DE19930933B4 - Method for the determination of anti-LKM 1 antibodies - Google Patents

Method for the determination of anti-LKM 1 antibodies Download PDF

Info

Publication number
DE19930933B4
DE19930933B4 DE19930933A DE19930933A DE19930933B4 DE 19930933 B4 DE19930933 B4 DE 19930933B4 DE 19930933 A DE19930933 A DE 19930933A DE 19930933 A DE19930933 A DE 19930933A DE 19930933 B4 DE19930933 B4 DE 19930933B4
Authority
DE
Germany
Prior art keywords
lkm
antibodies
determination
peptide
solid phase
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Expired - Fee Related
Application number
DE19930933A
Other languages
German (de)
Other versions
DE19930933A1 (en
Inventor
Werner Dr.rer.nat.habil. Schößler
Christian Dr. Hentschel
Falk Prof. Dr. Hiepe
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Human Gesellschaft fur Biochemica und Diagnos De
Original Assignee
Imtec Immundiagnostika GmbH
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Imtec Immundiagnostika GmbH filed Critical Imtec Immundiagnostika GmbH
Priority to DE19930933A priority Critical patent/DE19930933B4/en
Publication of DE19930933A1 publication Critical patent/DE19930933A1/en
Application granted granted Critical
Publication of DE19930933B4 publication Critical patent/DE19930933B4/en
Anticipated expiration legal-status Critical
Expired - Fee Related legal-status Critical Current

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/0004—Oxidoreductases (1.)
    • C12N9/0071—Oxidoreductases (1.) acting on paired donors with incorporation of molecular oxygen (1.14)
    • C12N9/0077—Oxidoreductases (1.) acting on paired donors with incorporation of molecular oxygen (1.14) with a reduced iron-sulfur protein as one donor (1.14.15)
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/564—Immunoassay; Biospecific binding assay; Materials therefor for pre-existing immune complex or autoimmune disease, i.e. systemic lupus erythematosus, rheumatoid arthritis, multiple sclerosis, rheumatoid factors or complement components C1-C9
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/795—Porphyrin- or corrin-ring-containing peptides
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/795—Porphyrin- or corrin-ring-containing peptides
    • G01N2333/80—Cytochromes
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/90—Enzymes; Proenzymes
    • G01N2333/902—Oxidoreductases (1.)
    • G01N2333/90245—Oxidoreductases (1.) acting on paired donors with incorporation of molecular oxygen (1.14)

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Immunology (AREA)
  • Molecular Biology (AREA)
  • Hematology (AREA)
  • Biomedical Technology (AREA)
  • Biotechnology (AREA)
  • Genetics & Genomics (AREA)
  • Microbiology (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)
  • Biochemistry (AREA)
  • Urology & Nephrology (AREA)
  • General Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Medicinal Chemistry (AREA)
  • General Engineering & Computer Science (AREA)
  • Rheumatology (AREA)
  • Cell Biology (AREA)
  • Rehabilitation Therapy (AREA)
  • Food Science & Technology (AREA)
  • Physics & Mathematics (AREA)
  • Analytical Chemistry (AREA)
  • General Physics & Mathematics (AREA)
  • Pathology (AREA)
  • Peptides Or Proteins (AREA)

Abstract

Peptid des Cytochroms P450 2D6, dadurch gekennzeichnet, dass es folgende Aminosäuresequenz aufweist:
LDELLTEHRMTWDPAQPPRDLTEAFLAEMBKAK. (I)Peptide of the cytochrome P450 2D6, characterized in that it has the following amino acid sequence:
LDELLTEHRMTWDPAQPPRDLTEAFLAEMBKAK. (I)

Description

Die Erfindung betrifft ein Verfahren zur Bestimmung von anti-LKM 1-Antikörpern. Anwendungsgebiete der Erfindung sind die Medizin und die pharmazeutische Industrie.The The invention relates to a method for the determination of anti-LKM 1 antibodies. application areas The invention relates to medicine and the pharmaceutical industry.

Zu den autoimmunen Lebererkrankungen zählt man vor allem die autoimmunen Verlaufsformen der chronisch aktiven Hepatitis (AI-CAH) Typ 1-3 sowie die primäre biliäre Zirrhose (PBC) und die Immuncholangopathie, die als Überlappungssyndrom zwischen AI-CAH und PBC anzusehen ist.To autoimmune liver diseases include autoimmune ones Forms of chronic active hepatitis (AI-CAH) type 1-3 as well as the primary biliary Cirrhosis (PBC) and immunolangiopathy, called overlap syndrome between AI-CAH and PBC.

Die Autoimmunhepatitiden, die strikt von virus-induzierten Verlaufsformen unterschieden werden müssen, sind relativ seltene Erkrankungen. Durch eine verbesserte serologische Diagnostik werden sie jedoch immer häufiger erkannt. Durch den Verlust der Selbsttoleranz kommt es zu Autoimmunreaktionen, die sich hauptsächlich gegen die Hepatozyten richten. Ob den dabei auftretenden Autoantikörpern pathogenetische Relevanz zukommt oder ob die Leberzelldestruktion allein durch T-Zellen vermittelt wird, ist noch nicht endgültig geklärt (1).The Autoimmune hepatitides, which are strictly of virus-induced courses have to be differentiated are relatively rare diseases. By an improved serological However, they are increasingly being diagnosed. By the loss Self-tolerance leads to autoimmune reactions that are mainly against to direct the hepatocytes. Whether the autoantibodies occurring pathogenetic Relevance or whether the liver cell destruction by T cells alone is not yet finally settled (1).

Der 2. Verlaufsform der autoimmunen chronisch aktiven Hepatitis wurde in der Vergangenheit aufgrund ihrer besonderen klinischen Bedeutung – 82% der Erkrankten entwickeln eine Leberzirrhose – gesonderte Beachtung geschenkt. Sie betrifft vorzugsweise Mädchen und junge Frauen und zeichnet sich häufig durch einen fulminanten Beginn und eine hohe Entzündungsaktivität aus. Serologisch ist diese Erkrankung durch eine Hypergammaglobulinämie und vor allem durch Autoantikörper gegen Leber- und Nieren-Mikrosomen charakterisiert. Als Targetantigen dieser als LKM 1 (liver-kidney-microsomes) bezeichneten Autoantikörper wurde das Cytochrom P450 2D6 (CYP2D6), ein Enzym der P450 Familie, identifiziert (2 – 4).Of the 2. Course of autoimmune chronic active hepatitis was in the past because of their special clinical significance - 82% of Patients develop liver cirrhosis - paid special attention. It concerns preferably girls and young women and is often characterized by a fulminant Onset and high inflammatory activity. serological This disease is due to a hypergammaglobulinemia and especially by autoantibodies characterized by liver and kidney microsomes. As target antigen this was called LKM 1 (liver kidney microsomes) autoantibody identified the cytochrome P450 2D6 (CYP2D6), an enzyme of the P450 family (2 - 4).

Die anti-LKM 1-Antikörper gelten als Marker der autoimmunen Hepatitis Typ 2. Sie können jedoch auch in ca. 7% der Patienten mit einer chronischen Hepatitis C und sehr selten bei einer Halothan induzierten Hepatitis beobachtet werden.The anti-LKM 1 antibody However, they can be considered as markers of autoimmune hepatitis type 2 in about 7% of patients with chronic hepatitis C and very rarely seen in halothane-induced hepatitis.

Es konnte gezeigt werden, dass die immundominante Region des Proteins ein Abschnitt von 33 Aminosäuren ist. Für die idiopathische autoimmune Hepatitis Typ 2 gilt, dass die meisten LKM 1 positiven Seren lineare Epitope erkennen, die sich in dieser Region befinden (5).It could be shown to be the immunodominant region of the protein a section of 33 amino acids is. For idiopathic autoimmune type 2 hepatitis applies to most LKM 1 positive sera recognize linear epitopes that are in this region located (5).

Nach dem Stand der Technik wurden anti-LKM 1-Autoantikörper bisher nur mit immunologischen Nachweisverfahren, wie z.B. Enzymimmunoassay (EIA), Immunoblot und Immunfluoreszenztest (IFT), bei denen entweder native mikrosomale Antigenpräparationen oder rekombinante Antigene, bestehend aus dem full lenght-CYP2D6 oder immundominanten Sequenzen von CYP2D6, fusioniert mit diversen Proteinen (Glutathion-S-Transferase, β-Galactosidase, His-tag), als Antigene an eine feste Phase immobilisiert wurden. Die rekombinanten Targetantigene wurden üblicherweise in pro- und eukariontischen Wirtszellen exprimiert.To The prior art has been anti-LKM 1 autoantibodies so far only with immunological detection methods, e.g. Enzyme Immunoassay (EIA), Immunoblot and Immunofluorescence Test (IFT), in which either native microsomal antigen preparations or recombinant antigens consisting of the full-length CYP2D6 or immunodominant sequences of CYP2D6 fused to diverse Proteins (glutathione-S-transferase, β-galactosidase, His-tag), as antigens were immobilized on a solid phase. The recombinant target antigens were customary expressed in pro- and eukaryotic host cells.

Mit Hilfe dieser biologischen Expressionssysteme ist es jedoch nur sehr schwer möglich, kleine Peptide ohne Fusionspartner, der oft auch zur Aufreinigung des rekombinanten Antigens notwendig ist, zu exprimieren. Gerade diese Fusionsproteine maskieren aber häufig aufgrund ihrer Größe und Konformation die für die Antikörpererkennung notwendigen Epitope der immundominanten Struktur, so dass eine ausreichende Sensitivität des rekombinanten Antigens oft nicht gegeben ist.With However, help from these biological expression systems is very limited hardly possible, small peptides without fusion partners, often also for purification of the recombinant antigen is necessary to express. Just however, these fusion proteins often mask because of their size and conformation the for the antibody recognition necessary epitopes of the immunodominant structure, so that sufficient sensitivity Of the recombinant antigen is often not given.

Andererseits wird nicht selten durch die antigene Struktur das Fusionsprotein sterisch abgeschirmt, was die ohnehin relativ aufwendige Präparation des Antigens aus seiner biologischen Matrix (Wirtszelle) erschwert oder gänzlich verhindert.on the other hand is often due to the antigenic structure of the fusion protein sterically shielded, which is the already relatively expensive preparation of the antigen from its biological matrix (host cell) or completely prevented.

Im rekombinanten Antigen auch nach dessen Aufreinigung verbleibende Wirtskomponenten wirken sich oft nachteilig auf die Sensitivität eines Testsystems aus.in the recombinant antigen even after its purification remaining Host components often adversely affect the sensitivity of a test system out.

Nicht zuletzt ist zum Betreiben biologischer Expressionsysteme ein nicht unerheblicher sicherheitstechnischer, finanzieller und zeitlicher Aufwand erforderlich.Not last is not to operate biological expression systems one insignificant safety, financial and temporal Effort required.

Die Präparation nativer Antigene liefert zudem meist hinsichtlich Ausbeute und Zusammensetzung schwer reproduzierbare Chargen und ist fast immer mit einem hohen Reinigungsaufwand verbunden.The preparation native antigens also provides mostly in terms of yield and composition hard reproducible batches and is almost always high Cleaning effort connected.

Überraschenderweise zeigte sich, dass beim Einsatz vollsynthetischer Peptide im Enzymimmunoassay, welche die immundominanten Bereiche des CYP2D6 repräsentieren, die Sensitivität und Spezifität der LKM 1-Antikörpererkennung deutlich verbessert werden konnte.Surprisingly showed that the use of fully synthetic peptides in the enzyme immunoassay, which represent the immunodominant regions of CYP2D6, the sensitivity and specificity the LKM 1 antibody detection could be significantly improved.

Die vollautomatisierte Peptidsynthese ermöglicht bekanntermaßen eine schnelle und kostengünstige Bereitstellung von Antigenen höchster Reinheit.The Fully automated peptide synthesis is known to allow one fast and inexpensive Provision of antigens highest Purity.

Der Erfindung liegt ein Immunoassay zur Bestimmung von anti-LKM 1-Antikörpern aus Körperflüssigkeiten zugrunde, bei dem ein synthetisches Peptid aus 33 Aminosäuren:
LDELLTEHRMTWDPAQPPRDLTEAFLAEMEKAK (Aminosäuren 375 – 408),
die das immundominante Epitop des CYP2D6 repräsentieren, an eine feste Phase, vorzugsweise eine Mikrotiterplatte aus Polystyren, adsorptiv oder kovalent, mit oder ohne Carriermolekül, gebunden ist. Gegebenenfalls wird die feste Phase vor der Beladung chemisch aktiviert.The invention is an immunoassay for the determination of anti-LKM 1 antibodies from the body based on a synthetic peptide of 33 amino acids:
LDELLTEHRMTWDPAQPPRDLTEAFLAEMEKAK (amino acids 375-408),
which represent the immunodominant epitope of CYP2D6, to a solid phase, preferably a microtiter plate of polystyrene, adsorptive or covalent, with or without carrier molecule bound. Optionally, the solid phase is chemically activated prior to loading.

Carrier im Sinne der Erfindung sind an sich bekannte hochmolekulare Verbindungen, wie z. B. Hämocyanin, Rinderserumalbumin oder polymere Peptide.Carrier in the context of the invention are known high molecular compounds, such as B. hemocyanin, Bovine serum albumin or polymeric peptides.

Darüber hinaus kann die feste Phase eine unterschiedliche geometrische Form aufweisen (z.B. Mikrotiterplatte, Röhrchen, kugel- oder flächenförmig).Furthermore For example, the solid phase may have a different geometric shape (e.g., microtiter plate, tube, spherical or planar).

Die zu bestimmenden Autoantikörper, die sich spezifisch an das immobilisierte Peptid binden, werden durch Inkubation von Körperflüssigkeiten und nachfolgend mit spezifischen Markerkonjugaten, die gegen einzelne Immunglobulinklassen oder gegen mehrere gerichtet sind, nachgewiesen, wobei als Marker vorzugsweise Enzyme oder Radioisotope verwendet werden.The to be determined autoantibodies, which bind specifically to the immobilized peptide by incubation of body fluids and subsequently with specific marker conjugates directed against individual Immunoglobulin classes or directed against several, preferably using enzymes or radioisotopes as markers become.

Das Verfahren ist dadurch gekennzeichnet, dass zwischen den Inkubationsschritten ein Waschprozess erfolgt.The Method is characterized in that between the incubation steps a washing process takes place.

Die anti-LKM 1-Antikörper werden optisch oder radiochemisch nachgewiesen, bevorzugt optisch mittels Farbreagenzien.The anti-LKM 1 antibody are detected optically or radiochemically, preferably optically by means of color reagents.

Desweiteren betrifft die Erfindung einen Testkit zur Bestimmung von LKM 1-Antikörpern in physiologischen Flüssigkeiten, bevorzugt Serum, der umfasst:
Eine peptid-beladene feste Phase, vzw. aus Polystyren,
Waschlösung,
Proben-Verdünnungspuffer,
Konjugat-Verdünnungspuffer,
einen markierten anti-Species-Immunglobulin-Antikörper,
ein markerspezifisches Nachweissystem, vorzugsweise ein Enzymsubstrat Furthermore, the invention relates to a test kit for the determination of LKM 1 antibodies in physiological fluids, preferably serum, which comprises:
A peptide-loaded solid phase, vzw. made of polystyrene,
Wash solution,
Sample dilution buffer,
Conjugate dilution buffer
a labeled anti-species immunoglobulin antibody,
a marker-specific detection system, preferably an enzyme substrate

Die Testvalidierung des beschriebenen ELISAs unter Einsatz des 33-Aminosäuren-Peptides ergab, dass im Vergleich mit den rekombinanten Fusionsproteinen CYP2D6-β-Galactosidase, CYP2D6-Glutathion-S-Transferase bzw. CYP2D6-Histidyl eine verbesserte Sensivität und vor allein Spezifität zu erzielen ist.The Test validation of the ELISA described using the 33-amino acid peptide revealed that compared with the recombinant fusion proteins CYP2D6-β-galactosidase, CYP2D6-glutathione-S-transferase or CYP2D6-histidyl for improved sensitivity and specificity alone is.

So ließen sich mit Hilfe des obigen Testes Seren von Patienten mit anderen autoimmunen Lebererkrankungen mit einer diagnostischen Spezifität von 100 % klar von der Gruppe der Patienten mit chronisch aktiver Hepatitis (AI-CAH) Typ 2 abgrenzen.So could using the above test sera from patients with others autoimmune liver disease with a diagnostic specificity of 100 % clear from the group of patients with chronic active hepatitis (AI-CAH) delimit type 2.

Ausführungsbeispieleembodiments

Im Folgenden steht M für mol/l.in the M stands for minor.

1) Peptidsynthese1) Peptide synthesis

Das Peptid wurde mit Hilfe der simultanen multiplen Peptidsynthese (6) an einem Automaten PSSM-8 der Fa. Shimadzu, Japan, unter Verwendung der Fmoc/But-Strategie nach Sheppard (7) hergestellt. Die Kupplungen wurden an einem polymeren Träger Tentagel S Trityl Harz, (RAPP Polymere, Tübingen) Beladung: 0,20 mMol/g Harz durchgeführt.The Peptide was synthesized by simultaneous multiple peptide synthesis (6) on a machine PSSM-8 Fa. Shimadzu, Japan, using of the Fmoc / But strategy according to Sheppard (7). The couplings were on a polymeric carrier Tentagel S Trityl resin, (RAPP polymers, Tübingen) loading: 0.20 mmol / g Resin performed.

Die Abspaltung aller Schutzgruppen wurde mit Trifluoressigsäure(TFA)/Wasser (95:5) 2h, Raumtemperatur unter Zusatz von 3% Triisopropylsilan bzw. TFA/Thioanisol/Thiokresol (95:2,5:2,5) in 3h bei Raumtemperatur unter Zusatz von 3% Triisopropylsilan, danach mit Zusatz von 10% Trimethylchlorsilan (1h) durchgeführt. Präparative HPLC: Anlage LC-8A mit UV-Vis-Detektor SPD-6A, Trennsäule: Vydac 218 TP 101522 (10 – 15 μm, 250 × 22 mm), Laufmittel: A = 0,05% TFA in Wasser, B = 0,05% TFA in 80% Acetonitril/Wasser; Fluß: 10,0 –15,0 ml/min, isokratisch oder mit einem flachen Gradienten.The Cleavage of all protecting groups was with trifluoroacetic acid (TFA) / water (95: 5) 2h, room temperature with the addition of 3% triisopropylsilane or TFA / thioanisole / thiocresol (95: 2.5: 2.5) in 3 h at room temperature with the addition of 3% triisopropylsilane, then with the addition of 10% Trimethylchlorosilane (1h) performed. Preparative HPLC: System LC-8A with UV-Vis detector SPD-6A, separation column: Vydac 218 TP 101522 (10 - 15 μm, 250 × 22 mm), Eluent: A = 0.05% TFA in water, B = 0.05% TFA in 80% acetonitrile / water; River: 10.0 -15.0 ml / min, isocratic or with a shallow gradient.

Die Analyse erfolgte mit Hilfe eines Flugzeitmassenspektrometers (MALDI-TOF) MALDI I der Fa. Shimadzu. The Analysis was carried out by means of a time-of-flight mass spectrometer (MALDI-TOF) MALDI I from Shimadzu.

2) Enzymimmunoassay2) enzyme immunoassay

Beladung: Das Peptid wird mit 0,5 μg/ml in 0,1 M Carbonatpuffer pH = 9,5 mit 100 μl/well bei 4°C über Nacht auf eine Polystyren-Mikrotiterplatte (100 μl/well) beladen, anschließend wird mit Waschpuffer (PBS, 0,1 % Tween 20, 0,01 % Thiomersal) einmal mit 250 μl/well gewaschen; dann mit 150 μl/well für 2h bei Raumtemperatur (RT) blockiert (1% Rinderserumalbumin, 0,02% Natriumazid in PBS) und schließlich dreimal wie oben gewaschen. Die feste Phase wird 3 – 16h getrocknet, und die Mikroteststreifen in Aluminiumfolie eingeschweißt.Loading: The peptide is given at 0.5 μg / ml in 0.1 M carbonate buffer pH = 9.5 with 100 μl / well at 4 ° C. overnight on a polystyrene microtiter plate (100 μl / well) loaded, then is washed once with wash buffer (PBS, 0.1% Tween 20, 0.01% Thiomersal) 250 μl / well washed; then with 150 μl / well for 2h blocked at room temperature (RT) (1% bovine serum albumin, 0.02% Sodium azide in PBS) and finally washed three times as above. The solid phase is dried for 3 - 16 h, and the micro test strips are shrink-wrapped in aluminum foil.

Durchführung: 100 μl Serumverdünnung (in 1 % RSA, 0,3 M NaCl, 0,1 % Tween 20, 0,02% Natriumazid in 0,01 M Phosphatpuffer) werden 1 h bei RT inkubiert, danach folgen drei Waschschritte mit Waschpuffer (je 250 μl/well). Zum Nachweis der gebundenen Antikörper erfolgt eine Inkubation mit einem anti-human-Immunglobulin G-Peroxidase-Konjugat für 30 min. bei RT (100 μl/well), worauf sich abermals drei Waschschritte (s. o.) anschließen. Die Visualisierung des Testes erfolgt durch eine gebrauchsfertige Substratlösung (3,3',5,5'-Tetramethylbenzidin), die 10 min. bei RT inkubiert wird (100 μl/well). Durch Zugabe von 100 μl Stoplösung (2 M Schwefelsäure) wird die Reaktion beendet, worauf die Absorption bei 450 nm gemessen wird. Die Auswertung erfolgt üblicherweise anhand eines mitgeführten Standardserums.Procedure: 100 μl of serum dilution (in 1% BSA, 0.3 M NaCl, 0.1% Tween 20, 0.02% sodium azide in 0.01 M phosphate buffer) are incubated for 1 h at RT, followed by three washes with washing buffer ( 250 μl / well each). To prove the ge Bound antibody is incubated with an anti-human immunoglobulin G peroxidase conjugate for 30 min. at RT (100 ul / well), followed by another three washes (see above). The visualization of the test is carried out by a ready substrate solution (3,3 ', 5,5'-tetramethylbenzidine), the 10 min. incubated at RT (100 μl / well). By adding 100 .mu.l stop solution (2 M sulfuric acid), the reaction is stopped, whereupon the absorbance at 450 nm is measured. The evaluation is usually carried out using a standard serum.

Literatur:Literature:

  • (1) Manns, M., Meyer zum Büschenfelde, K.H.: Autoimmune Erkrankungen der Leber in: Peter, H.H., Pichler, W.J. (Hrsg.), Klinische Immunologie. München, Wien, Baltimore: Urban und Schwarzenberg, 1996: 517-531(1) Manns, M., Meyer zum Büschenfelde, K.H .: Autoimmune Diseases of the liver in: Peter, H.H., Pichler, W.J. (Ed.), Clinical Immunology. Munich, Vienna, Baltimore: Urban and Schwarzenberg, 1996: 517-531
  • (2) Kiffel, L., Loeper, J., Flinois, J.P. et al.: Does the anti-liver-kidney microsome antibody (anti-LKM 1) recognize an isozyme of hepatic cytochrome P-450? Abstract P.1/17, 10th European Drug Metabolism Workshop, Guilford, UK, July 6th to 7th in 1986(2) Kiffel, L., Loeper, J., Flinois, J.P. et al .: Does the anti-liver kidney microsome antibody (anti-LKM 1) recognize isozyme of hepatic cytochrome P-450? Abstract P.1 / 17, 10th European Drug Metabolism Workshop, Guilford, UK, July 6th to 7th in 1986
  • (3) Beaune, P., Dansette, P.M., Mansuy, D., Kiffel, L.,Finck, M. Amar, C., Leroux, Homberg, J.C.: Human anti-endoplasmic reticulum autoantibodies appearing in a druginduced hepatitis are directed against a human liver cytochrome P-450 that hydroxylates the drug. Proc. Natl. Acad. Sci. USA 84 (1987) 551 555(3) Beaune, P., Dansette, P.M., Mansuy, D., Kiffel, L., Finck, M. Amar, C., Leroux, Homberg, J.C .: Human anti-endoplasmic reticulum autoantibodies appearing in a drug-induced hepatitis are directed against a human liver cytochrome P-450 that hydroxylates the drug. Proc. Natl. Acad. Sci. USA 84 (1987) 551 555
  • (4) Manns, P.M., Griffin, K.J., Sullivan, K.F., Johnson E.F.: LKM-1 Autoantibodies Recognize a Short linear Sequence in P4502D6, a Cytochrome P-450 Mono-oxygenase. J.Clin.Invest. 88 (1991) 1370-1378(4) Manns, P.M., Griffin, K.J., Sullivan, K.F., Johnson E.F .: LKM-1 Autoantibodies Recognize a Short Linear Sequence in P4502D6, a cytochrome P-450 mono-oxygenase. J. Clin. 88 (1991) 1370-1378
  • (5) Manns, M.P.: Liver/Kidney Microsomal Autoantibodies in: Peter, J.B., Shoenfeld, Y. (Hrsg.) Autoantibodies. Amsterdam, Lausanne, New York, Oxford, Shannon, Tokyo: Elsevier, 1996: 462-466.(5) Manns, M.P .: Liver / Kidney Microsomal Autoantibodies in: Peter, J.B., Shoenfeld, Y. (eds.) Autoantibodies. Amsterdam, Lausanne, New York, Oxford, Shannon, Tokyo: Elsevier, 1996: 462-466.
  • (6) G. Schnorrenberg, H. Gerhardt, Tetrahedron, 45, 7759 (1989)(6) G. Schnorrenberg, H. Gerhardt, Tetrahedron, 45, 7759 (1989)
  • (7) E. Atherton und R. C. Sheppard, "Solid phase peptide synthesis – a practical approach" IRL Press, Oxford, 1989(7) E. Atherton and R. C. Sheppard, "Solid phase peptide synthesis - a practical approach "IRL Press, Oxford, 1989

Claims (12)

Peptid des Cytochroms P450 2D6, dadurch gekennzeichnet, dass es folgende Aminosäuresequenz aufweist: LDELLTEHRMTWDPAQPPRDLTEAFLAEMBKAK. (I)A peptide of the cytochrome P450 2D6, characterized in that it has the following amino acid sequence: LDELLTEHRMTWDPAQPPRDLTEAFLAEMBKAK. (I) Verfahren zur Bestimmung von anti-LKM 1-Antikörpern, gekennzeichnet dadurch, dass das Peptid I oder eine Verbindung dieses Peptids mit einem Carriermolekül adsorptiv oder kovalent an eine feste Phase gebunden ist und nachfolgend zur spezifischen Bindung und zum Nachweis der anti-LKM 1-Antikörper im Immunoassay eingesetzt wird.Method for the determination of anti-LKM 1 antibodies, characterized in that the peptide I or a compound of this peptide a carrier molecule adsorptively or covalently bound to a solid phase and subsequently for specific binding and detection of anti-LKM 1 antibodies in Immunoassay is used. Verfahren zur Bestimmung von anti-LKM 1-Antikörpern nach Anspruch 2, gekennzeichnet dadurch, dass als Carrier hochmolekulare Verbindungen eingesetzt werden.Method for the determination of anti-LKM 1 antibodies Claim 2, characterized in that as a carrier high molecular weight Connections are used. Verfahren zur Bestimmung von anti-LKM 1-Antikörpern nach einem der Ansprüche 2 oder 3, gekennzeichnet dadurch, dass die Bindung des Antigens adsorptiv oder kovalent oder nach vorheriger chemischer Aktivierung der festen Phase erfolgt.Method for the determination of anti-LKM 1 antibodies one of the claims 2 or 3, characterized in that the binding of the antigen adsorptive or covalent or after prior chemical activation the solid phase takes place. Verfahren zur Bestimmung von anti-LKM 1-Antikörpern nach einem der Ansprüche 2 – 4, gekennzeichnet dadurch, dass die feste Phase aus Polystyren besteht.Method for the determination of anti-LKM 1 antibodies one of the claims 2 - 4, characterized in that the solid phase consists of polystyrene. Verfahren zur Bestimmung von anti-LKM 1-Antikörpern nach Anspruch 2 – 5, gekennzeichnet dadurch, dass die als feste Phase dienenden Träger in Form einer Mikrotiterplatte oder eines Röhrchens vorliegen oder eine kugelförmige oder flächenförmige Gestalt haben.Method for the determination of anti-LKM 1 antibodies Claim 2 - 5, characterized in that the solid phase serving carrier in the form a microtiter plate or a tube or a spherical or planar shape to have. Verfahren zur Bestimmung von anti-LKM 1-Antikörpern nach Anspruch 2 – 6, gekennzeichnet dadurch, dass die anti-LKM 1-Antikörper spezifisch an das immobilisierte Peptid-Antigen gebunden und im Immunoassay bestimmt werden. Method for the determination of anti-LKM 1 antibodies Claim 2 - 6, characterized in that the anti-LKM 1 antibodies are specific bound to the immobilized peptide antigen and in the immunoassay be determined. Verfahren zur Bestimmung von anti-LKM 1-Antikörpern nach Anspruch 2 – 7, gekennzeichnet dadurch, dass die Bindung der anti-LKM 1-Antikörper in geeigneten Puffern, die nichtionische und ionische Detergenzien und Proteine enthalten, erfolgt.Method for the determination of anti-LKM 1 antibodies Claim 2 - 7, characterized in that the binding of the anti-LKM 1 antibodies in suitable Buffers containing nonionic and ionic detergents and proteins contained, takes place. Verfahren zur Bestimmung von anti-LKM 1-Antikörpern nach Anspruch 2 – 9, gekennzeichnet dadurch, dass die gebundenen anti-LKM 1-Antikörper durch spezifische Marker-Konjugate, die gegen einzelne Immunglobulinklassen oder gegen mehrere gerichtet sind, nachgewiesen werden.Method for the determination of anti-LKM 1 antibodies Claim 2 - 9, characterized in that the bound anti-LKM 1 antibodies by specific marker conjugates, directed against individual immunoglobulin classes or against several are proven. Verfahren zur Bestimmung von anti-LKM 1-Antikörpern nach Anspruch 2 – 10, gekennzeichnet dadurch, dass als Marker Enzyme oder Radioisotope eingesetzt werden.Method for the determination of anti-LKM 1 antibodies Claim 2 - 10, characterized in that used as a marker enzymes or radioisotopes become. Testkit zur Bestimmung von LKM 1-Antikörpern in physiologischen Flüssigkeiten nach Anspruch 1 enthaltend eine peptid-beladene feste Phase, Waschlösung, Proben-Verdünnungspuffer, Konjugat-Verdünnungspuffer, einen markierten anti-Species-Immunglobulin-Antikörper, ein markerspezifisches Nachweissystem.Test kit for the determination of LKM 1 antibodies in physiological fluids according to claim 1 containing a peptide-loaded solid phase, Wash solution, Sample dilution buffer, Conjugate dilution buffer one labeled anti-species immunoglobulin antibody, a marker-specific Detection system. Testkit zur Bestimmung von LKM 1-Antikörpern in Serum nach Anspruch 11 enthaltend eine peptid-beladene feste Phase aus Polystyren, Waschlösung, Proben-Verdünnungspuffer, Konjugat-Verdünnungspuffer, einen markierten anti-Species-Immunglobulin-Antikörper, ein Enzymsubstrat.Test kit for the determination of LKM 1 antibodies in Serum according to claim 11 containing a peptide-loaded solid Phase of polystyrene, Wash solution, Sample dilution buffer, Conjugate dilution buffer one labeled anti-species immunoglobulin antibody, an enzyme substrate.
DE19930933A 1998-07-10 1999-07-06 Method for the determination of anti-LKM 1 antibodies Expired - Fee Related DE19930933B4 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
DE19930933A DE19930933B4 (en) 1998-07-10 1999-07-06 Method for the determination of anti-LKM 1 antibodies

Applications Claiming Priority (3)

Application Number Priority Date Filing Date Title
DE19832642 1998-07-10
DE19832642.4 1998-07-10
DE19930933A DE19930933B4 (en) 1998-07-10 1999-07-06 Method for the determination of anti-LKM 1 antibodies

Publications (2)

Publication Number Publication Date
DE19930933A1 DE19930933A1 (en) 2000-01-13
DE19930933B4 true DE19930933B4 (en) 2005-05-25

Family

ID=7874722

Family Applications (1)

Application Number Title Priority Date Filing Date
DE19930933A Expired - Fee Related DE19930933B4 (en) 1998-07-10 1999-07-06 Method for the determination of anti-LKM 1 antibodies

Country Status (1)

Country Link
DE (1) DE19930933B4 (en)

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1992022656A1 (en) * 1991-06-17 1992-12-23 Institut National De La Sante Et De La Recherche Medicale (Inserm) Human p450 iid6 cytochrome-derived peptide fragments, anti peptide fragment antibodies, and applications thereof in the diagnosis of autoimmune hepatitis

Patent Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1992022656A1 (en) * 1991-06-17 1992-12-23 Institut National De La Sante Et De La Recherche Medicale (Inserm) Human p450 iid6 cytochrome-derived peptide fragments, anti peptide fragment antibodies, and applications thereof in the diagnosis of autoimmune hepatitis

Non-Patent Citations (3)

* Cited by examiner, † Cited by third party
Title
Internet-Recherche am 23.04.2003: http://www.ncbi. nlm.nih.gov/entrez cDNA encoding human cytochrome P459 accession number: E10870
Internet-Recherche am 23.04.2003: http://www.ncbi.nlm.nih.gov/entrez cDNA encoding human cytochrome P459 accession number: E10870 *
Übersetzung der cDNA aus (2) in die Aminosäurese- quenz *

Also Published As

Publication number Publication date
DE19930933A1 (en) 2000-01-13

Similar Documents

Publication Publication Date Title
DE69637136T2 (en) Screening of combinatorial peptide libraries for the selection of peptide ligands for use in the affinity purification of target proteins
CN100525829C (en) Method for detecting ligands and targets in a mixture
JP2858534B2 (en) Monoclonal antibodies to denatured proteins
EP0138855B1 (en) Method of determining antigenically active amino acid sequences
JP4229704B2 (en) Fc region polypeptide binding molecule
JPH05508701A (en) Methods for identifying ligands that bind to analytes
DE60317136T2 (en) Immunoassay method, reagent for immunoassay method and method for its production
DE4209215A1 (en) HCV PEPTIDE ANTIGEN AND METHOD FOR DETERMINING HCV
DE60113139T2 (en) HCV MOSAIC ANTIGEN COMPOSITION
DE4240056A1 (en) Streptolysin O peptide antigens and method for the determination of streptolysin antibodies
JP2765902B2 (en) Diagnostic method and diagnostic system for quantification of apo AI
JPH03505120A (en) Paralog affinity chromatography
CA1341014C (en) Hcg peptides for use in antibody purification procedures
DE19930933B4 (en) Method for the determination of anti-LKM 1 antibodies
Levy et al. Mapping B cell epitopes in Goodpasture's disease.
Anderson et al. Polymer modification of antibody to eliminate immune complex and Fc binding
EP0776906A2 (en) Sm-D peptide antigens and their use especially in the diagnosis of systemic lupus erythromatodes
CN108948173B (en) Citrulline modified peptide and application thereof
CN108948174B (en) Citrulline modified peptide and application thereof
DE10002892A1 (en) New immunodominant peptides from actin, useful for diagnosis and treatment of type I autoimmune hepatitis
CN110317254A (en) People MBP epitope peptide, antigen, antibody, application and chemical luminescence reagent kit
US5246851A (en) Monoclonal antibody specific for a 14kd protein obtained from n gonorroeae
JPH06293798A (en) Epitope-related peptide of human parvovirus b19
DE19624620C2 (en) Method for the determination of anti-Sp 100 antibodies from body fluids
US20030049694A1 (en) Production of fusion proteins and use for identifying binding molecules

Legal Events

Date Code Title Description
8110 Request for examination paragraph 44
8364 No opposition during term of opposition
8327 Change in the person/name/address of the patent owner

Owner name: HUMAN GESELLSCHAFT FUER BIOCHEMICA UND DIAGNOS, DE

R119 Application deemed withdrawn, or ip right lapsed, due to non-payment of renewal fee

Effective date: 20140201