glycine Proteins 0.000 description 1
- 210000002307 prostate Anatomy 0.000 description 1
- 230000004850 protein–protein interaction Effects 0.000 description 1
- 230000006337 proteolytic cleavage Effects 0.000 description 1
- 102000005962 receptors Human genes 0.000 description 1
- 108020003175 receptors Proteins 0.000 description 1
- 206010038038 rectal cancer Diseases 0.000 description 1
- 201000001275 rectum cancer Diseases 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 230000002441 reversible effect Effects 0.000 description 1
- 238000004062 sedimentation Methods 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 201000000849 skin cancer Diseases 0.000 description 1
- 208000000587 small cell lung carcinoma Diseases 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 1
- 230000000087 stabilizing effect Effects 0.000 description 1
- 201000011549 stomach cancer Diseases 0.000 description 1
- 239000000126 substance Substances 0.000 description 1
- 239000000829 suppository Substances 0.000 description 1
- 238000013268 sustained release Methods 0.000 description 1
- 239000012730 sustained-release form Substances 0.000 description 1
- 238000002626 targeted therapy Methods 0.000 description 1
- 230000008685 targeting Effects 0.000 description 1
- 201000003120 testicular cancer Diseases 0.000 description 1
- 238000002560 therapeutic procedure Methods 0.000 description 1
- 125000003396 thiol group Chemical group [H]S* 0.000 description 1
- 150000003573 thiols Chemical class 0.000 description 1
- 210000001541 thymus gland Anatomy 0.000 description 1
- 201000002510 thyroid cancer Diseases 0.000 description 1
- 230000014616 translation Effects 0.000 description 1
- 108010038745 tryptophylglycine Proteins 0.000 description 1
- 230000036326 tumor accumulation Effects 0.000 description 1
- 230000004614 tumor growth Effects 0.000 description 1
- 208000029729 tumor suppressor gene on chromosome 11 Diseases 0.000 description 1
- 230000003827 upregulation Effects 0.000 description 1
- 201000005112 urinary bladder cancer Diseases 0.000 description 1
- 206010046766 uterine cancer Diseases 0.000 description 1
- 206010046885 vaginal cancer Diseases 0.000 description 1
- 208000013139 vaginal neoplasm Diseases 0.000 description 1
- 231100000747 viability assay Toxicity 0.000 description 1
- 238000003026 viability measurement method Methods 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
Description
Область техники изобретенияTechnical field of the invention
Настоящее изобретение относится к слитому белку, к наночастицам, состоящим из множества мономеров указанного слитого белка, к нуклеиновым кислотам, кодирующим указанный слитый белок, и к их диагностическим и терапевтическим применениям. Настоящее изобретение относится к слитому белку, к наночастице, состоящей из множества мономеров указанного слитого белка, и к их применению. Описан слитый белок на основе тяжелой цепи ферритина человека, который содержит на N-конце белка по меньшей мере одну последовательность расщепления металлопротеиназы и модифицированный полипептид PAS, действующий в качестве маскирующего полимера, который повышает стабильность комплекса белок-лекарственное средство, а также наночастица, состоящая из нескольких мономеров указанного слитого белка, нуклеиновая кислота, кодирующая указанный слитый белок, и их диагностические и терапевтические применения.The present invention relates to a fusion protein, nanoparticles consisting of multiple monomers of said fusion protein, nucleic acids encoding said fusion protein, and diagnostic and therapeutic uses thereof. The present invention relates to a fusion protein, a nanoparticle consisting of a plurality of monomers of said fusion protein, and their use. A fusion protein based on the heavy chain of human ferritin is described, which contains at the N-terminus of the protein at least one metalloproteinase cleavage sequence and a modified PAS polypeptide that acts as a masking polymer that increases the stability of the protein-drug complex, as well as a nanoparticle consisting of several monomers of said fusion protein, a nucleic acid encoding said fusion protein, and diagnostic and therapeutic uses thereof.
Уровень техникиState of the art
Селективное высвобождение терапевтических средств в пораженных областях является одной из самых важных задач по улучшению современных способов лечения, особенно в противоопухолевой терапии. В данном контексте применение наночастиц в качестве носителей (нановекторов) терапевтических средств потенциально обеспечивает возможность как обойти биологические барьеры, которые могут присутствовать на пути от места введения до конечной цели, так и, в частности, обеспечить накопление лекарственного средства селективным образом в пораженной области, а не в нормальных тканях. Основополагающим предварительным условием служит способность нановектора связывать большие количества лекарственного средства эффективным образом.Selective release of therapeutic agents in affected areas is one of the most important goals for improving current treatments, especially in anticancer therapy. In this context, the use of nanoparticles as carriers (nanovectors) of therapeutic agents potentially provides the opportunity to both bypass biological barriers that may be present along the path from the site of administration to the final target, and, in particular, to ensure the accumulation of the drug in a selective manner in the affected area, and not in normal tissues. A fundamental prerequisite is the ability of the nanovector to bind large amounts of drug in an efficient manner.
Среди известных носителей для целевого высвобождения лекарственного средства наночастицы на основе ферритинов (ferritins (Fts)) привлекают все большее внимание благодаря их исключительным характеристикам биосовместимости, способности проникать сквозь биологические барьеры, универсальности функционализируемости и возможности связывать определенные виды лекарственных средств. Fts представляют собой высоко симметричные мультимерные белковые структуры, состоящие из 24 субъединиц, которые собираются в молекулярную структуру по существу со сферической оболочкой, окружающей полость, которая физиологически используется для хранения железа. Наружный диаметр и внутренний диаметр составляют 12 и 8 нм, соответственно. Такая молекулярная структура по типу оболочки обозначается далее как наночастица или HFt-наночастица. Наночастицы на основе тяжелой цепи ферритина человека (heavy chain of human ferritin, HFt) демонстрируют ряд преимуществ по сравнению с другими системами высвобождения лекарственных средств, особенно в связи с применениями in vivo у человека. Фактически, молекулы HFt предназначены для прохождения сквозь биологические барьеры (с диаметром отсечения (minor diameter) 20 нм), и в физиологических условиях они присутствуют как в клетках, так и в крови, хотя и в низких концентрациях (приблизительно 20 мкг/л).Among the known carriers for targeted drug release, nanoparticles based on ferritins (Fts) are gaining increasing attention due to their exceptional characteristics of biocompatibility, ability to penetrate biological barriers, universal functionalizability and ability to bind certain types of drugs. Fts are highly symmetrical multimeric protein structures consisting of 24 subunits that assemble into a molecular structure with an essentially spherical shell surrounding a cavity that is physiologically used for iron storage. The outer diameter and inner diameter are 12 and 8 nm, respectively. This shell-type molecular structure is further referred to as a nanoparticle or HFt-nanoparticle. Heavy chain of human ferritin (HFt) nanoparticles demonstrate a number of advantages over other drug release systems, especially in connection with in vivo applications in humans. In fact, HFt molecules are designed to pass through biological barriers (with a cutoff diameter (minor diameter) of 20 nm), and under physiological conditions they are present in both cells and blood, albeit in low concentrations (approximately 20 μg/L).
Являясь природными элементами, они с меньшей вероятностью могут вызывать сильный неаутоиммунный (в ответ на внешние факторы) гуморальный и/или Т-клеточный иммунный ответ. Кроме того, HFt является одной из нескольких природных наночастиц, которая сама по себе способна связываться с опухолевыми клетками эффективным и селективным путем. Действительно, с использованием одной из самых привлекательных молекул для таргетной терапии злокачественных новообразований, рецептора трансферрина 1 (transferrin receptor 1 (TfR1)), было показано, что HFt интернализуется. TfR1 действительно представлен, из-за повышающей регуляции, в больших количествах на поверхности многих видов злокачественных опухолей (с превышением до 100 раз по сравнению с нормальными клетками) и эффективно интернализуется. Для более чем 474 образцов клинических тканей, была доказана интернализация HFt, но не легкой цепи ферритина человека (light chain of human ferritin (LFt)), посредством TfR1 и специфическое распознавание многих типов опухолей (т.е. злокачественных новообразований печени, легких, поджелудочной железы, толстой кишки, шейки матки, яичников, простаты, молочной железы, саркомы и тимуса) по сравнению с неопухолевыми тканями, с 98% чувствительностью и 95% специфичностью (Fan K, Сао C, Pan Y, Lu D, Yang D, Feng J, et al. Magnetoferritin nanoparticles for targeting and visualizing tumour tissues. Nat Nanotechnol. 2012;7:459-64). Однако, нативная HFt имеет несколько недостатков. Во-первых, выходы, с которыми она способна связываться с определенными типами лекарственных средств, такими как, например, доксорубицин (один из противоопухолевых препаратов с широким спектром противоопухолевой активности), являются низкими, и это может ограничить их возможное применение и клинические разработки. Во-вторых, нативная HFt при системном пути введения имеет очень короткий период полужизни в плазме, приблизительно от 2 до 3 ч. И, наконец, ее природная ферроксидазная активность может ингибировать развитие и созревание остеобластов человека и приводить к снижению минерализации, к остеопении и остеопорозу (Zarjou A, Jeney V, Arosio P, Poli M, Zavaczki E, Balla G, Balla J. Ferritin ferroxidase activity: a potent inhibitor of osteogenesis. J Bone Miner Res. 2010,25:164-72). По данной причине целесообразно использовать вариант HFt, лишенный ферроксидазной активности благодаря сайт-специфической мутации (в настоящем документе обозначена как vHFt), который не вызывает ингибирования.Being naturally occurring elements, they are less likely to induce a strong non-autoimmune (in response to external factors) humoral and/or T-cell immune response. In addition, HFt is one of several natural nanoparticles that itself is capable of binding to tumor cells in an effective and selective manner. Indeed, using one of the most attractive molecules for targeted therapy of malignancies, transferrin receptor 1 (TfR1), HFt has been shown to be internalized. TfR1 is indeed present, due to up-regulation, in large quantities on the surface of many types of malignant tumors (up to 100-fold in excess compared to normal cells) and is efficiently internalized. In over 474 clinical tissue samples, internalization of HFt, but not the light chain of human ferritin (LFt), through TfR1 and specific recognition of many tumor types (i.e., liver, lung, pancreatic) was demonstrated. gland, colon, cervix, ovary, prostate, breast, sarcoma and thymus) compared with non-neoplastic tissues, with 98% sensitivity and 95% specificity (Fan K, Cao C, Pan Y, Lu D, Yang D, Feng J, et al. Magnetoferritin nanoparticles for targeting and visualizing tumor tissues. Nat Nanotechnol. 2012;7:459-64). However, native HFt has several disadvantages. First, the yields in which it is able to bind to certain types of drugs, such as doxorubicin (one of the anticancer drugs with a broad spectrum of antitumor activity), are low, and this may limit their potential use and clinical development. Second, native HFt, when administered systemically, has a very short plasma half-life of approximately 2 to 3 hours. Finally, its natural ferroxidase activity may inhibit the development and maturation of human osteoblasts and lead to decreased mineralization, osteopenia, and osteoporosis. (Zarjou A, Jeney V, Arosio P, Poli M, Zavaczki E, Balla G, Balla J. Ferritin ferroxidase activity: a potent inhibitor of osteogenesis. J Bone Miner Res. 2010,25:164-72). For this reason, it is advisable to use a variant of HFt that lacks ferroxidase activity due to a site-specific mutation (herein referred to as vHFt), which does not cause inhibition.
Недавно, для того чтобы увеличить как период полужизни in vivo нативного HFt, так и стабильность комплексов HFt-лекарственное средство, в WO 2016051340 А1 была раскрыта новая конструкцияRecently, in order to increase both the in vivo half-life of native HFt and the stability of HFt-drug complexes, a new design was disclosed in WO 2016051340 A1
- 1 044061 на основе HFt, названная HFt-MP-PAS, подходящая для доставки лекарственного средства. В данной конструкции N-конец каждой субъединицы HFt генетически слит с: i) полипептидной последовательностью PAS, то есть последовательностью, богатой остатками пролина (Р), аланина (А) и серина (S); и ii) селективной к опухоли последовательностью (МР), реагирующей на протеолитическое расщепление опухолевыми протеазами (ММР), вставленной между каждой субъединицей HFt и расположенным снаружи полипептидом PAS. Целью защиты с помощью PAS было повышение стабильности белка во время процесса инкапсулирования лекарственного средства, предпочтительно для лекарственного средства доксорубицин, и повышение стабильности комплекса белок-лекарственное средство. Присутствие PAS также способно маскировать поверхность белка и, таким образом, удлинять период его полужизни в плазме. Последовательность МР позволяет избирательно удалять защиту PAS с помощью сигналов, присутствующих в микроокружении опухоли (т.е. ММР, специфичные для данной последовательности), так что полученная в результате демаскированная HFt может свободно взаимодействовать и интернализироваться посредством TfR1, сверхэкспрессируемого в злокачественных клетках. Конструкция HFt-MP-PAS доказала, что i) инкапсулирует во внутренней полости в три раза больше доксорубицина (DOX), чем HFt дикого типа, ii) образует более стабильные комплексы (т.е. утечка лекарственного средства была незначительной) и iii) обладает более высоким in vivo временем циркуляции. Важно, что DOX-нагруженная конструкция HFt-MP-PAS (HFt-MP-PAS-DOX) продемонстрировала превосходную терапевтическую эффективность в in vivo модели рака поджелудочной железы человека, значительно увеличивая общую выживаемость животных. Увеличение инкапсулирования DOX, стабильности комплекса белоклекарственное средство и времени циркуляции в плазме по отношению к HFt было приписано наличию PAS. Однако, все еще существует потребность в создании улучшенных наночастиц в качестве носителей (нановекторов) терапевтических средств.- 1 044061 based on HFt, named HFt-MP-PAS, suitable for drug delivery. In this construct, the N-terminus of each HFt subunit is genetically fused to: i) a PAS polypeptide sequence, that is, a sequence rich in proline (P), alanine (A) and serine (S) residues; and ii) a tumor-selective sequence (MP) responsive to proteolytic cleavage by tumor proteases (MMPs) inserted between each HFt subunit and the externally located PAS polypeptide. The purpose of PAS protection was to increase protein stability during the drug encapsulation process, preferably for the drug doxorubicin, and to increase the stability of the protein-drug complex. The presence of PAS can also mask the surface of the protein and thus prolong its half-life in plasma. The MP sequence allows selective deprotection of PAS by signals present in the tumor microenvironment (i.e., sequence-specific MMPs), so that the resulting unmasked HFt can freely interact with and be internalized by TfR1 overexpressed in malignant cells. The HFt-MP-PAS design was proven to i) encapsulate three times more doxorubicin (DOX) in the internal cavity than wild-type HFt, ii) form more stable complexes (i.e., there was little drug leakage), and iii) have higher in vivo circulation time. Importantly, the DOX-loaded HFt-MP-PAS construct (HFt-MP-PAS-DOX) demonstrated excellent therapeutic efficacy in an in vivo model of human pancreatic cancer, significantly increasing overall animal survival. Increased DOX encapsulation, protein drug complex stability, and plasma circulation time relative to HFt were attributed to the presence of PAS. However, there is still a need to develop improved nanoparticles as carriers (nanovectors) of therapeutic agents.
Сущность изобретенияThe essence of the invention
Авторы настоящего изобретения неожиданно обнаружили, что введение по меньшей мере одного отрицательно заряженного остатка, выбранного из глутамата или аспартата в домен PAS резко улучшает свойства слитого белка HFT-MP-PAS, как ясно видно из экспериментальных данных, представленные в примерах и чертежах настоящего раскрытия. В частности, авторы настоящего изобретения неожиданно обнаружили, что новая конструкция со вставкой отрицательно заряженного остатка, такого как глутамат, в домен PAS (HF-MP-PASE) превосходит как нативный белок HFt, так и белок HFt-MP-PAS с точки зрения количества белка, полученного в конце реакций для капсулирования лекарственного препарата. Кроме того, новая конструкция HF-MP-PASE показывает более высокую степень накопления лекарственного препарата в ядрах клеток, более высокую стабильность в сыворотке крови и более высокую степень накопления в опухоли по сравнению с нативным HFt и HFt-MP-PAS.The present inventors have unexpectedly discovered that the introduction of at least one negatively charged residue selected from glutamate or aspartate into the PAS domain dramatically improves the properties of the HFT-MP-PAS fusion protein, as clearly seen from the experimental data presented in the examples and drawings of the present disclosure. In particular, the present inventors unexpectedly discovered that a new construct inserting a negatively charged residue such as glutamate into the PAS domain (HF-MP-PASE) outperforms both the native HFt protein and the HFt-MP-PAS protein in terms of quantity protein obtained at the end of reactions to encapsulate a drug. In addition, the new HF-MP-PASE design shows higher drug accumulation in cell nuclei, higher stability in serum, and higher tumor accumulation compared with native HFt and HFt-MP-PAS.
Соответственно, первый объект настоящего изобретения представляет собой слитый белок, содержащий по меньшей мере три домена, где:Accordingly, the first aspect of the present invention is a fusion protein containing at least three domains, where:
(a) первый домен содержит аминокислотную последовательность тяжелой цепи нативного ферритина человека или его варианта, имеющего по меньшей мере 90% идентичности с аминокислотной последовательностью тяжелой цепи нативного ферритина человека;(a) the first domain contains the amino acid sequence of a native human ferritin heavy chain or a variant thereof having at least 90% identity with the amino acid sequence of a native human ferritin heavy chain;
(b) второй домен содержит аминокислотную последовательность сайта расщепления матриксной металлопротеиназы (ММР); и (c) третий N-концевой домен состоит из аминокислотной последовательности полипептида из по меньшей мере 20 аминокислотных остатков, и который по существу состоит или состоит из пролина, серина, аланина и по меньшей мере одного отрицательно заряженного остатка, выбранного из глутамата или аспартата. Настоящее изобретение обеспечивает также композиции, содержащие соединения по настоящему изобретению, а также для конкретных применений в терапевтических применениях. Эта и другие цели достигаются благодаря слитому белку, как охарактеризовано в прилагаемой формуле изобретения в пункте 1. Другие независимые пункты и зависимые пункты формулы изобретения относятся к дополнительным аспектам и конкретным вариантам осуществления изобретения, которые являются неотъемлемой частью настоящего описания.(b) the second domain contains the amino acid sequence of a matrix metalloproteinase (MMP) cleavage site; and (c) the third N-terminal domain consists of an amino acid sequence of a polypeptide of at least 20 amino acid residues, and which essentially consists of or consists of proline, serine, alanine and at least one negatively charged residue selected from glutamate or aspartate. The present invention also provides compositions containing the compounds of the present invention, as well as for specific uses in therapeutic applications. This and other objects are achieved by the fusion protein as described in the accompanying claims in paragraph 1. Other independent claims and dependent claims relate to additional aspects and specific embodiments of the invention, which are an integral part of the present description.
Для того, чтобы улучшить и облегчить связывание лекарственного средства внутри полости ферритина, авторы настоящего изобретения решили удалить остатки цистеина с поверхности белка и ввести дополнительные остатки цистеина в полость белка. Таким образом, стало возможным очень эффективно связывать с внутренней полостью каждую молекулу, содержащую тиолреактивный мотив, например, лекарства, линкеры, флуорофоры и тому подобное (см. примеры и фигуры).In order to improve and facilitate drug binding within the ferritin cavity, the present inventors decided to remove cysteine residues from the surface of the protein and introduce additional cysteine residues into the protein cavity. Thus, it has become possible to very efficiently bind to the internal cavity every molecule containing a thiol-reactive motif, for example drugs, linkers, fluorophores and the like (see examples and figures).
Соответственно, еще один объект настоящего изобретения представляет собой мутеин тяжелой цепи нативного ферритина человека, где указанный мутеин не имеет каких-либо остатков цистеина на поверхности белка и имеет по меньшей мере один цистеин во внутренней полости белка.Accordingly, another aspect of the present invention is a heavy chain mutein of native human ferritin, wherein the mutein does not have any cysteine residues on the surface of the protein and has at least one cysteine in the internal cavity of the protein.
Кроме того, для того, чтобы улучшить и облегчить связывание лекарственных средств, содержащих положительно заряженный мотив, авторы настоящего изобретения решили удалить остатки цистеина с поверхности белка и ввести дополнительный отрицательно заряженный остаток, выбранный из глутамата или аспартата, в полость белка. Таким образом, стало возможным очень эффективно связывать с внутренней полостью молекулы, содержащие положительно заряженный мотив, например, лекарства, линке- 2 044061 ры, флуорофоры и тому подобное (см. примеры и фигуры).Moreover, in order to improve and facilitate the binding of drugs containing a positively charged motif, the present inventors decided to remove cysteine residues from the surface of the protein and introduce an additional negatively charged residue, selected from glutamate or aspartate, into the protein cavity. In this way, it has become possible to very efficiently bind molecules containing a positively charged motif, such as drugs, linkers, fluorophores and the like, to the internal cavity (see examples and figures).
Соответственно, еще один объект настоящего изобретения представляет собой мутеин тяжелой цепи нативного ферритина человека, где указанный мутеин не имеет каких-либо остатков цистеина на поверхности белка и имеет по меньшей мере один дополнительный остаток глутамата или аспартата во внутренней полости белка.Accordingly, another aspect of the present invention is a heavy chain mutein of native human ferritin, wherein the mutein does not have any cysteine residues on the surface of the protein and has at least one additional glutamate or aspartate residue in the internal cavity of the protein.
Еще один объект настоящего изобретения представляет собой выделенную нуклеиновую кислоту, кодирующую слитый белок или наночастицу в соответствии с любым из раскрытых в данном документе вариантов осуществления.Another aspect of the present invention is an isolated nucleic acid encoding a fusion protein or nanoparticle in accordance with any of the embodiments disclosed herein.
Еще один объект настоящего изобретения представляет собой вектор, содержащий указанные нуклеиновые кислоты, и клетку-хозяин, содержащую указанную нуклеиновую кислоту или указанный вектор.Another aspect of the present invention is a vector containing said nucleic acids and a host cell containing said nucleic acid or said vector.
Дополнительные признаки и преимущества изобретения станут очевидными из следующего подробного описания, которое предоставлено только в иллюстративных целях, но не в качестве ограничения, со ссылкой на прилагаемые чертежи.Additional features and advantages of the invention will become apparent from the following detailed description, which is provided for illustrative purposes only and not by way of limitation, with reference to the accompanying drawings.
Краткое описание чертежейBrief description of drawings
На фиг. 1 схематически представлено получение наночастиц HFt, в которых N-конец каждого из 24 мономеров генетически связан с расщепляемыми пептидными последовательностями и с последовательностями, по существу состоящими из пролина, аланина, серина и глутамата (PASE).In fig. 1 schematically depicts the preparation of HFt nanoparticles in which the N-terminus of each of the 24 monomers is genetically linked to cleavable peptide sequences and to sequences essentially consisting of proline, alanine, serine and glutamate (PASE).
На фиг. 2 показаны профили перемещения полос электрофореза в нативном агарозном геле. Дорожка HFt-MP-PAS (15 мкг); Дорожка 2, HFt-MP-PASE (15 мкг). На фиг. 3 схематически представлен синтез HFt-MP-PASE, содержащего лекарственное средство митоксантрон (MIT) или пиксантрон (PIX). Для ясности показаны только 4 из 24 модифицированных N-концов HFt.In fig. Figure 2 shows the movement profiles of electrophoresis bands in a native agarose gel. Lane HFt-MP-PAS (15 μg); Lane 2, HFt-MP-PASE (15 μg). In fig. 3 schematically shows the synthesis of HFt-MP-PASE containing the drug mitoxantrone (MIT) or pixantrone (PIX). For clarity, only 4 of the 24 modified HFt N termini are shown.
На фиг. 4 показана способность инкапсулировать митоксантрон или пиксантрон у предыдущей конструкции HFt (HFt-MP-PAS) по сравнению с новым белком HFt-MP-PASE и другими данными из литературы. Величины относительного выхода указаны в виде % выхода белка и количества связанных молекул лекарственного средства. Можно видеть, что данная конструкция, являющаяся объектом данного патента, неожиданно и непредвиденно имеет превосходные выходы с точки зрения получения белка по сравнению как с нативным HFt, так и с модифицированным HFt (HFt-MP-PAS). На фиг. 5 показаны профили элюции эксклюзионной хроматографии (SEC) и распределение частиц по размерам (DLS) конструкций на основе HFt. (A) SEC-анализ конструкций HFt-MP-PAS (черный) и HFt-MP-PASE (красный), загруженных MIT. Профили элюции, полученные при одновременном отслеживании вкладов белка и MIT при 280 нм (сплошная линия) и 610 нм (пунктирная линия), соответственно. (В) DLS-профили тех же конструкций.In fig. Figure 4 shows the ability to encapsulate mitoxantrone or pixantrone of the previous HFt construct (HFt-MP-PAS) compared to the new HFt-MP-PASE protein and other data from the literature. Relative yield values are reported as % protein yield and number of drug molecules bound. It can be seen that this design, which is the subject of this patent, unexpectedly and unexpectedly has superior yields in terms of protein production compared to both native HFt and modified HFt (HFt-MP-PAS). In fig. Figure 5 shows the size exclusion chromatography (SEC) elution profiles and particle size distribution (DLS) of the HFt-based constructs. (A) SEC analysis of MIT-loaded HFt-MP-PAS (black) and HFt-MP-PASE (red) constructs. Elution profiles obtained by simultaneously monitoring protein and MIT contributions at 280 nm (solid line) and 610 nm (dashed line), respectively. (B) DLS profiles of the same structures.
На фиг. 6 показано высвобождение лекарственного средства из комплексов HFt-MP-PASE-MIT. Наноносители, нагруженные MIT, хранили при 4 и 37°С в PBS и анализировали на содержание митоксантрона с помощью SEC в определенные моменты времени. Процент утечки митоксантрона оценивали путем сравнения собранных одновременно профилей элюции при 280 нм и 610 нм.In fig. Figure 6 shows drug release from HFt-MP-PASE-MIT complexes. MIT-loaded nanocarriers were stored at 4 and 37 °C in PBS and analyzed for mitoxantrone content by SEC at specific time points. The percentage of mitoxantrone leakage was assessed by comparing simultaneously collected elution profiles at 280 nm and 610 nm.
На фиг. 7 показана локализация HFt-MP-PASE-MIT (концентрация MIT 20 мкМ) в клеточных линиях рака толстой кишки SW480 (верхняя панель) и SW620 (нижняя панель) после 3-часовой инкубации. Левые панели: окрашивание ламином (Lamin) А/С (маркер ядерной мембраны, зеленый); центральные панели: MIT (синий); правые панели: наложение. Белая черта обозначает длину в 10 мкм.In fig. Figure 7 shows the localization of HFt-MP-PASE-MIT (MIT concentration 20 μM) in colon cancer cell lines SW480 (top panel) and SW620 (bottom panel) after 3-hour incubation. Left panels: Lamin A/C staining (nuclear membrane marker, green); center panels: MIT (blue); right panels: overlay. The white bar indicates a length of 10 µm.
На фиг. 8 показана локализация MIT (панели А, В), HFt-MP-PAS-MIT (панели С, D) и HFt-MP-PASE-MIT (панели Е, F) в клеточных линиях рака толстой кишки SW480 (панели А, С и Е) и SW620 (панели В, D и F) после 3 ч инкубации. Концентрация MIT составляет 20 мкМ во всех экспериментах. Белая черта обозначает длину 20 мкм. На фиг. 9 показана эффективность MIT и HFt-MP-PASE-MIT в уничтожении линий клеток человека РаСа-44, Capan-1 и MiaPaCa2 (рак поджелудочной железы), НТ1080 (фибросаркома), MDA-MB-231 (рак молочной железы) и SW480 и SW620 (колоректальный рак). Среднее ± SEM (n = 3)In fig. Figure 8 shows the localization of MIT (panels A, B), HFt-MP-PAS-MIT (panels C, D) and HFt-MP-PASE-MIT (panels E, F) in SW480 colon cancer cell lines (panels A, C and E) and SW620 (panels B, D, and F) after 3 h of incubation. The MIT concentration was 20 μM in all experiments. The white bar indicates a length of 20 µm. In fig. Figure 9 shows the effectiveness of MIT and HFt-MP-PASE-MIT in killing human cell lines PaCa-44, Capan-1 and MiaPaCa2 (pancreatic cancer), HT1080 (fibrosarcoma), MDA-MB-231 (breast cancer) and SW480 and SW620 (colorectal cancer). Mean ± SEM (n = 3)
На фиг. 10 показаны результаты экспериментов по биораспределению доксорубицин-содержащих соединений. Концентрации доксорубицина в плазме рассчитывали через 24 ч после внутривенных инъекций мышам, несущим опухоль поджелудочной железы человека (ксенотрансплантаты), некапсулированного лекарственного средства доксорубицина или доксорубицина, инкапсулированного в соединениях на основе ферритина: нативный HFt, HFt-MP-PAS и HFt-MP-PASE.In fig. Figure 10 shows the results of experiments on the biodistribution of doxorubicin-containing compounds. Doxorubicin plasma concentrations were calculated 24 h after intravenous injections into mice bearing human pancreatic tumors (xenografts) of unencapsulated doxorubicin drug or doxorubicin encapsulated in ferritin-based compounds: native HFt, HFt-MP-PAS, and HFt-MP-PASE .
На фиг. 11 схематически представлено изготовление наночастиц на основе HFt, где помимо модификаций N-конца, показанных ранее (HFt-MP-PAS), остатки нативного цистеина замещены остатками серина и ненативные остатки цистеина или глутамата (в красных сферах) включены во внутреннюю полость (HFt-Cys-MP-PASE или HFt-Glu-MP-PASE).In fig. 11 schematically shows the fabrication of HFt-based nanoparticles, where in addition to the N-terminal modifications shown earlier (HFt-MP-PAS), native cysteine residues are replaced by serine residues and non-native cysteine or glutamate residues (in red spheres) are included in the internal cavity (HFt- Cys-MP-PASE or HFt-Glu-MP-PASE).
На фиг. 12 схематически представлен синтез HFt-Cys-MP-PASE или HFt-Glu-MP-PASE, содержащего лекарственное средство, реакционноспособное по отношению к тиоловой группе цистеинов (например, малеимид), или лекарственное средство, содержащее положительный мотив. Для ясности показаны только 4 из 24 модифицированных N-концов HFt. Ненативные остатки цистеина во внутренней по- 3 044061 лости белка показаны красным цветом.In fig. 12 schematically illustrates the synthesis of HFt-Cys-MP-PASE or HFt-Glu-MP-PASE containing a drug reactive with the thiol group of cysteines (eg, maleimide) or a drug containing a positive motif. For clarity, only 4 of the 24 modified HFt N termini are shown. Non-native cysteine residues in the inner cavity of the protein are shown in red.
На фиг. 13 показана способность инкапсулировать производное доксорубицина 6-малеимидокапроилгидразон (DOX-EMCH) или комбинацию малеимидопропионовой кислоты и Genz-644282 новым белком HFt-Cys2-MP-PASE (содержащим 4 ненативных цистеина на мономер, 96 на 24 мера) или способность инкапсулировать нативный митоксантрон или Genz-644282 с помощью HFt-Glu-MP-PASE (содержащего 4 ненативных глутамата на мономер, 96 на 24 мера). Относительные выходы указаны в виде % выхода белка и числа конъюгированных молекул лекарственного средства.In fig. 13 показана способность инкапсулировать производное доксорубицина 6-малеимидокапроилгидразон (DOX-EMCH) или комбинацию малеимидопропионовой кислоты и Genz-644282 новым белком HFt-Cys2-MP-PASE (содержащим 4 ненативных цистеина на мономер, 96 на 24 мера) или способность инкапсулировать нативный митоксантрон или Genz-644282 using HFt-Glu-MP-PASE (containing 4 non-native glutamates per monomer, 96 by 24 mer). Relative yields are reported as % protein yield and number of conjugated drug molecules.
Подробное описание изобретенияDetailed Description of the Invention
Слитый белок, который является объектом настоящего изобретения, содержит по меньшей мере три домена.The fusion protein that is the subject of the present invention contains at least three domains.
Первый домен содержит аминокислотную последовательность тяжелой цепи ферритина человека. Такая аминокислотная последовательность представляет собой нативную последовательность, имеющую по меньшей мере 90% идентичности последовательности. Так как длина тяжелой цепи ферритина человека составляет 183 аминокислоты (SEQ ID NO:1), то вариант, имеющий по меньшей мере 90% идентичности последовательности, содержит до 19 аминокислотных замен по сравнению с нативной последовательностью.The first domain contains the amino acid sequence of the human ferritin heavy chain. Such an amino acid sequence is a native sequence having at least 90% sequence identity. Since the heavy chain length of human ferritin is 183 amino acids (SEQ ID NO:1), a variant having at least 90% sequence identity contains up to 19 amino acid substitutions compared to the native sequence.
В одном варианте осуществления тяжелая цепь ферритина человека представляет собой мутеин, в котором остатки цистеина с поверхности белка удалены и по меньшей мере один цистеин или отрицательно заряженный (аспартат или глутамат) остаток вставлен во внутреннюю полость белка, предпочтительно, два, три или четыре цистеина или аспартата, или глутамата вставляются во внутреннюю полость белка. Нативные цистеиновые остатки с поверхности белка заменены остатком без тиолреактивной группы, с предпочтительной заменой цистеина на серин. Белковая поверхность ферритина человека в данном описании определяется как любые остатки, доступные для растворителя. Внутренняя полость ферритина человека определяется в данном описании как любые остатки, не доступные для растворителя.In one embodiment, the human ferritin heavy chain is a mutein in which cysteine residues from the surface of the protein are removed and at least one cysteine or negatively charged (aspartate or glutamate) residue is inserted into the internal cavity of the protein, preferably two, three or four cysteines or aspartate or glutamate are inserted into the internal cavity of the protein. Native cysteine residues from the protein surface are replaced by a residue without a thiol-reactive group, with a preference for replacing cysteine with serine. The protein surface of human ferritin is defined herein as any solvent accessible residue. The internal cavity of human ferritin is defined herein as any residue that is not accessible to solvent.
Например, в одном варианте осуществления цистеин вставлен вместо лизина 71, лизина 143 и/или глицина 182.For example, in one embodiment, a cysteine is inserted in place of lysine 71, lysine 143, and/or glycine 182.
В одном предпочтительном варианте осуществления тяжелая цепь ферритина человека представляет собой аминокислотную последовательность SEQ ID NO: 2 варианта HFT (HFT-Cys1), лишенного нативных остатков цистеина и содержащего три ненативных остатка цистеина во внутренней полости, которые представляют альтернативный вариант. Аминокислотная последовательность HFt-Cys1 характеризуется шестью аминокислотными заменами: серин вместо цистеина 90, серин вместо цистеина 102, серин вместо цистеина 130, цистеин вместо лизина 71, цистеин вместо лизина 143 и цистеин вместо глицина 182.In one preferred embodiment, the human ferritin heavy chain is the amino acid sequence of SEQ ID NO: 2 of an HFT variant (HFT-Cys1) lacking native cysteine residues and containing three non-native cysteine residues in the inner cavity that represent an alternative variant. The amino acid sequence of HFt-Cys1 is characterized by six amino acid substitutions: serine instead of cysteine 90, serine instead of cysteine 102, serine instead of cysteine 130, cysteine instead of lysine 71, cysteine instead of lysine 143, and cysteine instead of glycine 182.
В одном предпочтительном варианте осуществления тяжелая цепь ферритина человека лишена нативных остатков цистеина и содержит четыре ненативных остатка цистеина во внутренней полости, которые представляют альтернативный вариант (HFt-Cys2). Аминокислотная последовательность данного дополнительного варианта характеризуется семью аминокислотными заменами: серин вместо цистеина 90, серин вместо цистеина 102, серин вместо цистеина 130, цистеин вместо лизина 53, цистеин вместо лизина 71, цистеин вместо треонина 135 и цистеин вместо лизина 143. В одном предпочтительном варианте осуществления тяжелая цепь ферритина человека лишена нативных остатков цистеина и содержит четыре ненативных остатка глутамата во внутренней полости, которые представляют альтернативный вариант (HFt-Glu). Аминокислотная последовательность данного дополнительного варианта характеризуется семью аминокислотными заменами: серин вместо цистеина 90, серин вместо цистеина 102, серин вместо цистеина 130, глутамат вместо лизина 53, глутамат вместо лизина 71, глутамат вместо треонина 135 и глутамат вместо лизина 143. Все мутеины/варианты ферритина человека, раскрытые в данном документе, представляют собой объекты настоящего изобретения. Все раскрытые в данном документе варианты осуществления тяжелой цепи ферритина человека могут быть использованы в качестве первого домена в слитом белке по изобретению. Аминокислотная последовательность нативного HFt представляет собой (учитывая, что первый метионин является началом кодирующей области и может быть удален при дальнейшей обработке белка):In one preferred embodiment, the human ferritin heavy chain is devoid of native cysteine residues and contains four non-native cysteine residues in the inner cavity that represent an alternative variant (HFt-Cys2). The amino acid sequence of this additional variant is characterized by seven amino acid substitutions: serine instead of cysteine 90, serine instead of cysteine 102, serine instead of cysteine 130, cysteine instead of lysine 53, cysteine instead of lysine 71, cysteine instead of threonine 135, and cysteine instead of lysine 143. In one preferred embodiment The human ferritin heavy chain lacks native cysteine residues and contains four non-native glutamate residues in the inner cavity, which represent an alternative variant (HFt-Glu). The amino acid sequence of this additional variant is characterized by seven amino acid substitutions: serine instead of cysteine 90, serine instead of cysteine 102, serine instead of cysteine 130, glutamate instead of lysine 53, glutamate instead of lysine 71, glutamate instead of threonine 135, and glutamate instead of lysine 143. All muteins/ferritin variants humans disclosed herein constitute the objects of the present invention. All human ferritin heavy chain embodiments disclosed herein can be used as the first domain in a fusion protein of the invention. The amino acid sequence of native HFt is (given that the first methionine is the beginning of the coding region and can be removed during further processing of the protein):
(SEQIDNO 1)(SEQIDNO 1)
MTTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFMTTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYF
LHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKPDCDDWESGLNAMECALHLEKNVN QSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKMGAPESGLAEY LFDKHTLGDSDNESLHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKPDCDDWESGLNAMECALHLEKNVN QSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKMGAPESGLAEY LFDKHTLGDSDNES
В некоторых вариантах осуществления слитый белок HFt по изобретению содержит вариант HFt (HFt Cys1), лишенный нативных остатков цистеина и содержащий три ненативных остатка цистеина во внутренней полости. В одном варианте осуществления аминокислотная последовательность варианта HFT Cys1 представляет собой:In some embodiments, the HFt fusion protein of the invention comprises a variant HFt (HFt Cys1) lacking native cysteine residues and containing three non-native cysteine residues in the internal cavity. In one embodiment, the amino acid sequence of the HFT Cys1 variant is:
- 4 044061 (SEQ ID NO 2)- 4 044061 (SEQ ID NO 2)
MTTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYF LHQSHEEREHAEKLMCLQNQRGGRIFLQDIKKPDSDDWESGLNAMESALHLEKNVN QSLLELHKLATDKNDPHLSDFIETHYLNEQVCAIKELGDHVTNLRKMGAPESGLAEY LFDKHTLGDSDNECMTTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYF LHQSHEEREHAEKLMCLQNQRGGRIFLQDIKKPDSDDWESGLNAMESALHLEKNVN QSLLELHKLATDKNDPHLSDFIETHYLNEQVCAIKELGDHVTNLRKMGAPESGLAEY LFDKHTLGDSDNEC
Аминокислотная последовательность варианта HFt Cys2 представляет собой:The amino acid sequence of the HFt Cys2 variant is:
(SEQ ID NO 15)(SEQ ID NO 15)
MTTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFACYF LHQSHEEREHAEKLMCLQNQRGGRIFLQDIKKPDSDDWESGLNAMESALHLEKNVN QSLLELHKLATDKNDPHLSDFIECHYLNEQVCAIKELGDHVTNLRKMGAPESGLAEY LFDKHTLGDSDNESMTTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFACYF LHQSHEEREHAEKLMCLQNQRGGRIFLQDIKKPDSDDWESGLNAMESALHLEKNVN QSLLELHKLATDKNDPHLSDFIECHYLNEQVCAIKELGDHVTNLRKMGAPESGLAEY LFDKHTLGDSDNES
В некоторых вариантах осуществления слитый белок HFt по изобретению содержит вариант HFt (HFt Glu), лишенный нативных остатков цистеина и содержащий четыре ненативных остатка глутамата во внутренней полости. В одном варианте осуществления аминокислотная последовательность вариант HFt Glu представляет собой:In some embodiments, the HFt fusion protein of the invention comprises a variant HFt (HFt Glu) lacking native cysteine residues and containing four non-native glutamate residues in the internal cavity. In one embodiment, the amino acid sequence of the HFt Glu variant is:
(SEQID NO: 18)(SEQID NO: 18)
MTTASTSQVRQNYHQDSEAA1NRQ1NLELYASYVYLSMSYYFDRDDVALKNFAEYF LHQSHEEREHAEKLMELQNQRGGRIFLQDIKKPDSDDWESGLNAMESALHLEKNVN QSLLELHKLATDKNDPHLSDFTEEHYLNEQVEATKELGDHVTNLRKMGAPESGLAEY LFDKHTLGDSDNESMTTASTSQVRQNYHQDSEAA1NRQ1NLELYASYVYLSMSYYFDRDDVALKNFAEYF LHQSHEEREHAEKLMELQNQRGGRIFLQDIKKPDSDDWESGLNAMESALHLEKNVN QSLLELHKLATDKNDPHLSDFTEEHYLNEQVEATKELGDHVTNLRKMGAPESGLAEY LFDKHTLGDSDNES
Второй домен слитого белка по изобретению содержит аминокислотную последовательность по меньшей мере одного сайта расщепления матриксной металлопротеиназы (ММР), в частности, ММР 2, ММР 3, ММР 7 или ММР 9. В качестве неограничивающего примера, далее перечислены несколько пептидов, которые имитируют последовательность расщепления цепи коллагена и особенно эффективно расщепляются с помощью ММР 2 и ММР 9:The second domain of the fusion protein of the invention contains the amino acid sequence of at least one matrix metalloproteinase (MMP) cleavage site, in particular MMP 2, MMP 3, MMP 7 or MMP 9. As a non-limiting example, the following are several peptides that mimic the cleavage sequence collagen chains and are especially efficiently degraded by MMP 2 and MMP 9:
Gly Pro Leu Gly He Ala Gly Gin (SEQ ID NO: 3)Gly Pro Leu Gly He Ala Gly Gin (SEQ ID NO: 3)
Gly Pro Gin Gly He Trp Gly Gin (SEQ ID NO: 4)Gly Pro Gin Gly He Trp Gly Gin (SEQ ID NO: 4)
Pro Leu Gly Leu Ala Gly (SEQ ID NO: 5)Pro Leu Gly Leu Ala Gly (SEQ ID NO: 5)
Pro Vai Gly Leu He Gly (SEQ ID NO: 6)Pro Vai Gly Leu He Gly (SEQ ID NO: 6)
Cys Gly Leu Asp Asp (SEQ ID NO: 7)Cys Gly Leu Asp Asp (SEQ ID NO: 7)
Аминокислотные последовательности, которые содержат сайт расщепления для предполагаемого фермента, также могут быть сконструированы таким образом, что сайт расщепления повторяется несколько раз, как, например, в последовательности, как показано ниже:Amino acid sequences that contain a cleavage site for a putative enzyme can also be designed such that the cleavage site is repeated several times, such as in the sequence shown below:
Gly Pro Leu Gly He Ala Gly Gin Gly Pro Leu Gly He Ala Gly Gin (SEQ ID NO: 8).Gly Pro Leu Gly He Ala Gly Gin Gly Pro Leu Gly He Ala Gly Gin (SEQ ID NO: 8).
Все ранее указанные аминокислотные последовательности являются характерными, но не ограничивающими примерами получения слитых белков и наночастиц согласно настоящему изобретению.All previously mentioned amino acid sequences are representative, but not limiting, examples of the preparation of fusion proteins and nanoparticles according to the present invention.
Третий домен слитого белка по изобретению, связанный с N-концом, по существу состоит или состоит из аминокислотной последовательности полипептида, которая богата пролином, серином, аланином и по меньшей мере одной отрицательно заряженной аминокислотой, такой как глутамат или аспартат (для краткости называемый PASE), для повышения стабильности белка в процессе инкапсулирования лекарственного средства, особенно с лекарственными средствами, которые могут стимулировать белковую агрегацию, и повышения стабильности комплекса белок-лекарственное средство по сравнению с полипептидом, в котором отсутствуют отрицательно заряженные аминокислоты (PAS).The third domain of the fusion protein of the invention, linked to the N-terminus, essentially consists of or consists of a polypeptide amino acid sequence that is rich in proline, serine, alanine and at least one negatively charged amino acid such as glutamate or aspartate (called PASE for short) , to improve protein stability during drug encapsulation, especially with drugs that can stimulate protein aggregation, and to improve the stability of the protein-drug complex compared to a polypeptide that lacks negatively charged amino acids (PAS).
Полипептид PASE по существу состоит из аминокислотных последовательностей, богатых Pro, Ala и Ser, и по меньшей мере одного или нескольких Glu и/или Asp, которые образуют отрицательно заряженный неструктурированный полимер, длина которого предпочтительно составляет менее 80 аминокислотных остатков, более предпочтительно содержит от 20 до 80 аминокислотных остатков, еще более предпочтительно содержит от 30 до 70 аминокислотных остатков. В предпочтительном варианте осуществления пролиновые остатки вышеуказанного полипептида PASE составляют от 10 до 40% от общего количества аминокислотных остатков полипептида PASE.The PASE polypeptide is essentially composed of amino acid sequences rich in Pro, Ala and Ser, and at least one or more Glu and/or Asp, which form a negatively charged unstructured polymer, preferably less than 80 amino acid residues in length, more preferably containing from 20 up to 80 amino acid residues, even more preferably contains from 30 to 70 amino acid residues. In a preferred embodiment, the proline residues of the above PASE polypeptide comprise from 10 to 40% of the total amino acid residues of the PASE polypeptide.
Согласно одному варианту осуществления домен PASE будет содержать один, два, три или четыре глутамата и/или аспартата. В одном предпочтительном варианте осуществления домен PASE содержит не более одного глутамата или аспартата в пределах 15, 16, 17, 18, 19 или 20 остатков домена PAS.In one embodiment, the PASE domain will contain one, two, three or four glutamates and/or aspartates. In one preferred embodiment, the PASE domain contains no more than one glutamate or aspartate within residues 15, 16, 17, 18, 19, or 20 of the PAS domain.
Примеры полипептидов PASE, особенно подходящие для применения в рамках настоящего изобретения и поэтому являющиеся предпочтительными, представляют собой следующие:Examples of PASE polypeptides particularly suitable for use in the present invention and therefore preferred are the following:
- 5 044061- 5 044061
ASP AAP APASP AAP APSAP AEASP AAP APASP AAP APS APAE (SEQ ID NO: 9);ASP AAP APASP AAP APSAP AEASP AAP APASP AAP APS APAE (SEQ ID NO: 9);
ASPAAPAPASPAEPAPSAPAASPAAPAPASPAEPAPSAPA (SEQ ID NO: 10);ASPAAPAPASPAEPAPSAPAASPAAPAPASPAEPAPSAPA (SEQ ID NO: 10);
ASP AAP APASP AAP APSAP AEASP AAP APASP AAP APSAP AEASPAAP APASP AAP APSASP AAP APASP AAP APSAP AEASP AAP APASP AAP APSAP AEASPAAP APASP AAP APS
APAEASPAAPAPAS (SEQ ID NO: 11);APEAASPAAPAPAS (SEQ ID NO: 11);
ASP AAP APASP AAP APSAP AD ASP AAP APASP AAP APSAP AD (SEQ ID NO: 12);ASP AAP APASP AAP APSAP AD ASP AAP APASP AAP APSAP AD (SEQ ID NO: 12);
ASPAAPAPASPADPAPSAPAASPAAPAPASPADPAPSAPA (SEQ ID NO: 13);ASPAAPAPASPADPAPSAPAASPAAPAPASPADPAPSAPA (SEQ ID NO: 13);
ASP AAP APASP AAP APSAP ADASP AAP APASP AAP APSAP ADASP AAP APASP AAP APSASP AAP APASP AAP APSAP ADASP AAP APASP AAP APSAP ADASP AAP APASP AAP APS
AP AD ASP AAPAPAS (SEQ ID NO: 14);AP AD ASP AAPAPAS (SEQ ID NO: 14);
Все раскрытые здесь домены PASE являются объектами настоящего изобретения. Термином полипептид по существу состоит из аминокислотных последовательностей, богатых Pro, Ala и Ser в настоящем описании определяется полипептид, который образует стабильную конформацию случайного клубка и который состоит из Pro, Ala и Ser, где от 1 до 5% остатков Pro, Ala и Ser заменены другими аминокислотами, такими как, например, глицин, которые не изменяют стабильную конформацию случайного клубка полипептида. Как упомянуто выше, биосинтетические полипептиды в конформации случайного клубка (или полипептидные сегменты в конформации случайного клубка) по настоящему изобретению, состоящие исключительно из остатков пролина и аланина и по меньшей мере одного остатка глутамата или аспартата, образуют стабильную конформацию случайного клубка. Используемый в данном документе термин случайный клубок в целом относится к любой конформации полимерной молекулы, включая аминокислотные полимеры/аминокислотные последовательности/полипептиды, в которых отдельные мономерные элементы, образующие указанную полимерную структуру являются по существу случайным образом ориентированными по отношению к смежным мономерным элементам, в то же время все еще являясь химически связанными с указанными смежными мономерными элементами. Конкретно, полипептид, аминокислотная последовательность или аминокислотный полимер, принимающий/имеющий/образующий конформацию случайного клубка, по существу, не имеют определенной вторичной и третичной структуры. Природа полипептидных случайных клубков и способы их экспериментальной идентификации известны специалисту в данной области и описаны в научной литературе (Cantor (1980) Biophysical Chemistry, 2nd ed., W.H. Freeman and Company, New York; Creighton (1993) Proteins-Structures and Molecular Properties, 2nd ed., W.H. Freeman and Company, New York; Smith (1996) Fold Des 1:R95 R106).All PASE domains disclosed herein are subject to the present invention. The term polypeptide essentially consisting of amino acid sequences rich in Pro, Ala and Ser is defined herein as a polypeptide that forms a stable random coil conformation and which consists of Pro, Ala and Ser, where 1 to 5% of the Pro, Ala and Ser residues are replaced other amino acids, such as glycine, which do not change the stable conformation of the random coil of the polypeptide. As mentioned above, the biosynthetic random coil polypeptides (or random coil polypeptide segments) of the present invention consisting solely of proline and alanine residues and at least one glutamate or aspartate residue form a stable random coil conformation. As used herein, the term random coil generally refers to any conformation of a polymer molecule, including amino acid polymers/amino acid sequences/polypeptides, in which the individual monomer units forming the polymer structure are substantially randomly oriented with respect to adjacent monomer units, while while still being chemically bound to said adjacent monomer elements. Specifically, a polypeptide, amino acid sequence, or amino acid polymer adopting/having/forming a random coil conformation does not essentially have a defined secondary and tertiary structure. The nature of polypeptide random coils and methods for their experimental identification are known to one skilled in the art and are described in the scientific literature (Cantor (1980) Biophysical Chemistry, 2nd ed., W.H. Freeman and Company, New York; Creighton (1993) Proteins-Structures and Molecular Properties, 2nd ed., W.H. Freeman and Company, New York; Smith (1996) Fold Des 1:R95 R106).
Стабилизирующий и маскирующий полипептид PASE добавляется к поверхности HFt посредством короткой пептидной последовательности, которая, как ранее указывалось, содержит один или более сайтов расщепления металлопротеиназы, получая таким образом слитый белок по изобретению с замещаемой маскировкой. Действительно, полипептид PASE может быть селективно удален в тканях-мишенях посредством внеклеточных матриксных металлопротеиназ (ММР). Было показано, что ММР 2 и ММР 9 являются ключевыми металлопротеиназами, которые сверхэкспрессированы в опухолевом микроокружении и участвуют в ангиогенезе, инвазии и опухолевых метастазах.A PASE stabilizing and masking polypeptide is added to the surface of HFt through a short peptide sequence which, as previously stated, contains one or more metalloproteinase cleavage sites, thereby obtaining a displaceable masking fusion protein of the invention. Indeed, the PASE polypeptide can be selectively removed in target tissues by extracellular matrix metalloproteinases (MMPs). MMP 2 and MMP 9 have been shown to be key metalloproteinases that are overexpressed in the tumor microenvironment and are involved in angiogenesis, invasion and tumor metastasis.
Еще один объект настоящего изобретения представляет собой слитый белок, в котором домен PASE или PAS и ММР-расщепляемые домены связаны с С-концом белка HFt вместо N-конца. Согласно одному варианту осуществления слитый белок имеет SEQ ID NO: 16 или SEQ ID NO: 17.Another aspect of the present invention is a fusion protein in which a PASE or PAS domain and MMP cleavage domains are linked to the C terminus of the HFt protein instead of the N terminus. In one embodiment, the fusion protein has SEQ ID NO: 16 or SEQ ID NO: 17.
PAS MP HFt (SEQ ID NO: 16)PAS MP HFt (SEQ ID NO: 16)
MTTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYF LHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKPDCDDWESGLNAMECALHLEKNVN QSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKMGAPESGLAEY LFDKHTLGDSDNESPLGLAGASP AAP APASP AAP APSAP AASP AAP APASP AAP APSA PAMTTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYF LHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKPDCDDWESGLNAMECALHLEKNVN QSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKMGAPESGLAEY LFDKHTLGDSDNESPLGLAGA SP AAP APASP AAP APSAP AASP AAP APASP AAP APSA PA
PASE MP HFt (SEQ ID NO: 17)PASE MP HFt (SEQ ID NO: 17)
MTTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYF LHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKPDCDDWESGLNAMECALHLEKNVN QSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKMGAPESGLAEY LFDKHTLGDSDNESPLGLAGASP AAP APASP AEP APSAP AASP AAP APASP AEP APSAP AMTTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYF LHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKPDCDDWESGLNAMECALHLEKNVN QSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKMGAPESGLAEY LFDKHTLGDSDNESPLGLAGA SP AAP APASP AEP APSAP AASP AAP APASP AEP APSAP A
Применение полипептидов PASE на мультимерной поверхности ферритина в рамках настоящего изобретения дает несколько преимуществ по сравнению с известными из уровня техники. Для того, чтобы получить с более высоким выходом монодисперсные материалы во время образования комплекса белок-лекарственное средство, авторы изобретения генетически преобразовали HFt MP PAS, о котором сообщалось ранее, путем добавления остатков глутамата (Е) или аспартата (D) в последовательности PAS и получили новую конструкцию, названную HFt MP PASE. Благодаря данной модификации, белки на основе ферритина могут образовывать комплексы с лекарственными средствами, которые могут стимулировать агрегацию белка (например, митоксантрон и пиксантрон) более растворимым и монодисThe use of PASE polypeptides on the multimeric surface of ferritin within the scope of the present invention provides several advantages over those known in the prior art. In order to obtain monodisperse materials in higher yield during protein-drug complex formation, we genetically engineered the previously reported HFt MP PAS by adding glutamate (E) or aspartate (D) residues to the PAS sequences to obtain a new design called HFt MP PASE. Thanks to this modification, ferritin-based proteins can form complexes with drugs that can stimulate protein aggregation (for example, mitoxantrone and pixantrone) to become more soluble and monodispersible.
- 6 044061 персным образом, чем нативная HFt или модифицированный аналог HFt MP PAS.- 6 044061 in a different way than native HFt or the modified analogue HFt MP PAS.
Данное улучшение стабильности инкапсулирования комплекса белок-лекарственное средство, которое отличается от доксорубицина (например, митоксантрон и пиксантрон), было удивительно и неожиданно получены авторами настоящего изобретения, которые сконструировали наночастицы на основе тяжелой цепи ферритина человека (HFt), используя как технологию слитых генов, так и технологию получения рекомбинантных белков. В частности, как будет подробно описано в разделе, относящемся к примерам, были сделаны генетические конструкции, которые, в одной последовательности нуклеиновой кислоты (например, ДНК), кодируют три последовательности, приведенные на фиг. 1: i) HFt; ii) короткие пептидные последовательности (МР), расщепляемые ММР-2/9; iii) неструктурированные полипептидные последовательности, богатые Pro, Ser, Ala и Glu (PASE), предпочтительно, с длиной, составляющей от 20 до 80 остатков. Последовательности ii) и iii) связаны с N-концом HFt для обратимой маскировки.This improvement in the encapsulation stability of a protein-drug complex that is different from doxorubicin (e.g., mitoxantrone and pixantrone) was surprisingly and unexpectedly obtained by the present inventors, who constructed human ferritin heavy chain (HFt) nanoparticles using both gene fusion technology, and the technology for producing recombinant proteins. In particular, as will be described in detail in the examples section, genetic constructs have been made that, in a single nucleic acid sequence (eg, DNA), encode the three sequences shown in FIG. 1: i) HFt; ii) short peptide sequences (MP) cleaved by MMP-2/9; iii) unstructured polypeptide sequences rich in Pro, Ser, Ala and Glu (PASE), preferably with a length ranging from 20 to 80 residues. Sequences ii) and iii) are linked to the N-terminus of HFt for reversible masking.
Как уже говорилось выше, слитые белки HFt, полученные авторами настоящего изобретения, спонтанно образуют наночастицы HFt, способные нести терапевтические молекулы (химические соединения, моноклональные антитела, пептиды и тому подобное) (фиг. 2).As discussed above, the HFt fusion proteins produced by the present inventors spontaneously form HFt nanoparticles capable of carrying therapeutic molecules (chemicals, monoclonal antibodies, peptides, and the like) (FIG. 2).
В одном варианте осуществления одна или несколько, предпочтительно 5, терапевтических и/или диагностических молекул инкапсулированы во внутренней полости наночастицы HFt, или ковалентно связаны с поверхностью наночастицы HFt, или ковалентно связаны во внутренней полости HFt. Количество связанного лекарственного средства и гомогенность комплекса белок-лекарственное средство значительно увеличивались по сравнению с немодифицированным белком (HFt) или модифицированным PAS (HFt MP PAS) благодаря наличию полипептидов PASE. Гомогенность полученного материала является весьма желательным свойством в области фармацевтики, поскольку оно указывает на отсутствие негативных эффектов, таких как осаждение, кластеризация и потеря конечного продукта, несущего терапевтическую молекулу.In one embodiment, one or more, preferably 5, therapeutic and/or diagnostic molecules are encapsulated in the internal cavity of the HFt nanoparticle, or covalently bound to the surface of the HFt nanoparticle, or covalently bound in the internal cavity of the HFt. The amount of bound drug and the homogeneity of the protein-drug complex were significantly increased compared to unmodified protein (HFt) or modified PAS (HFt MP PAS) due to the presence of PASE polypeptides. The homogeneity of the resulting material is a highly desirable property in the pharmaceutical field as it indicates the absence of negative effects such as sedimentation, clustering and loss of the final product carrying the therapeutic molecule.
Терапевтическая молекула представляет собой, например, фармацевтически активный ингредиент. Как используется в настоящем описании, термин фармацевтический активный ингредиент или, проще, активный ингредиент относится к любой фармацевтически активной молекуле (химическое соединение, моноклональное антитело, пептид и тому подобное), например, к молекуле, которая может быть использована для лечения злокачественного новообразования. Предпочтительные активные ингредиенты для использования в настоящем изобретении представляют собой, например, но ими не ограничиваются, доксорубицин, митоксантрон, пиксантрон, Genz 644282, паклитаксел, ауристатины, камптотецины, гемцитабин и активные ингредиенты на основе платины. Также может быть использован предшественник активных ингредиентов, перечисленных выше.The therapeutic molecule is, for example, a pharmaceutically active ingredient. As used herein, the term pharmaceutical active ingredient or, more simply, active ingredient refers to any pharmaceutically active molecule (chemical compound, monoclonal antibody, peptide, and the like), for example, a molecule that can be used to treat a cancer. Preferred active ingredients for use in the present invention include, for example, but are not limited to, doxorubicin, mitoxantrone, pixantrone, Genz 644282, paclitaxel, auristatins, camptothecins, gemcitabine and platinum-based active ingredients. A precursor to the active ingredients listed above may also be used.
При терапевтических применениях наночастицы HFt по настоящему изобретению, которые действуют как нацеленные системы носителей, могут быть введены индивиду или пациенту посредством любого подходящего пути введения, например перорально, парентерально, внутривенно, внутрибрюшинно, внутримышечно, в виде суппозиториев, внутриочагово, интраназально или подкожно, интратекально, интралимфатически, путем ингаляции микрокапель или путем имплантации устройства замедленного высвобождения, например осмотического насоса. Как используется в настоящем описании, термин индивид относится к животным, таким как млекопитающие, включая человека, коров, овец, коз, лошадей, собак, кошек, кроликов, крыс, мышей и тому подобное.For therapeutic applications, the HFt nanoparticles of the present invention, which act as targeted carrier systems, can be administered to an individual or patient through any suitable route of administration, for example, orally, parenterally, intravenously, intraperitoneally, intramuscularly, suppositories, intralesional, intranasally or subcutaneously, intrathecally , intralymphatically, by inhalation of microdroplets, or by implantation of a sustained release device such as an osmotic pump. As used herein, the term individual refers to animals such as mammals, including humans, cows, sheep, goats, horses, dogs, cats, rabbits, rats, mice and the like.
Как используется в настоящем описании, термин лечение относится к свидетельству успешного или улучшенного лечения определенного заболевания, поражения, состояния или симптома, или, при определенных обстоятельствах, к профилактике возникновения симптома или состояния.As used herein, the term treatment refers to evidence of successful or improved treatment of a particular disease, lesion, condition or symptom, or, under certain circumstances, prevention of the occurrence of a symptom or condition.
При терапевтических применениях наночастицы HFt по изобретению используются для введения терапевтически эффективной дозы фармацевтически активного ингредиента. Терапевтически эффективная доза означает дозу, которая дает терапевтический эффект, для достижения которого ее вводят. Точная доза будет зависеть от ряда факторов, в том числе цели лечения, индивида, заболевания, на которое направлено лечение, и тому подобное, и может быть легко определена специалистом в данной области техники, используя известные per se методики (см, например, Lieberman, Pharmaceutical Dosage Forms (vols. 1-3, 1992); Lloyd, The Art, Science and Technology of Pharmaceutical Compounding (1999); Pickar, Dosage Calculations (1999); and Remington: The Science and Practice of Pharmacy, 20th Edition, 2003, Gennaro, Ed., Lippincott, Williams & Wilkins).In therapeutic applications, the HFt nanoparticles of the invention are used to administer a therapeutically effective dose of a pharmaceutically active ingredient. A therapeutically effective dose means a dose that produces the therapeutic effect for which it is administered. The exact dosage will depend on a number of factors, including the purpose of treatment, the individual, the disease being treated, and the like, and can be readily determined by one skilled in the art using techniques known per se (see, e.g., Lieberman, Pharmaceutical Dosage Forms (vols. 1-3, 1992); Lloyd, The Art, Science and Technology of Pharmaceutical Compounding (1999); Pickar, Dosage Calculations (1999); and Remington: The Science and Practice of Pharmacy, 20th Edition, 2003 , Gennaro, Ed., Lippincott, Williams & Wilkins).
Наночастицы HFt по изобретению могут быть использованы для лечения любого заболевания, которое требует введения фармацевтического ингредиента, например, путем изолирования активного ингредиента в полости наночастицы или путем его ковалентного связывания с поверхностью наночастиц. Наночастицы могут быть также использованы для диагностики, более конкретно, для визуализации заболеваний, путем изолирования активного ингредиента в полости наночастицы или путем его ковалентного связывания с поверхностью наночастиц.The HFt nanoparticles of the invention can be used to treat any disease that requires administration of a pharmaceutical ingredient, for example, by sequestering the active ingredient within the cavity of the nanoparticle or by covalently binding it to the surface of the nanoparticle. Nanoparticles can also be used for diagnostics, more specifically for disease imaging, by sequestering the active ingredient within the cavity of the nanoparticle or by covalently binding it to the surface of the nanoparticle.
Наночастицы HFt по изобретению могут быть введены индивиду для лечения любого заболевания, предпочтительно, гиперпролиферативного заболевания, включая злокачественное новообразование, например: карциномы, глиомы, мезотелиомы, меланомы, саркомы, лимфомы, лейкоз, аденокарциномы, рак молочной железы, рак яичников, рак шейки матки, глиобластома, лейкоз, лимфома, рак предстательнойThe HFt nanoparticles of the invention can be administered to an individual for the treatment of any disease, preferably a hyperproliferative disease, including malignancy, for example: carcinomas, gliomas, mesotheliomas, melanomas, sarcomas, lymphomas, leukemia, adenocarcinomas, breast cancer, ovarian cancer, cervical cancer , glioblastoma, leukemia, lymphoma, prostate cancer
- 7 044061 железы, лимфома Беркитта, рак головы и шеи, рак толстой кишки, колоректальный рак, немелкоклеточный рак легкого, мелкоклеточный рак легкого, рак пищевода, рак желудка, рак поджелудочной железы, гепатобилиарный рак, рак мочевого пузыря, мелкоклеточный рак кишечника, рак прямой кишки, рак почки, рак желчного пузыря, рак полового члена, рак уретры, рак яичка, рак шейки матки, рак влагалища, рак матки, рак щитовидной железы, паратиреоидный рак, рак надпочечников, эндокринный рак поджелудочной железы, карциноидная опухоль, рак кости, рак кожи, ретинобластомы, множественные меланомы, лимфома Ходжкина, неходжкинская лимфома (см. CANCER: PRINCIPLES AND PRACTICE (DeVita, V. Т. et al. 2008 Edition) для других видов злокачественного новообразования).- 7 044061 glands, Burkitt's lymphoma, head and neck cancer, colon cancer, colorectal cancer, non-small cell lung cancer, small cell lung cancer, esophageal cancer, stomach cancer, pancreatic cancer, hepatobiliary cancer, bladder cancer, small cell intestinal cancer, cancer rectal cancer, kidney cancer, gall bladder cancer, penile cancer, urethral cancer, testicular cancer, cervical cancer, vaginal cancer, uterine cancer, thyroid cancer, parathyroid cancer, adrenal cancer, endocrine pancreatic cancer, carcinoid tumor, bone cancer , skin cancer, retinoblastomas, multiple melanomas, Hodgkin's lymphoma, non-Hodgkin's lymphoma (see CANCER: PRINCIPLES AND PRACTICE (DeVita, V. T. et al. 2008 Edition) for other types of malignancy).
Согласно одному варианту осуществления наночастицы HFT являются связанными с каждой молекулой, содержащей тиолреактивный мотив, например, лекарственные средства, линкеры, флуорофоры и тому подобное с использованием, например, одного или нескольких цистеинов, вставленных во внутреннюю полость. Согласно одному предпочтительному варианту осуществления наночастицы HFT инкапсулируют производное доксорубицина 6-малеимидокапроилгидразон (DOX ЕМСН) или линкер малеимидопропионовую кислоту и лекарственный препарат GENZ 644282, используя один или несколько цистеинов, вставленных во внутренней полости. Следующие примеры приведены в иллюстративных целях, но не в качестве ограничения объема настоящего изобретения, определенного в прилагаемой формуле изобретения.In one embodiment, the HFT nanoparticles are coupled to each thiol-reactive motif-containing molecule, eg, drugs, linkers, fluorophores and the like using, for example, one or more cysteines inserted into an internal cavity. In one preferred embodiment, HFT nanoparticles encapsulate the doxorubicin derivative 6-maleimidocaproylhydrazone (DOX EMCH) or the linker maleimidopropionic acid and the drug GENZ 644282 using one or more cysteines inserted in the internal cavity. The following examples are provided for illustrative purposes and not as a limitation on the scope of the present invention as defined in the appended claims.
ПримерыExamples
Пример 1.Example 1.
Конструирование экспрессионных векторов для слитых белков HFt-MP-PASE.Construction of expression vectors for HFt-MP-PASE fusion proteins.
В качестве попытки уменьшить агрегацию белка и повысить стабильность было решено ввести отрицательно заряженные остатки в образующую внешнюю поверхность последовательность PAS, слитую с каждой субъединицей HFt. Действительно, анализ полученной ранее конструкции HFt-MP-PAS дал основание предположить, что введение двух глутаматных остатков в последовательность PAS из 40 остатков может вызвать достаточное электростатическое отталкивание для предотвращения агрегации между сборками различных 24-меров, не влияя на субъединичную сборку внутри 24-мера. Чтобы максимально распределить отрицательные заряды на поверхности конструкции, остатки глутаминовой кислоты были размещены на расстоянии 20 остатков друг от друга.In an attempt to reduce protein aggregation and increase stability, it was decided to introduce negatively charged residues into the outer surface-forming PAS sequence fused to each HFt subunit. Indeed, analysis of the previously obtained HFt-MP-PAS construct suggested that the introduction of two glutamate residues into the 40-residue PAS sequence could induce sufficient electrostatic repulsion to prevent aggregation between assemblies of different 24-mers without affecting subunit assembly within the 24-mer. . To maximize the distribution of negative charges on the surface of the structure, glutamic acid residues were placed at a distance of 20 residues from each other.
Ген HFt-MP-PASE получали путем объединения трех различных последовательностей в одну последовательность: HFt (SEQ ID NO: 1), МР (SEQ ID NO: 5) и PASE (SEQ ID NO: 10). Данная конструкция отличается от ранее раскрытой конструкции HFt-MP-PAS (названной ранее HFt MMP PAS40; WO 2016051340) только двумя аминокислотными заменами в последовательности PAS: глутамат вместо аланина 13 и глутамат вместо аланина 33. Каждый из сравнительных экспериментов, описанных в данном новом патенте, был выполнен с использованием данных двух конструкций. Вектор экспрессии, рЕТ-Ha, содержащий ген HFt-MP-PASE, синтезировали, используя GENEART AG (Germania). Синтез гена проводили с учетом оптимизации кодонов для высоких уровней экспрессии в Escherichia coli.The HFt-MP-PASE gene was obtained by combining three different sequences into one sequence: HFt (SEQ ID NO: 1), MP (SEQ ID NO: 5) and PASE (SEQ ID NO: 10). This design differs from the previously disclosed HFt-MP-PAS construct (formerly named HFt MMP PAS40; WO 2016051340) by only two amino acid substitutions in the PAS sequence: glutamate in place of alanine 13 and glutamate in place of alanine 33. Each of the comparative experiments described in this new patent , was performed using these two designs. An expression vector, pET-Ha, containing the HFt-MP-PASE gene was synthesized using GENEART AG (Germania). Gene synthesis was carried out taking into account codon optimization for high expression levels in Escherichia coli.
Слитый белок HFt MP PASE получали с помощью рекомбинантной технологии белков и очищали из растворимой клеточной фракции, с высоким выходом, подобно HFt-MP-PAS (около 150 мг на литр из культуры клеток Е. coli). Влияние на подвижность белка отрицательно заряженных остатков глутамата (48 на белок), вставленных на поверхности белка, оценивали путем проведения электрофореза в агарозном геле в нативных условиях (фиг. 1). В отличие от денатурирующего SDS PAGE, в нативном электрофорезе подвижность белка зависит как от заряда белка, так и от молекулярной массы. Предполагая, что последняя сопоставима для HFt MP PAS и HFt MP PASE, наблюдаемая разница в подвижности белка должна быть приписана дополнительным отрицательным зарядам в конструкции HFt-MP-PASE (фиг. 2). Пример 2.The HFt MP PASE fusion protein was produced by recombinant protein technology and purified from the soluble cell fraction in high yield, similar to HFt-MP-PAS (about 150 mg per liter from E. coli cell culture). The effect on protein mobility of negatively charged glutamate residues (48 per protein) inserted on the protein surface was assessed by performing agarose gel electrophoresis under native conditions (Fig. 1). Unlike denaturing SDS PAGE, in native electrophoresis the mobility of the protein depends on both the charge of the protein and the molecular weight. Assuming that the latter is comparable for HFt MP PAS and HFt MP PASE, the observed difference in protein mobility must be attributed to the additional negative charges in the HFt-MP-PASE construct (Fig. 2). Example 2.
Получение HFt-MP-PAS и HFt-MP-PASE, несущих химиотерапевтические средства В качестве химиотерапевтических средств авторы настоящего изобретения привели пример, в котором использовали лекарственные средства митоксантрон (MIT) или пиксантрон (РГХ). Данные препараты были инкапсулированы внутрь белковой полости слитых белков, используя процесс рассоединения-соединения белка как функцию рН в соответствии с протоколом, раскрытым в Falvo et al., 2016, Biomacromolecules. 17(2):514 22. Процедура разборки/сборки показана на фиг. 3.Preparation of HFt-MP-PAS and HFt-MP-PASE Carrying Chemotherapeutic Agents As chemotherapeutic agents, the present inventors gave an example in which the drugs mitoxantrone (MIT) or pixantrone (PX) were used. These drugs were encapsulated within the protein cavity of the fusion proteins using a protein uncoupling-uncoupling process as a function of pH according to the protocol disclosed in Falvo et al., 2016, Biomacromolecules. 17(2):514 22. The disassembly/assembly procedure is shown in Fig. 3.
Пример 3.Example 3.
Тестирование инкапсулирующих выходов лекарственного средства митоксантрон и пиксантрон.Testing of encapsulating drug releases mitoxantrone and pixantrone.
Эффективность инкапсулировать MIT или PIX в HFt-MP-PASE сравнивали с таковой у нативного белка HFT и HFT MP PAS (фиг. 4). Во всех проведенных экспериментах HFt-MP-PASE превосходит как нативный белок HFt, так и белок HFt-MP-PAS по количеству белка, полученного в конце реакций. Это указывает на то, что HFt-MP-PASE является более стабильным и не агрегирует/не выпадает в осадок из раствора во время образования комплекса белок-лекарственное средство.The efficiency of encapsulating MIT or PIX in HFt-MP-PASE was compared with that of native HFT protein and HFT MP PAS (Fig. 4). In all experiments performed, HFt-MP-PASE outperformed both native HFt protein and HFt-MP-PAS protein in terms of the amount of protein obtained at the end of the reactions. This indicates that HFt-MP-PASE is more stable and does not aggregate/precipitate out of solution during protein-drug complex formation.
Пример 4.Example 4.
Тестирование гомогенности и стабильности комплекса белок-митоксантрон.Testing the homogeneity and stability of the protein-mitoxantrone complex.
Комплексы HFt-MP-PASE, нагруженные MIT, были более растворимыми и монодисперсными, чем HFt-MP-PAS-аналоги, так что высокомолекулярные частицы в растворе не обнаруживались (фиг. 5).The MIT-loaded HFt-MP-PASE complexes were more soluble and monodisperse than the HFt-MP-PAS counterparts, such that high molecular weight species were not detectable in solution (Figure 5).
- 8 044061- 8 044061
Эксперименты по динамическому рассеянию света (DLS) показали, что образцы HFt-MP-PASE-MIT имеют приблизительно такой же размер, как ранее раскрытый авторами изобретения HFt-MP-PAS-DOX (содержащий доксорубицин как лекарственное средство), со средним диаметром 17,0±1,1 нм (фиг. 5В). Полученные результаты указывают на то, что вставка остатков глутамата в HFt-MP-PASE-MIT неожиданно приводит к более высокой растворимости и гомогенности белка по сравнению с HFt-MP-PASаналогом, вероятно, предотвращая MIT-опосредованные белок-белковые взаимодействия в растворе. В дополнение, несколько большее число молекул MIT на 24-мер, наблюдаемое для HFt-MP-PAS по сравнению с HFt-MP-PASE (55,0 против 49,0) может быть, вероятно, приписано присутствию молекул MIT на поверхностях первой конструкции, что может способствовать белок-белковой агрегации.Dynamic light scattering (DLS) experiments revealed that the HFt-MP-PASE-MIT samples were approximately the same size as the inventors' previously disclosed HFt-MP-PAS-DOX (containing the drug doxorubicin), with an average diameter of 17. 0 ± 1.1 nm (Fig. 5B). The results indicate that the insertion of glutamate residues into HFt-MP-PASE-MIT unexpectedly results in higher protein solubility and homogeneity compared to the HFt-MP-PAS counterpart, likely preventing MIT-mediated protein-protein interactions in solution. In addition, the slightly higher number of MIT molecules per 24-mer observed for HFt-MP-PAS compared to HFt-MP-PASE (55.0 vs. 49.0) can likely be attributed to the presence of MIT molecules on the surfaces of the former design , which may promote protein-protein aggregation.
Стабильность комплексов HFt-MP-PASE-MIT тестировали путем хранения растворов в течение 2 месяцев в PBS при 4°С или 37°С и оценивая содержание MIT с помощью анализа эксклюзионной хроматографии (SEC) каждые 7 дней. HFt-MP-PASE-MIT продемонстрировал превосходную стабильность, менее 10% MIT высвобождалось после 2 месяцев хранения при 4°С (фиг. 6), и не имелось признаков помутнения или выпадения в осадок.The stability of the HFt-MP-PASE-MIT complexes was tested by storing the solutions for 2 months in PBS at 4°C or 37°C and assessing the MIT content by size exclusion chromatography (SEC) analysis every 7 days. HFt-MP-PASE-MIT showed excellent stability, with less than 10% of MIT released after 2 months of storage at 4°C (Figure 6), and there was no evidence of turbidity or precipitation.
Пример 5.Example 5.
Тестирование клеточной интернализации и локализации наноносителей на основе HFt.Cellular internalization and localization testing of HFt-based nanocarriers.
Для того чтобы определить, подвергаются ли MIT-содержащие конструкции на основе HFt связыванию с клеточной поверхностью и/или интернализации, их инкубировали с опухолевыми клетками толстой кишки, SW480 и SW620, при 37°С в течение 1 или 3 ч и флуоресценцию, связанную с MIT, визуализировали с помощью конфокальной микроскопии.To determine whether MIT-containing HFt-based constructs undergo cell surface binding and/or internalization, they were incubated with colon tumor cells, SW480 and SW620, at 37°C for 1 or 3 h and fluorescence associated with MIT, imaged using confocal microscopy.
На фиг. 7 показана локализация HFt МР PASE MIT в клеточных линиях SW480 (верхняя панель) и SW620 (нижняя панель). После 3 ч инкубирования HFt MP PASE MIT в больших количествах накапливается в ядрах обеих клеточных линий, как показано окрашиванием маркером ядерной мембраны ламином А/С (в зеленом цвете). В частности, MIT локализуется во внутриядерных структурах, предположительно являющихся ядрышками, на основе размера, положения и формы, как ранее предполагалось для клеток карциномы толстой кишки и злокачественных клеток молочной железы.In fig. Figure 7 shows the localization of the HFt MP PASE MIT in the SW480 (top panel) and SW620 (bottom panel) cell lines. After 3 h of incubation, HFt MP PASE MIT accumulated in large quantities in the nuclei of both cell lines, as shown by staining with the nuclear membrane marker lamin A/C (in green). Specifically, MIT localizes to intranuclear structures predicted to be nucleoli based on size, position, and shape, as previously suggested for colon carcinoma cells and malignant breast cells.
Сравнение между клетками, обработанными свободным MIT, HFt-MP-PAS-MIT или HFt-MP-PASE показано на фиг. 8. Во всех случаях MIT локализуется внутри клеточных ядер, но в случае свободного MIT и HFt-MP-PAS-MIT препарат частично присутствует также в цитоплазме. В целом, клетки, обработанные HFt-MP-PASE-MIT, показали высокую степень накопления MIT в ядрах.A comparison between cells treated with free MIT, HFt-MP-PAS-MIT, or HFt-MP-PASE is shown in FIG. 8. In all cases, MIT is localized inside the cell nucleus, but in the case of free MIT and HFt-MP-PAS-MIT, the drug is also partially present in the cytoplasm. Overall, cells treated with HFt-MP-PASE-MIT showed a high degree of nuclear accumulation of MIT.
Пример 6.Example 6.
Анти-пролиферативные эффекты HFt MP PASE MIT in vitro.Anti-proliferative effects of HFt MP PASE MIT in vitro.
Для оценки способности HFt-MP-PASE, нагруженного MIT, уничтожать злокачественные клетки in vitro авторы изобретения провели анализы жизнеспособности ХТТ на широком спектре злокачественных клеток человека различного происхождения:To evaluate the ability of MIT-loaded HFt-MP-PASE to kill malignant cells in vitro, we performed XTT viability assays on a wide range of human malignant cells of various origins:
фибросаркома НТ1080; тройной негативный MDA молочной железы MB 231;fibrosarcoma HT1080; triple negative breast MDA MB 231;
панкреатические РаСа 44, Capan 1 и MiaPaCa2; колоректальные злокачественные клетки SW480 и SW620.pancreatic PaCa 44, Capan 1 and MiaPaCa2; colorectal malignant cells SW480 and SW620.
Не только MIT сохранил фармакологическую активность после инкапсулирования в конструкциях HFt MP PASE, но и MIT-нагруженные наноносители показали значения IC50, сходные со значениями для неинкапсулированного MIT во всех протестированных клеточных линиях, и даже меньше в некоторых случаях (см. фиг. 9). Данный факт замечателен тем, что неинкапсулированные лекарственные средства могут свободно диффундировать в клетки, в то время как конструкции HFt MP PASE могут только доставлять MIT путем скорость-лимитирующего опосредованного рецептором поглощения. Более того, новая наносистема HFt-MP-PASE-MIT показала, что на клеточных линиях поджелудочной железы эффективность уничтожения приблизительно в десять раз выше, чем у применяемого в настоящее время препарата гемцитабина (то есть 0,43 против 6,75 мкМ, 0,10 против 2,8 мкМ и 0,07 против 1,15 мкМ для клеток Раса44, Capan 1 и MiaPaCa2, соответственно).Not only did MIT retain pharmacological activity after encapsulation in HFt MP PASE constructs, but MIT-loaded nanocarriers showed IC50 values similar to those for unencapsulated MIT in all cell lines tested, and even lower in some cases (see Figure 9) . This fact is remarkable in that unencapsulated drugs can diffuse freely into cells, whereas HFt MP PASE constructs can only deliver MIT via rate-limiting receptor-mediated uptake. Moreover, the new HFt-MP-PASE-MIT nanosystem showed that in pancreatic cell lines the killing efficiency was approximately ten times higher than that of the currently used drug gemcitabine (i.e., 0.43 vs. 6.75 μM, 0. 10 vs. 2.8 µM and 0.07 vs. 1.15 µM for Paca44, Capan 1 and MiaPaCa2 cells, respectively).
Пример 7.Example 7.
Эксперименты по биораспределению доксорубицин-содержащих соединений на мышах.Experiments on the biodistribution of doxorubicin-containing compounds in mice.
Для сравнения, как HFt-MP-PASE сравнивается с HFt-MP-PAS с точки зрения накопления лекарственного средства в опухолях и органах, оба слитых белка инкапсулировали с лекарственным средством. В качестве лекарственного средства был выбран доксорубицин (DOX), поскольку оба слитых белка обладают схожей способностью инкапсулировать его, в отличие от лекарственного средства митоксантрона. Концентрации доксорубицина в плазме рассчитывали через 24 ч после внутривенных инъекций у мышей, несущих человеческие опухоли поджелудочной железы (ксенотрансплантаты), неинкапсулированного лекарственного средства доксорубицин или доксорубицина, инкапсулированного в соединениях на основе ферритина: нативный HFT, HFt-MP-PAS и HFt-MP-PASE. На фиг. 10 показано, что HFt-MPPASE обладает более высокой стабильностью в сыворотке крови и также больше накапливается в опухоли.To compare how HFt-MP-PASE compares with HFt-MP-PAS in terms of drug accumulation in tumors and organs, both fusion proteins were encapsulated with drug. Doxorubicin (DOX) was chosen as the drug because both fusion proteins have similar encapsulating ability, unlike the drug mitoxantrone. Doxorubicin plasma concentrations were calculated 24 hours after intravenous injections in mice bearing human pancreatic tumors (xenografts), unencapsulated drug doxorubicin, or doxorubicin encapsulated in ferritin-based compounds: native HFT, HFt-MP-PAS, and HFt-MP- PASE. In fig. 10 shows that HFt-MPPASE has higher stability in serum and also accumulates more in the tumor.
- 9 044061- 9 044061
Пример 8.Example 8.
Конструирование экспрессионных векторов для слитых белков HFt-MP-PASE-Cys или Glu.Construction of expression vectors for HFt-MP-PASE-Cys or Glu fusion proteins.
В качестве попытки улучшить и облегчить связывание лекарственного средства внутри полости в ферритине, было решено удалить остатки цистеина с поверхности белка и ввести дополнительные цистеиновые или глутаматные остатки в белковую полость. Таким образом, было бы возможно связать с внутренней полостью каждую молекулу, содержащую тиолреактивный или положительно заряженный мотив, например, лекарства, линкеры, флуорофоры и тому подобное. На фиг. 11 и 12 схематично показано изготовление и синтез HFt на основе наночастиц, где в дополнение к N-концевым модификациям, показанным ранее (HFt-MP-PAS), нативные остатки цистеина замещены остатками серина, и ненативные остатки цистеина или глутамата (в красных сферах) включены во внутреннюю полость (HFt-Cys-MP-PASE или HFt Glu MP PASE). Фиг. 13 показывает способность инкапсулировать производное доксорубицина 6-малеимидокапроилгидразон с помощью нового белка HFt-Cys2-MP-PASE (содержащего 4 ненативных цистеина на мономер, 96 на 24-мер). На этой же фигуре показана способность HFt-Cys-MP-PASE инкапсулировать линкер малеимидопропионовую кислоту и лекарственное средство Genz 644282. На этой же фигуре показана способность HFt-Glu-MP-PASE инкапсулировать свободные лекарственные средства митоксантрон или Genz 644282. Все данные лекарственные средства были инкапсулированы в белковой полости слитых белков, используя процесс рассоединения-соединения белка как функцию рН в соответствии с протоколом, раскрытым в Falvo et al., 2016, Biomacromolecules. 17(2):514 22, с одной модификацией. В реакциях с использованием молекул, содержащих малеимид, их добавляли при рН от 6,5 до 7,5 после стадии кислого рН, чтобы избежать возможного повреждения молекулы из-за низких значений рН. Кроме того, в реакции с использованием линкера малеимидопропионовой кислоты и лекарственного средства Genz 644282, первый добавляли перед лекарственным средством при соотношении линкер/тиол 1,2:1.In an attempt to improve and facilitate drug binding within the ferritin cavity, it was decided to remove cysteine residues from the surface of the protein and introduce additional cysteine or glutamate residues into the protein cavity. Thus, it would be possible to bind to the internal cavity every molecule containing a thiol-reactive or positively charged motif, such as drugs, linkers, fluorophores and the like. In fig. 11 and 12 schematically show the fabrication and synthesis of nanoparticle-based HFt, where in addition to the N-terminal modifications shown previously (HFt-MP-PAS), native cysteine residues are replaced by serine residues, and non-native cysteine or glutamate residues (in red spheres) included in the internal cavity (HFt-Cys-MP-PASE or HFt Glu MP PASE). Fig. 13 shows the ability to encapsulate the doxorubicin derivative 6-maleimidocaproylhydrazone using the novel HFt-Cys2-MP-PASE protein (containing 4 non-native cysteines per monomer, 96 per 24-mer). The same figure shows the ability of HFt-Cys-MP-PASE to encapsulate the maleimidopropionic acid linker and the drug Genz 644282. The same figure shows the ability of HFt-Glu-MP-PASE to encapsulate the free drugs mitoxantrone or Genz 644282. All of these drugs were encapsulated in the protein cavity of the fusion proteins using a protein uncoupling-coupling process as a function of pH according to the protocol disclosed in Falvo et al., 2016, Biomacromolecules. 17(2):514 22, with one modification. In reactions using molecules containing maleimide, they were added at pH 6.5 to 7.5 after an acidic pH step to avoid possible damage to the molecule due to low pH values. Moreover, in the reaction using maleimidopropionic acid linker and drug Genz 644282, the former was added before the drug at a linker/thiol ratio of 1.2:1.
Относительные выходы указаны в виде % выхода белка и числа конъюгированных молекул лекарственного средства.Relative yields are reported as % protein yield and number of conjugated drug molecules.
Пример 9.Example 9.
Анти-пролиферативные эффекты HFt-Glu-MP-PASE Genz 644282 in vitro Для тестирования пролиферации клетки саркомы человека (НТ 1080 и А204), рака молочной железы человека (MDA MB 231), меланомы человека (Colo38) и рака поджелудочной железы человека (РаСа44 и MiaPaCa2) высевали на 15 96-луночных планшетов в количестве, составляющем приблизительно 5х103/лунка, в 200 мкл полной среды при 37°С. На следующий день в лунки добавляли Genz 644282 или HFt Glu MP PASE Genz 644282, трехкратно, при различных концентрациях Genz 644282, и клетки культивировали в течение 72 ч. В течение последних 4 ч в культуре жизнеспособность клеток оценивали по восстановлению 3(4,5-диметилтиазол-2-ил)2,5-дифенилтетразолийбромида (МТТ). Всего в каждую лунку добавляли 1 мг/мл МТТ и образцы инкубировали в течение 30 мин при 37°С. После промывания кристаллы формазана растворяли в 100 мкл диметилсульфоксида. Поглощение измеряли при 550 нм.Anti-proliferative effects of HFt-Glu-MP-PASE Genz 644282 in vitro To test the proliferation of human sarcoma cells (HT 1080 and A204), human breast cancer (MDA MB 231), human melanoma (Colo38) and human pancreatic cancer (PaCa44) and MiaPaCa2) were seeded into 15 96-well plates at approximately 5 x 10 3 /well in 200 μl of complete medium at 37°C. The next day, Genz 644282 or HFt Glu MP PASE Genz 644282 was added to the wells three times at different concentrations of Genz 644282, and the cells were cultured for 72 hours. During the last 4 hours in culture, cell viability was assessed by the reduction of 3(4,5- dimethylthiazol-2-yl)2,5-diphenyltetrazolium bromide (MTT). A total of 1 mg/ml MTT was added to each well and the samples were incubated for 30 min at 37°C. After washing, the formazan crystals were dissolved in 100 μL of dimethyl sulfoxide. Absorbance was measured at 550 nm.
Анти-пролиферативные эффекты HFt Glu MP PASE Genz 644282 на культивируемые злокачественные клетки показаны на фиг. 14. Полученные результаты свидетельствуют о том, что HFt Glu MP PASE Genz 644282 эффективно ингибирует злокачественные клетки, выращенные in vitro зависимым от концентрации образом, со значениями IC50, одинаковыми или ниже по сравнению с неинкапсулированным лекарственным средством. Данные результаты имеют большое значение в свете потенциальных терапевтических применений. Те же результаты были также получены, используя конструкцию HFt-Cys-MP-PASE Genz 644282. Анти-пролиферативные эффекты HFt-Glu-MP-PASE Genz 644282 in vivo Пятинедельным самкам голых (nude) мышей CD1 (Charles River Laboratories, Лекко, Италия) инъецировали подкожно (то есть в правый бок) 4х106 клеток РаСа-44, ресуспендированных в 200 мкл среды RPMI1640 плюс 1% BSA. После того как размеры опухоли достигали объем около 100 мм3, мышей рандомизировали в группы из шести животных и внутривенно вводили 200 мкл физиологического раствора, Genz-644282 (1,9 мг/кг) или HFt-Glu-MP-PASE-Genz (0,95 или 1,9 мг/кг). Мышам делали внутривенные инъекции два раза в неделю в течение трех недель; объем опухоли измеряли два раза в неделю с помощью цифрового штангенциркуля, и массу мышей контролировали. После того как размер опухоли мышей достиг объема >1500 мм3, животных умерщвляли. На фиг. 15 представлены кривые роста опухолей через приблизительно две недели после последнего лечения. На данной фигуре очевидна способность HFt-Glu-MP-PASE-Genz резко снижать прогрессирование злокачественного новообразования, при этом наблюдается 100% полного ответа опухоли. На фиг. 16 показано общее выживание животного. Все животные, которых лечили HFt-Glu-MP-PASE-Genz, были свободны от заболевания и выживали через 100 дней после начала терапии, что указывает на высокую эффективность тестируемого соединения.The anti-proliferative effects of HFt Glu MP PASE Genz 644282 on cultured malignant cells are shown in FIG. 14. The results obtained indicate that HFt Glu MP PASE Genz 644282 effectively inhibits malignant cells grown in vitro in a concentration-dependent manner, with IC 50 values equal to or lower than the unencapsulated drug. These results are of great importance in light of potential therapeutic applications. The same results were also obtained using the HFt-Cys-MP-PASE Genz 644282 construct. Anti-proliferative effects of HFt-Glu-MP-PASE Genz 644282 in vivo in 5-week-old female CD1 nude mice (Charles River Laboratories, Lecco, Italy ) were injected subcutaneously (i.e., in the right flank) with 4x10 6 PaCa-44 cells resuspended in 200 μl of RPMI1640 medium plus 1% BSA. Once the tumor size reached a volume of approximately 100 mm 3 , mice were randomized into groups of six animals and intravenously injected with 200 μl of saline, Genz-644282 (1.9 mg/kg) or HFt-Glu-MP-PASE-Genz (0 .95 or 1.9 mg/kg). Mice received intravenous injections twice a week for three weeks; tumor volume was measured twice a week using a digital caliper, and the weight of the mice was monitored. After the tumor size of the mice reached a volume of >1500 mm 3 , the animals were sacrificed. In fig. 15 shows tumor growth curves approximately two weeks after the last treatment. This figure clearly demonstrates the ability of HFt-Glu-MP-PASE-Genz to dramatically reduce cancer progression, with a 100% complete tumor response rate. In fig. Figure 16 shows the overall survival of the animal. All animals treated with HFt-Glu-MP-PASE-Genz were free of disease and alive 100 days after initiation of therapy, indicating the high efficacy of the test compound.
--
Claims (15)
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| IT102017000116184 | 2017-11-06 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| EA044061B1 true EA044061B1 (en) | 2023-07-20 |
Family
ID=
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CN111328346B (en) | Fusion proteins based on human ferritin and protease cleavable peptides and their use as chemotherapeutic carriers | |
| RU2695220C2 (en) | Targeted conjugates and particles and compositions thereof | |
| US9644001B2 (en) | Cell-penetrating peptides | |
| US11981754B2 (en) | Biomimetic peptide and biodegradable delivery platform for the treatment of angiogenesis- and lymphangiogenesis-dependent diseases | |
| CN106922149B (en) | Fusion protein, nanoparticle composed of a plurality of monomers of said fusion protein and uses thereof | |
| US11679160B2 (en) | Castration resistant prostate cancer | |
| US20140294967A1 (en) | Stable nanocomposition comprising paclitaxel, process for the preparation thereof, its use and pharmaceutical compositions containing it | |
| TW200902051A (en) | Enzymatic anticancer therapy | |
| KR101958964B1 (en) | Cyclic peptides with an anti-neoplasic and anti-angiogenic activity | |
| Xu et al. | Multifunctional building elements for the construction of peptide drug conjugates | |
| JP2010509241A (en) | Self-aggregating nanoparticles composed of transmembrane peptides and their use for specific intratumoral delivery of anticancer agents | |
| EA044061B1 (en) | NEW FUSION PROTEINS BASED ON HUMAN FERRITIN AND PROTEASE CLEAVABLE PEPTIDES AND THEIR APPLICATION AS CARRIERS OF CHEMOTHERAPEUTICS | |
| CN109311940B (en) | DSG 2-derived peptides | |
| KR102274876B1 (en) | Novel cell penetrating peptides and use thereof | |
| US7368431B2 (en) | Polypeptide, the conjugate thereof with doxorubicine and a pharmaceutical composition based thereon | |
| CN110452301A (en) | A kind of antineoplastic amalgamation protein and its coded polynucleotide and application | |
| KR102274877B1 (en) | Novel cell penetrating peptides and use thereof | |
| AU2022346534A1 (en) | Novel protein and pharmaceutical composition comprising same for prevention or treatment of cancer | |
| CN117582520A (en) | Ferritin-tumor immunoregulatory molecule conjugate and use thereof | |
| KR20190123824A (en) | Use of Colicin D fragment for treating cancer | |
| CN109415424A (en) | Peptide and its nanoparticle formulations |