DE60231701D1 - Ammoniumsulfat zur aufhebung von inhibitorischen effekten - Google Patents

Ammoniumsulfat zur aufhebung von inhibitorischen effekten

Info

Publication number
DE60231701D1
DE60231701D1 DE60231701T DE60231701T DE60231701D1 DE 60231701 D1 DE60231701 D1 DE 60231701D1 DE 60231701 T DE60231701 T DE 60231701T DE 60231701 T DE60231701 T DE 60231701T DE 60231701 D1 DE60231701 D1 DE 60231701D1
Authority
DE
Germany
Prior art keywords
effects
inhibitoral
abolishing
rna
ammonium sulphate
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Expired - Lifetime
Application number
DE60231701T
Other languages
English (en)
Inventor
Christian Korfhage
Ralf Wyrich
Uwe Oelmueller
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Qiagen GmbH
Original Assignee
Qiagen GmbH
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Qiagen GmbH filed Critical Qiagen GmbH
Application granted granted Critical
Publication of DE60231701D1 publication Critical patent/DE60231701D1/de
Anticipated expiration legal-status Critical
Expired - Lifetime legal-status Critical Current

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/10—Processes for the isolation, preparation or purification of DNA or RNA
    • C12N15/1003—Extracting or separating nucleic acids from biological samples, e.g. pure separation or isolation methods; Conditions, buffers or apparatuses therefor

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Biomedical Technology (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Organic Chemistry (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biotechnology (AREA)
  • General Engineering & Computer Science (AREA)
  • Molecular Biology (AREA)
  • Plant Pathology (AREA)
  • Biophysics (AREA)
  • Microbiology (AREA)
  • Physics & Mathematics (AREA)
  • Crystallography & Structural Chemistry (AREA)
  • Biochemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Analytical Chemistry (AREA)
  • Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
  • Saccharide Compounds (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
DE60231701T 2001-01-25 2002-01-25 Ammoniumsulfat zur aufhebung von inhibitorischen effekten Expired - Lifetime DE60231701D1 (de)

Applications Claiming Priority (3)

Application Number Priority Date Filing Date Title
US26450801P 2001-01-25 2001-01-25
US26448801P 2001-01-26 2001-01-26
PCT/EP2002/000763 WO2002059360A2 (en) 2001-01-25 2002-01-25 Ammonium sulfate for neutralization of inhibitory effects

Publications (1)

Publication Number Publication Date
DE60231701D1 true DE60231701D1 (de) 2009-05-07

Family

ID=26950578

Family Applications (1)

Application Number Title Priority Date Filing Date
DE60231701T Expired - Lifetime DE60231701D1 (de) 2001-01-25 2002-01-25 Ammoniumsulfat zur aufhebung von inhibitorischen effekten

Country Status (8)

Country Link
US (1) US6872818B2 (de)
EP (1) EP1356122B1 (de)
JP (1) JP4139222B2 (de)
AT (1) ATE426678T1 (de)
AU (1) AU2002247654B9 (de)
CA (1) CA2433542C (de)
DE (1) DE60231701D1 (de)
WO (1) WO2002059360A2 (de)

Families Citing this family (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20050208501A1 (en) * 2004-03-16 2005-09-22 Ambion, Inc. Process and reagents for extraction of RNA from fractionated blood leukocytes
DE102005015005A1 (de) 2005-04-01 2006-10-05 Qiagen Gmbh Verfahren zur Behandlung einer Biomoleküle enthaltenden Probe
DE102006019650A1 (de) * 2006-04-25 2007-10-31 InViTek Gesellschaft für Biotechnik & Biodesign mbH Formulierungen und Verfahren zur Isolierung von Nukleinsäuren aus beliebigen komplexen Ausgangsmaterialien und nachfolgende komplexe Genanalytik
GB201107466D0 (en) 2011-05-05 2011-06-15 Loktionov Alexandre Device and method for non-invasive collection of colorectal mucocellular layer and disease detection
EP3265558B1 (de) * 2015-03-06 2020-05-06 Bio-Rad Laboratories, Inc. Stabilisierte rna-lösungen
JP7163186B2 (ja) * 2016-03-19 2022-10-31 キアゲン ゲーエムベーハー Ｒｎａの安定化
US20190153427A1 (en) * 2016-07-08 2019-05-23 President And Fellows Of Harvard College Determination of rna in blood or other fluids
IT202000018682A1 (it) * 2020-07-30 2022-01-30 Biofarma S R L Soluzione acquosa per la conservazione di acidi nucleici

Family Cites Families (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6204375B1 (en) * 1998-07-31 2001-03-20 Ambion, Inc. Methods and reagents for preserving RNA in cell and tissue samples
CA2299119C (en) 1999-02-23 2013-02-05 Qiagen Gmbh A method of stabilizing and/or isolating nucleic acids

Also Published As

Publication number Publication date
AU2002247654B2 (en) 2007-03-29
WO2002059360A3 (en) 2003-08-07
EP1356122B1 (de) 2009-03-25
JP4139222B2 (ja) 2008-08-27
CA2433542A1 (en) 2002-08-01
WO2002059360A2 (en) 2002-08-01
US20020115851A1 (en) 2002-08-22
EP1356122A2 (de) 2003-10-29
CA2433542C (en) 2008-12-02
US6872818B2 (en) 2005-03-29
AU2002247654A1 (en) 2002-08-06
ATE426678T1 (de) 2009-04-15
JP2004516853A (ja) 2004-06-10
AU2002247654B9 (en) 2007-05-10

Similar Documents

Publication Publication Date Title
ECSP055584A (es) Proceso para la preparación de fibrinógeno
DE60300734D1 (de) Anordnungen zur Vorbehandlung von Proben
DK1606317T3 (da) Anti-IL-22RA-antistoffer og bindingspartnere samt fremgangsmåder til anvendelse ved inflammation
BR0115842B1 (pt) dispositivo e processo para aplicação regulada de adesivos e/ou selantes.
WO2002097130A3 (de) Mikrostrukturen und deren verwendung für die gerichtete evolution von biomolekülen
DK1255826T3 (da) Automatisering af proteindesign for proteinbiblioteker
DE60122368D1 (de) Verwendung von Gaboxadol zur Behandlung von premenstruelle Störung, postnatal Depression oder postmenopausal-bedingte-dysphorische Störung
WO2004112687A3 (en) Antiviral acylguanidine compounds and methods
DE60323749D1 (de) Substituierte pyrroline als kinase inhibitoren
MX2020008272A (es) Nucleasas diseñadas específicas de blancos.
DE50307886D1 (de) Leitungsführungseinheit zur aktiven führung von leitungen, kabeln oder dergleichen
DE60231701D1 (de) Ammoniumsulfat zur aufhebung von inhibitorischen effekten
ATE344321T1 (de) Verfahren zur aufreinigung von bakterienzellen und zellbestandteilen
DE602004009824D1 (de) Analyse von massenspektraldaten in den ruhigen gebieten
DE60101559D1 (de) Benutzung von comt-inhibitoren als analgetika
ATE486059T1 (de) Synthese und verfahren zu deren verwendung von tetrahydroindolon analogen und derivaten
BR0107801B1 (pt) processo para tratar escàrias ou misturas de escàrias.
ATE331103T1 (de) Profilsystem für den querschnitt von flachschlüsseln
BR0202786B1 (pt) processo de sìntese de uréia.
ATE388941T1 (de) Neue pyrimidin-4,6-dicarbons urediamide zur selektiven inhibierung von kollagenasen
EA200401032A1 (ru) Антиинфарктные молекулы
ATE364389T1 (de) Verfahren zur herstellung von extrakten aus pelargonium sidoides und/oder pelargonium reniforme
ATE334174T1 (de) System und prozess zur reinigung und/oder behandlung von fahrzeugoberflächen
DE60109799D1 (de) Verwendung von quetiapin für aufmerksamkeitsmangel-hyperaktivitätsstörungen oder verhaltensstörungen
DE60327543D1 (de) Substituierte tetraline und indane und ihre verwendung

Legal Events

Date Code Title Description
8364 No opposition during term of opposition