DE19930933A1 - A cytochrome P450 2D6 derived peptide epitope and method for detecting anti-LKM 1 antibodies, useful for detecting autoimmune chronic hepatitis type 2 - Google Patents

A cytochrome P450 2D6 derived peptide epitope and method for detecting anti-LKM 1 antibodies, useful for detecting autoimmune chronic hepatitis type 2

Info

Publication number
DE19930933A1
DE19930933A1 DE19930933A DE19930933A DE19930933A1 DE 19930933 A1 DE19930933 A1 DE 19930933A1 DE 19930933 A DE19930933 A DE 19930933A DE 19930933 A DE19930933 A DE 19930933A DE 19930933 A1 DE19930933 A1 DE 19930933A1
Authority
DE
Germany
Prior art keywords
lkm
antibodies
determination
antibodies according
solid phase
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Granted
Application number
DE19930933A
Other languages
German (de)
Other versions
DE19930933B4 (en
Inventor
Werner Schoesler
Christian Hentschel
Falk Hiepe
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Human Gesellschaft fur Biochemica und Diagnos De
Original Assignee
Imtec Immundiagnostika GmbH
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Imtec Immundiagnostika GmbH filed Critical Imtec Immundiagnostika GmbH
Priority to DE19930933A priority Critical patent/DE19930933B4/en
Publication of DE19930933A1 publication Critical patent/DE19930933A1/en
Application granted granted Critical
Publication of DE19930933B4 publication Critical patent/DE19930933B4/en
Anticipated expiration legal-status Critical
Expired - Fee Related legal-status Critical Current

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/0004—Oxidoreductases (1.)
    • C12N9/0071—Oxidoreductases (1.) acting on paired donors with incorporation of molecular oxygen (1.14)
    • C12N9/0077—Oxidoreductases (1.) acting on paired donors with incorporation of molecular oxygen (1.14) with a reduced iron-sulfur protein as one donor (1.14.15)
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/564—Immunoassay; Biospecific binding assay; Materials therefor for pre-existing immune complex or autoimmune disease, i.e. systemic lupus erythematosus, rheumatoid arthritis, multiple sclerosis, rheumatoid factors or complement components C1-C9
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/795—Porphyrin- or corrin-ring-containing peptides
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/795—Porphyrin- or corrin-ring-containing peptides
    • G01N2333/80—Cytochromes
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/90—Enzymes; Proenzymes
    • G01N2333/902—Oxidoreductases (1.)
    • G01N2333/90245—Oxidoreductases (1.) acting on paired donors with incorporation of molecular oxygen (1.14)

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Immunology (AREA)
  • Molecular Biology (AREA)
  • Hematology (AREA)
  • Biomedical Technology (AREA)
  • Biotechnology (AREA)
  • Genetics & Genomics (AREA)
  • Microbiology (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)
  • Biochemistry (AREA)
  • Urology & Nephrology (AREA)
  • General Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Medicinal Chemistry (AREA)
  • General Engineering & Computer Science (AREA)
  • Rheumatology (AREA)
  • Cell Biology (AREA)
  • Rehabilitation Therapy (AREA)
  • Food Science & Technology (AREA)
  • Physics & Mathematics (AREA)
  • Analytical Chemistry (AREA)
  • General Physics & Mathematics (AREA)
  • Pathology (AREA)
  • Peptides Or Proteins (AREA)

Abstract

A peptide of the cytochrome P450 2D6, consisting of 30-40 (especially 33) amino acids, in the form of a conformational epitope, occurring in autoimmune chronic hepatitis type 2 is new. Independent claims are also included for: (1) a method to determine anti-LKM 1 antibodies comprising detecting specific binding of the cytochrome P450 2D6 (optionally bound to a carrier molecule adsorbed or covalently bound to a solid phase) in an immunoassay; and (2) a kit for the method of (1).

Description

Die Erfindung betrifft ein Verfahren zur Bestimmung von anti-LKM 1-Antikörpern. Anwendungsgebiete der Erfindung sind die Medizin und die pharmazeutische Industrie.The invention relates to a method for the determination of anti-LKM 1 antibodies. Areas of application of the invention are medicine and the pharmaceutical industry.

Zu den autoimmunen Lebererkrankungen zählt man vor allem die autoimmunen Verlaufsformen der chronisch aktiven Hepatitis (AI-CAH) Typ 1-3 sowie die primäre biliäre Zirrhose (PBC) und die Immuncholangopathie, die als Überlappungs-Syndrom zwischen AI-CAH und PBC anzusehen ist.The autoimmune liver diseases include above all the autoimmune forms chronic active hepatitis (AI-CAH) type 1-3 and primary biliary cirrhosis (PBC) and the immunocholangopathy, which is the overlap syndrome between AI-CAH and PBC can be seen.

Die Autoimmunhepatitiden, die strikt von virus-induzierten Verlaufsformen unterschieden werden müssen, sind relativ seltene Erkrankungen. Durch eine verbesserte serologische Diagnostik werden sie jedoch immer häufiger erkannt. Durch den Verlust der Selbsttoleranz kommt es zu Autoimmunreaktionen, die sich hauptsächlich gegen die Hepatozyten richten. Ob den dabei auftretenden Autoantikörpern pathogenetische Relevanz zukommt oder ob die Leberzelldestruktion allein durch T-Zellen vermittelt wird, ist noch nicht endgültig geklärt (1).The autoimmune hepatitis that strictly differentiated from virus-induced forms are relatively rare diseases. Through an improved serological Diagnostics, however, are recognized more and more often. By losing self-tolerance there are autoimmune reactions that are mainly directed against the hepatocytes. If the autoantibodies occurring are pathogenetically relevant or whether the Liver cell destruction mediated solely by T cells has not yet been finally clarified (1).

Der 2. Verlaufsform der autoimmunen chronisch aktiven Hepatitis wurde in der Vergangenheit aufgrund ihrer besonderen klinischen Bedeutung - 82% der Erkrankten entwickeln eine Leberzirrhose - gesonderte Beachtung geschenkt. Sie betrifft vorzugsweise Mädchen und junge Frauen und zeichnet sich häufig durch einen fulminanten Beginn und eine hohe Entzündungsaktivität aus. Serologisch ist diese Erkrankung durch eine Hypergammaglobulinämie und vor allem durch Autoantikörper gegen Leber- und Nieren- Mikrosomen charakterisiert. Als Targetantigen dieser als LKM 1 (liver-kidney-microsomes) bezeichneten Autoantikörper wurde das Cytochrom P450 2D6 (CYP2D6), ein Enzym der P450 Familie, identifiziert (2-4).The 2nd form of autoimmune chronic active hepatitis has been in the past due to their special clinical importance - 82% of those affected develop one Cirrhosis of the liver - special attention given. It mainly affects girls and boys Women and is often characterized by a brilliant start and a high Inflammatory activity. This disease is serological due to hypergammaglobulinemia and mainly characterized by autoantibodies against liver and kidney microsomes. As Targeted antigen of this autoantibody designated as LKM 1 (liver-kidney-microsomes) identified the cytochrome P450 2D6 (CYP2D6), an enzyme of the P450 family (2-4).

Die anti-LKM 1-Antikörper gelten als Marker der autoimmunen Hepatitis Typ 2. Sie können jedoch auch in ca. 7% der Patienten mit einer chronischen Hepatitis C und sehr selten bei einer Halothan induzierten Hepatitis beobachtet werden.The anti-LKM 1 antibodies are considered markers of type 2 autoimmune hepatitis. You can however also in about 7% of patients with chronic hepatitis C and very rarely in one Halothane-induced hepatitis can be observed.

Es konnte gezeigt werden, daß die immundominante Region des Proteins ein Abschnitt von 33 Aminosäuren ist. Für die idiopathische autoimmune Hepatitis Typ 2 gilt, daß die meisten LKM 1 positiven Seren lineare Epitope erkennen, die sich in dieser Region befinden (5).The immunodominant region of the protein could be shown to be a section of 33 Is amino acids. For idiopathic autoimmune hepatitis type 2, most LKM 1 positive sera recognize linear epitopes located in this region (5).

Nach dem Stand der Technik wurden anti-LKM 1-Autoantikörper bisher nur mit immunologischen Nachweisverfahren, wie z. B. Enzymimmunoassay (EIA), Immunoblot und Immunfluoreszenztest (IFT), bei denen entweder native mikrosomale Antigenpräparationen oder rekombinante Antigene, bestehend aus dem full lenght-CYP2D6 oder immundominanten Sequenzen von CYP2D6, fusioniert mit diversen Proteinen (Glutathion-S-Transferase, β- Galactosidase, His-tag), als Antigene an eine feste Phase immobilisiert wurden. Die rekombinanten Targetantigene wurden üblicherweise in pro- und eukariontischen Wirtszellen exprimiert.According to the prior art, anti-LKM 1 autoantibodies have so far only been used immunological detection methods, such as. B. Enzyme Immunoassay (EIA), Immunoblot and  Immunofluorescence test (IFT), in which either native microsomal antigen preparations or recombinant antigens consisting of the full length CYP2D6 or immunodominant Sequences of CYP2D6, fused with various proteins (glutathione-S-transferase, β- Galactosidase, His-tag), when antigens were immobilized on a solid phase. The recombinant target antigens were commonly found in pro- and eukaryotic host cells expressed.

Mit Hilfe dieser biologischen Expressionssysteme ist es jedoch nur sehr schwer möglich, kleine Peptide ohne Fusionspartner, der oft auch zur Aufreinigung des rekombinanten Antigens notwendig ist, zu exprimieren. Gerade diese Fusionsproteine maskieren aber häufig aufgrund ihrer Größe und Konformation die für die Antikörpererkennung notwendigen Epitope der immundominanten Struktur, so daß eine ausreichende Sensitivität des rekombinanten Antigens oft nicht gegeben ist.With the help of these biological expression systems, however, it is very difficult to make small ones Peptides without a fusion partner, often used to purify the recombinant antigen is necessary to express. However, it is precisely these fusion proteins that often mask due to their size and conformation are the epitopes necessary for antibody recognition immunodominant structure, so that sufficient sensitivity of the recombinant antigen is often not given.

Andererseits wird nicht selten durch die antigene Struktur das Fusionsprotein sterisch abgeschirmt, was die ohnehin relativ aufwendige Präparation des Antigens aus seiner biologischen Matrix (Wirtszelle) erschwert oder gänzlich verhindert.On the other hand, the fusion protein often becomes steric due to the antigenic structure shielded what the already relatively expensive preparation of the antigen from its biological matrix (host cell) difficult or completely prevented.

Im rekombinanten Antigen auch nach dessen Aufreinigung verbleibende Wirtskomponenten wirken sich oft nachteilig auf die Sensitivität eines Testsystems aus.Host components remaining in the recombinant antigen even after its purification often have a negative impact on the sensitivity of a test system.

Nicht zuletzt ist zum Betreiben biologischer Expressionsyssteme ein nicht unerheblicher sicherheitstechnischer, finanziell er und zeitlicher Aufwand erforderlich.Last but not least, operating a biological expression system is a not insignificant one Security, financial and time expenditure required.

Die Präparation nativer Antigene liefert zudem meist hinsichtlich Ausbeute und Zusammensetzung schwer reproduzierbare Chargen und ist fast immer mit einem hohen Reinigungsaufwand verbunden.The preparation of native antigens also mostly provides in terms of yield and Composition difficult to reproduce batches and is almost always with a high Cleaning effort connected.

Überraschenderweise zeigte sich, daß beim Einsatz vollsynthetischer Peptide im Enzymimmunoassay, welche die immundominanten Bereiche des CYP2D6 repräsentieren, die Sensitivität und Spezifität der LKM 1-Antikörpererkennung deutlich verbessert werden konnte.Surprisingly, it was found that when using fully synthetic peptides in Enzyme immunoassay representing the immunodominant regions of the CYP2D6 that Sensitivity and specificity of LKM 1 antibody detection could be significantly improved.

Die vollautomatisierte Peptidsynthese ermöglicht bekanntermaßen eine schnelle und kostengünstige Bereitstellung von Antigenen höchster Reinheit. The fully automated peptide synthesis is known to enable fast and Cost-effective supply of the highest purity antigens.  

Der Erfindung liegt ein Immunoassay zur Bestimmung von anti-LKM 1-Antikörpern aus Körperflüssigkeiten zugrunde, bei dem ein synthetisches Peptid aus 33 Aminosäuren: LDELLTEHRMTWDPAQPPRDLTEAFLAEMEKAK (Aminosäuren 375-408)
oder Teile davon, die das immundominante Epitop des CYP2D6 repräsentieren, an eine feste Phase, vorzugsweise eine Mikrotiterplatte aus Polystyren, adsorptiv oder kovalent, mit oder ohne Carriermolekül, gebunden ist. Gegebenenfalls wird die feste Phase vor der Beladung chemisch aktiviert.The invention is based on an immunoassay for the determination of anti-LKM 1 antibodies from body fluids, in which a synthetic peptide of 33 amino acids: LDELLTEHRMTWDPAQPPRDLTEAFLAEMEKAK (amino acids 375-408)
or parts thereof, which represent the immunodominant epitope of CYP2D6, are bound to a solid phase, preferably a microtiter plate made of polystyrene, adsorptively or covalently, with or without a carrier molecule. If necessary, the solid phase is activated chemically before loading.

Carrier im Sinne der Erfindung sind an sich bekannte hochmolekulare Verbindungen, wie z. B. Hamocyanin, Rinderserumalbumin oder polymere Peptide.Carriers in the sense of the invention are known high-molecular compounds, such as. B. Hamocyanin, bovine serum albumin or polymeric peptides.

Darüber hinaus kann die feste Phase eine unterschiedliche geometrische Form aufweisen (z. B. Mikrotiterplatte, Röhrchen, kugel- oder flächenförmig).In addition, the solid phase can have a different geometric shape (e.g. Microtiter plate, tube, spherical or flat).

Die zu bestimmenden Autoantikörper, die sich spezifisch an das immobilisierte Peptid binden, werden durch Inkubation von Körperflüssigkeiten und nachfolgend mit spezifischen Markerkonjugaten, die gegen einzelne Immunglobulinklassen oder gegen mehrere gerichtet sind, nachgewiesen, wobei als Marker vorzugsweise Enzyme oder Radioisotope verwendet werden.The autoantibodies to be determined that bind specifically to the immobilized peptide are made by incubating body fluids and subsequently with specific ones Marker conjugates that target one or more immunoglobulin classes, detected, preferably enzymes or radioisotopes being used as markers.

Das Verfahren ist dadurch gekennzeichnet, daß zwischen den Inkubationsschritten ein Waschprozeß erfolgt.The method is characterized in that between the incubation steps Washing process takes place.

Die anti-LKM 1-Antikörper werden optisch oder radiochemisch nachgewiesen, bevorzugt optisch mittels Farbreagenzien.The anti-LKM 1 antibodies are optically or radiochemically detected, preferred optically using color reagents.

Desweiteren betrifft die Erfindung einen Testkit zur Bestimmung von LKM 1-Antikörpern in physiologischen Flüssigkeiten, bevorzugt Serum, der umfaßt:
Eine peptid-beladene feste Phase, vzw. aus Polystyren,
Waschlösung,
Proben-Verdünnungspuffer,
Konjugat-Verdünnungspuffer,
einen markierten anti-Species-Immunglobulin-Antikörper,
ein markerspezifisches Nachweissystem, vorzugsweise ein Enzymsubstrat. Furthermore, the invention relates to a test kit for the determination of LKM 1 antibodies in physiological liquids, preferably serum, which comprises:
A peptide-loaded solid phase, vzw. made of polystyrene,
Washing solution,
Sample dilution buffer,
Conjugate dilution buffer,
a labeled anti-species immunoglobulin antibody,
a marker-specific detection system, preferably an enzyme substrate.

Die Testvalidierung des beschriebenen ELISAs unter Einsatz des 33-Aminosäuren-Peptides ergab, daß im Vergleich mit den rekombinanten Fusionsproteinen CYP2D6-β-Galactosidase, CYP2D6-Glutathion-S-Transferase bzw. CYP2D6-Histidyl eine verbesserte Sensivität und vor allem Spezifität zu erzielen ist.Test validation of the described ELISA using the 33-amino acid peptide showed that in comparison with the recombinant fusion proteins CYP2D6-β-galactosidase, CYP2D6-glutathione-S-transferase or CYP2D6-histidyl an improved sensitivity and before specificity can be achieved.

So ließen sich mit Hilfe des obigen Testes Seren von Patienten mit anderen autoimmunen Lebererkrankungen mit einer diagnostischen Spezifität von 100% klar von der Gruppe der Patienten mit chronisch aktiver Hepatitis (AI-CAH) Typ 2 abgrenzen.With the help of the above test, sera from patients with other people could be autoimmune Liver disease with a diagnostic specificity of 100% clearly from the group of Delimit patients with chronic active hepatitis (AI-CAH) type 2.

AusführungsbeispieleEmbodiments 1) Peptidsynthese1) Peptide synthesis

Das Peptid wurde mit Hilfe der simultanen multiplen Peptidsynthese (6) an einem Automaten PSSM-8 der Fa. Shimadzu, Japan, unter Verwendung der Fmoc/But-Strategie nach Sheppard (7) hergestellt. Die Kupplungen wurden an einem polymeren Träger Tentagel S Trityl Marz, (RAPP Polymere, Tübingen) Beladung: 0,20 mMol/g Harz durchgeführt.The peptide was synthesized using the simultaneous multiple peptide synthesis (6) PSSM-8 from Shimadzu, Japan, using the Fmoc / But strategy according to Sheppard (7) manufactured. The couplings were made on a polymeric support Tentagel S Trityl Marz, (RAPP Polymers, Tübingen) Loading: 0.20 mmol / g resin carried out.

Die Abspaltung aller Schutzgruppen wurde mit Trifluoressigsaure(TFA)/Wasser (95 : 5) 2 h, Raumtemperatur unter Zusatz von 3% Triisopropylsilan bzw. TFA/Thioanisol/Thiokresol (95 : 2,5 : 2,5) in 3 h bei Raumtemperatur unter Zusatz von 3% Triisopropylsilan, danach mit Zusatz von 10% Trimethylchlorsilan (1 h) durchgeführt. Präparative HPLC: Anlage LC-8A mit UV-Vis-Detektor SPD-6A, Trennsäule: Vydac 218 TP 101522 (10-15 µm, 250×22 mm), Laufmittel: A = 0,05% TFA in Wasser, B = 0,05% TFA in 80% Acetonitril/Wasser; Fluß 10,0-15,0 ml/min, isokratisch oder mit einem flachen Gradienten.All protective groups were cleaved off with trifluoroacetic acid (TFA) / water (95: 5) for 2 h, Room temperature with the addition of 3% triisopropylsilane or TFA / thioanisole / thiocresol (95: 2.5: 2.5) in 3 h at room temperature with the addition of 3% triisopropylsilane, then with Addition of 10% trimethylchlorosilane (1 h) was carried out. Preparative HPLC: System LC-8A with UV-Vis detector SPD-6A, separation column: Vydac 218 TP 101522 (10-15 µm, 250 × 22 mm), Eluent: A = 0.05% TFA in water, B = 0.05% TFA in 80% acetonitrile / water; Flow 10.0-15.0 ml / min, isocratic or with a flat gradient.

Die Analyse erfolgte mit Hilfe eines Flugzeitmassenspektrometers (MALDI-TOF) MALDI I der Fa. Shimadzu.The analysis was carried out using a time-of-flight mass spectrometer (MALDI-TOF) MALDI I Shimadzu.

2) Enzymimmunoassay2) Enzyme Immunoassay

Beladung: Das Peptid wird mit 0,5 µg/ml in 0,1 M Carbonatpuffer pH = 9,5 mit 100 µl/well bei 4°C über Nacht auf eine Polystyren-Mikrotiterplatte (100 µl/well) beladen, anschließend wird mit Waschpuffer (PBS, 0,1% Tween 20, 0,01% Thiomersal) einmal mit 250 µl/well gewaschen, dann mit 150 µl/well für 2 h bei Raumtemperatur (RT) blockiert (1% Rinderserumalbumin, 0,02% Natriumazid in PBS) und schließlich dreimal wie oben gewaschen. Die feste Phase wird 3-16 h getrocknet, und die Mikroteststreifen in Aluminiumfolie eingeschweißt.Loading: The peptide is mixed with 0.5 µg / ml in 0.1 M carbonate buffer pH = 9.5 with 100 µl / well Load 4 ° C overnight on a polystyrene microtiter plate (100 µl / well), then with Wash buffer (PBS, 0.1% Tween 20, 0.01% thiomersal) washed once with 250 µl / well, then blocked with 150 µl / well for 2 h at room temperature (RT) (1% bovine serum albumin, 0.02% Sodium azide in PBS) and finally washed three times as above. The solid phase is 3-16 h  dried, and the micro test strips sealed in aluminum foil.

Durchführung: 100 µl Serumverdünnung (in 1% RSA, 0,3 M NaCl, 0,1% Tween 20, 0,02% Natriumazid in 0,01 M Phosphatpuffer) werden 1 h bei RT inkubiert, danach folgen drei Waschschritte mit Waschpuffer (je 250 µl/well). Zum Nachweis der gebundenen Antikörper erfolgt eine Inkubation mit einem anti-human-Immunglobulin G-Peroxidase-Konjugat für 30 min bei RT (100 µl/well), worauf sieh abermals drei Waschschritte (s. o.) anschließen. Die Visualisierung des Testes erfolgt durch eine gebrauchsfertige Substratlösung (3,3',5,5'- Tetramethylbenzidin), die 10 min. bei RT inkubiert wird (100 µl/well). Durch Zugabe von 100 µl Stoplösung (1 N Schwefelsäure) wird die Reaktion beendet, worauf die Absorption bei 450 nm gemessen wird. Die Auswertung erfolgt üblicherweise anhand eines mitgeführten Standardserums.Procedure: 100 µl serum dilution (in 1% RSA, 0.3 M NaCl, 0.1% Tween 20, 0.02% Sodium azide in 0.01 M phosphate buffer) are incubated for 1 h at RT, followed by three Wash steps with wash buffer (250 µl / well each). For the detection of bound antibodies incubation is carried out with an anti-human immunoglobulin G-peroxidase conjugate for 30 min at RT (100 µl / well), whereupon again follow three washing steps (see above). The The test is visualized using a ready-to-use substrate solution (3.3 ', 5.5'- Tetramethylbenzidine), the 10 min. is incubated at RT (100 ul / well). By adding 100 µl Stop solution (1 N sulfuric acid) the reaction is terminated, followed by absorption at 450 nm is measured. The evaluation is usually carried out using a carried one Standard serums.

Literaturliterature

  • (1) Manns, M., Meyer zum Büschenfelde, K.H.: Autoimmune Erkrankungen der Leber in: Peter, H.H., Pichler, W.J. (Hrsg.), Klinische Immunologie. München, Wien, Baltimore: Urban und Schwarzenberg, 1996: 517-531(1) Manns, M., Meyer zum Büschenfelde, K.H .: Autoimmune diseases of the liver in: Peter, H.H., Pichler, W.J. (Ed.), Clinical Immunology. Munich, Vienna, Baltimore: Urban and Schwarzenberg, 1996: 517-531
  • (2) Kiffel, L., Loeper, J., Flinois, J.P. et al.: Does the anti-liver-kidney microsome antibody (anti-LKM 1) recognize an isozyme of hepatic cytochrome P-450? Abstract P. 1/17, 10th European Drug Metabolism Workshop, Guilford, UK, July 6th to 7th in 1986(2) Kiffel, L., Loeper, J., Flinois, J.P. et al .: Does the anti-liver-kidney microsome antibody (anti-LKM 1) recognize an isozyme of hepatic cytochrome P-450? Abstract P. 1/17, 10th European Drug Metabolism Workshop, Guilford, UK, July 6th to 7th in 1986
  • (3) Beaune, P., Dansette, P.M., Mansuy, D., Kiffel, L.,Finck, M. Amar, C., Leroux, Momberg, J.C.: Muman anti-endoplasmic reticulum autoantibodies appearing in a (frug­ induced hepatitis are directed against a human liver cytochrome P-450 that hydroxylates the drug. Proc. Natl. Acad. Sci. USA 84 (1987) 551-555(3) Beaune, P., Dansette, P.M., Mansuy, D., Kiffel, L., Finck, M. Amar, C., Leroux, Momberg, J.C .: Muman anti-endoplasmic reticulum autoantibodies appearing in a (frug induced hepatitis are directed against a human liver cytochrome P-450 that hydroxylates the drug. Proc. Natl. Acad. Sci. USA 84: 551-555 (1987)
  • (4) Manns, P.M., Griffln, K.J., Sullivan, K.F., Johnson E.F.: LKM-1 Autoantibodies Recognize a Short linear Sequence in P4502D6, a Cytochrome P-450 Mono-oxygenase. J.Clin.Invest. 88 (1991) 1370-1378(4) Manns, P.M., Griffln, K.J., Sullivan, K.F., Johnson E.F .: LKM-1 Autoantibodies Recognize a short linear sequence in P4502D6, a cytochrome P-450 mono-oxygenase. J.Clin.Invest. 88: 1370-1378 (1991)
  • (5) Manns, M.P.: Liver/Kidney Microsomal Autoantibodies in. Peter, J.B., Shoenfeld, Y. (Hrsg.) Autoantibodies. Amsterdam, Lausanne, New York, Oxford, Shannon, Tokyo: Elsevier, 1996: 462-466.(5) Manns, M.P .: Liver / Kidney Microsomal Autoantibodies in. Peter, J.B., Shoenfeld, Y. (Ed.) Autoantibodies. Amsterdam, Lausanne, New York, Oxford, Shannon, Tokyo: Elsevier, 1996: 462-466.
  • (6) G. Schnorrenberg, H. Gerhardt, Tetrahedron, 45, 7759 (1989)(6) G. Schnorrenberg, H. Gerhardt, Tetrahedron, 45, 7759 (1989)
  • (7) E. Atherton und R. C. Sheppard, "Solid phase peptide synthesis - a practical approach" IRL Press, Oxford, 1989.(7) E. Atherton and R. C. Sheppard, "Solid phase peptide synthesis - a practical approach" IRL Press, Oxford, 1989.

Claims (14)

1. Peptide des Cytochroms P450 2D6, bestehend aus 30-40, vorzugsweise 33, Aminosäuren, die ein Konformationsepitop bilden, wie sie bei der autoimmunen chronischen Hepatitis Typ 2 vorkommen.1. Peptides of the cytochrome P450 2D6, consisting of 30-40, preferably 33, amino acids form a conformation epitope, as is the case with autoimmune chronic hepatitis type 2 occurrence. 2. Peptide gemäß Anspruch 1, dadurch gekennzeichnet, daß sie entweder ganz oder teilweise oder als Variante des folgenden Peptids aufgebaut sind
LDELLTEHRMTWDPAQPPRDLTEAFLAEMEKAK.2. Peptides according to claim 1, characterized in that they are constructed either entirely or partially or as a variant of the following peptide
LDELLTEHRMTWDPAQPPRDLTEAFLAEMEKAK. 3. Verfahren zur Bestimmung von anti-LKM 1-Antikörpern, gekennzeichnet dadurch, daß ein immundominantes Peptid des Cytochroms P450 2D6 oder eine Verbindung dieses Peptids mit einem Carriermolekül adsorptiv oder kovalent an eine feste Phase gebunden ist und nachfolgend zur spezifischen Bindung und zum Nachweis der anti-LKM 1-Antikörper im Immunoassay eingesetzt wird.3. A method for the determination of anti-LKM 1 antibodies, characterized in that a immunodominant peptide of the cytochrome P450 2D6 or a compound of this peptide with a carrier molecule is adsorptively or covalently bound to a solid phase and subsequently for specific binding and for the detection of anti-LKM 1 antibodies in the immunoassay is used. 4. Verfahren zur Bestimmung von anti-LKM 1-Antikörpern nach Anspruch 3, gekennzeichnet dadurch, daß als Antigen das folgende Peptid, ganz oder teilweise oder als Variante eingesetzt wird
LDELLTEHRMTWDPAQPPRDLTEAFLAEMEKAK.4. A method for the determination of anti-LKM 1 antibodies according to claim 3, characterized in that the following peptide, whole or in part or as a variant, is used as the antigen
LDELLTEHRMTWDPAQPPRDLTEAFLAEMEKAK. 5. Verfahren zur Bestimmung von anti-LKM 1-Antikörpern nach Anspruch 3 und 4, gekennzeichnet dadurch, daß als Carrier hochmolekulare Verbindungen eingesetzt werden.5. A method for the determination of anti-LKM 1 antibodies according to claim 3 and 4, characterized in that high-molecular compounds are used as carriers. 6. Verfahren zur Bestimmung von anti-LKM 1-Antikörpern nach Anspruch 3-5, gekennzeichnet dadurch, daß die Bindung des Antigens adsorptiv oder kovalent oder nach vorheriger chemischer Aktivierung der festen Phase erfolgt.6. A method for the determination of anti-LKM 1 antibodies according to claims 3-5, characterized in that the binding of the antigen is adsorptive or covalent or after previous chemical The solid phase is activated. 7. Verfahren zur Bestimmung von anti-LKM 1 -Antikörpern nach Anspruch 3-6, gekennzeichnet dadurch, daß die feste Phase aus Polystyren besteht.7. The method for determining anti-LKM 1 antibodies according to claims 3-6, characterized in that the solid phase consists of polystyrene. 8. Verfahren zur Bestimmung von anti-LKM 1-Antikörpern nach Anspruch 3-7, gekennzeichnet dadurch, daß die feste Phase eine unterschiedliche Form hat.8. A method for the determination of anti-LKM 1 antibodies according to claim 3-7, characterized  in that the solid phase has a different shape. 9. Verfahren zur Bestimmung von anti-LKM 1-Antikörpern nach Anspruch 3-8, gekennzeichnet dadurch, daß die als feste Phase dienenden Träger in Form einer Mikrotiterplatte oder eines Röhrchens vorliegen oder eine kugelförmige oder flächenförmige Gestalt haben.9. A method for the determination of anti-LKM 1 antibodies according to claim 3-8, characterized in that the serving as a solid phase in the form of a microtiter plate or Tubes are present or have a spherical or sheet-like shape. 10. Verfahren zur Bestimmung von anti-LKM 1-Antikörpern nach Anspruch 3-9, gekennzeichnet dadurch, daß die anti-LKM 1-Antikörper spezifisch an das immobilisierte Peptid- Antigen gebunden und im Immunoassay bestimmt werden.10. A method for the determination of anti-LKM 1 antibodies according to claims 3-9, characterized in that the anti-LKM 1 antibodies are specific to the immobilized peptide Antigen bound and determined in the immunoassay. 11. Verfahren zur Bestimmung von anti-LKM 1-Antikörpern nach Anspruch 3-10, gekennzeichnet dadurch, daß die Bindung der anti-LKM 1 -Antikörper in geeigneten Puffern, die nichtionische und ionische Detergenzien und Proteine enthalten, erfolgt.11. A method for the determination of anti-LKM 1 antibodies according to claims 3-10, characterized in that the binding of the anti-LKM 1 antibodies in suitable buffers, the contain non-ionic and ionic detergents and proteins. 12. Verfahren zur Bestimmung von anti-LKM 1-Antikörpern nach Anspruch 3-11, gekennzeichnet dadurch, daß die gebundenen anti-LKM 1-Antikörper durch spezifische Marker- Konjugate, die gegen einzelne Immunglobulinklassen oder gegen mehrere gerichtet sind, nachgewiesen werden.12. A method for the determination of anti-LKM 1 antibodies according to claim 3-11, characterized in that the bound anti-LKM 1 antibodies by specific marker Conjugates that target one or more immunoglobulin classes, be detected. 13. Verfahren zur Bestimmung von anti-LKM 1-Antikörpern nach Anspruch 3-12, gekennzeichnet dadurch, daß als Marker Enzyme oder Radioisotope eingesetzt werden.13. A method for the determination of anti-LKM 1 antibodies according to claims 3-12, characterized in that enzymes or radioisotopes are used as markers. 14. Testkit zur Bestimmung von LKM 1-Antikörpern in physiologischen Flüssigkeiten, bevorzugt Serum, der umfaßt
eine peptid-beladene feste Phase, vzw. aus Polystyren, Waschlösung,
Proben-Verdünnungspuffer,
Konjugat-Verdünnungspuffer,
einen markierten anti-Species-Immunglobulin-Antikörper,
ein markerspezifisches Nachweissystem, vorzugsweise ein Enzymsubstrat.14. Test kit for the determination of LKM 1 antibodies in physiological liquids, preferably serum, which comprises
a peptide-loaded solid phase, vzw. from polystyrene, washing solution,
Sample dilution buffer,
Conjugate dilution buffer,
a labeled anti-species immunoglobulin antibody,
a marker-specific detection system, preferably an enzyme substrate.
DE19930933A 1998-07-10 1999-07-06 Method for the determination of anti-LKM 1 antibodies Expired - Fee Related DE19930933B4 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
DE19930933A DE19930933B4 (en) 1998-07-10 1999-07-06 Method for the determination of anti-LKM 1 antibodies

Applications Claiming Priority (3)

Application Number Priority Date Filing Date Title
DE19832642.4 1998-07-10
DE19832642 1998-07-10
DE19930933A DE19930933B4 (en) 1998-07-10 1999-07-06 Method for the determination of anti-LKM 1 antibodies

Publications (2)

Publication Number Publication Date
DE19930933A1 true DE19930933A1 (en) 2000-01-13
DE19930933B4 DE19930933B4 (en) 2005-05-25

Family

ID=7874722

Family Applications (1)

Application Number Title Priority Date Filing Date
DE19930933A Expired - Fee Related DE19930933B4 (en) 1998-07-10 1999-07-06 Method for the determination of anti-LKM 1 antibodies

Country Status (1)

Country Link
DE (1) DE19930933B4 (en)

Family Cites Families (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
FR2677653A1 (en) * 1991-06-17 1992-12-18 Inst Nat Sante Rech Med PEPTIDE FRAGMENTS FROM HUMAN CYTOCHROME P450 IID6, PEPTIDE ANTI-FRAGMENT ANTIBODIES AND THEIR APPLICATIONS IN THE DIAGNOSIS OF AUTOIMMUNE HEPATITIS.

Also Published As

Publication number Publication date
DE19930933B4 (en) 2005-05-25

Similar Documents

Publication Publication Date Title
JP2624973B2 (en) Synthetic polypeptides and antibodies related to Epstein-Barr virus early antigen (diffusion)
JP2858534B2 (en) Monoclonal antibodies to denatured proteins
JP4229704B2 (en) Fc region polypeptide binding molecule
US7445788B2 (en) Compositions and methods for detection of Ehrlichia canis and Ehrlichia chaffeensis antibodies
DE19649390A1 (en) Antigen-specific IgG detection
JP2592121B2 (en) Methods and kits for the diagnosis of IgA kidney disease
EP1328811B1 (en) Hcv mosaic antigen composition
US5741654A (en) Immunoassay for the detection of human autoantibodies
DE4240056A1 (en) Streptolysin O peptide antigens and method for the determination of streptolysin antibodies
CA1341014C (en) Hcg peptides for use in antibody purification procedures
US20140106381A1 (en) Method for the diagnosis of rheumatoid arthritis
DE19930933B4 (en) Method for the determination of anti-LKM 1 antibodies
Anderson et al. Polymer modification of antibody to eliminate immune complex and Fc binding
KR20160075964A (en) Diagnosis Method for Classical Swine Fever(CSF) using E2 proteins of CSF-Virus and its Specific Monoclonal Antibodies, and Diagnostic Kit using the method
CN114895023A (en) Application of reagent for detecting anti-Talin-1-IgG autoantibody in preparation of kit for detecting vascular endothelial injury
CN114720700A (en) Application of reagent for detecting anti-cytoskeleton-associated protein4-IgG autoantibody in preparation of kit for detecting vascular endothelial injury
JP2837669B2 (en) T-cell lymphotropic virus protein and its analysis
CN108948173B (en) Citrulline modified peptide and application thereof
JP3149116B2 (en) Epitope-related peptide of human parvovirus
CN110317254A (en) People MBP epitope peptide, antigen, antibody, application and chemical luminescence reagent kit
DE10002892A1 (en) New immunodominant peptides from actin, useful for diagnosis and treatment of type I autoimmune hepatitis
JP3709078B2 (en) Method and kit for measuring diacetylpolyamine
US5246851A (en) Monoclonal antibody specific for a 14kd protein obtained from n gonorroeae
CN114910643B (en) Method and reagent for identifying antibody combined with mutant antigen
JPH06293798A (en) Epitope-related peptide of human parvovirus b19

Legal Events

Date Code Title Description
8110 Request for examination paragraph 44
8364 No opposition during term of opposition
8327 Change in the person/name/address of the patent owner

Owner name: HUMAN GESELLSCHAFT FUER BIOCHEMICA UND DIAGNOS, DE

R119 Application deemed withdrawn, or ip right lapsed, due to non-payment of renewal fee

Effective date: 20140201