DE102008062136B4 - Pharmaceutical composition based on peptide of camel milk - Google Patents

Pharmaceutical composition based on peptide of camel milk Download PDF

Info

Publication number
DE102008062136B4
DE102008062136B4 DE102008062136A DE102008062136A DE102008062136B4 DE 102008062136 B4 DE102008062136 B4 DE 102008062136B4 DE 102008062136 A DE102008062136 A DE 102008062136A DE 102008062136 A DE102008062136 A DE 102008062136A DE 102008062136 B4 DE102008062136 B4 DE 102008062136B4
Authority
DE
Germany
Prior art keywords
lactophorin
dpp4
seq
peptides
peptide
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Active
Application number
DE102008062136A
Other languages
German (de)
Other versions
DE102008062136A1 (en
Inventor
Karen Depta
Dr. Al Zoubi Khaled
Dr. Al Falah Marwan
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
KAMAMED GMBH, DE
Original Assignee
KAMAMED UG
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by KAMAMED UG filed Critical KAMAMED UG
Priority to DE102008062136A priority Critical patent/DE102008062136B4/en
Priority to PCT/EP2009/008768 priority patent/WO2010072327A2/en
Publication of DE102008062136A1 publication Critical patent/DE102008062136A1/en
Application granted granted Critical
Publication of DE102008062136B4 publication Critical patent/DE102008062136B4/en
Active legal-status Critical Current
Anticipated expiration legal-status Critical

Links

Images

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/01—Hydrolysed proteins; Derivatives thereof
    • A61K38/012—Hydrolysed proteins; Derivatives thereof from animals
    • A61K38/018—Hydrolysed proteins; Derivatives thereof from animals from milk
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/12—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
    • A61K35/20—Milk; Whey; Colostrum
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/04—Peptides having up to 20 amino acids in a fully defined sequence; Derivatives thereof
    • A61K38/06—Tripeptides
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/1703—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • A61K38/1709—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00—Drugs for disorders of the nervous system
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00—Drugs for disorders of the nervous system
    • A61P25/24—Antidepressants
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00—Drugs for disorders of the nervous system
    • A61P25/28—Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00—Drugs for disorders of the metabolism
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00—Drugs for disorders of the metabolism
    • A61P3/04—Anorexiants; Antiobesity agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00—Drugs for disorders of the metabolism
    • A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00—Drugs for disorders of the metabolism
    • A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
    • A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00—Drugs for immunological or allergic disorders
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00—Drugs for disorders of the cardiovascular system

Abstract

Verwendung eines Peptids, das eine der Sequenzen SEQ-ID Nr. 1 (Lactophorin A), SEQ-ID Nr. 2 (Lactophorin B) oder SEQ-ID Nr. 7 aufweist, zur Behandlung einer Krankheit, die durch Hemmung der humanen DPP4 therapierbar ist und aus der Gruppe ausgewählt ist, die aus Diabetes mellitus oder Fettleibigkeit besteht.Use of a peptide which has one of the sequences SEQ-ID No. 1 (lactophorin A), SEQ-ID No. 2 (lactophorin B) or SEQ-ID No. 7 for the treatment of a disease which can be treated by inhibiting human DPP4 and is selected from the group consisting of diabetes mellitus or obesity.

Description

Die Erfindung betrifft Peptide, die z. B. aus Kamelmilch isolierbar sind, und als Wirkstoff in pharmazeutischen Zusammensetzungen verwendet werden können, insbesondere zur Verwendung bei medizinischen Indikationen, die durch Hemmung der humanen DPP4, zAAP und/oder DPP8 und/oder DPP9 therapiert werden können, insbesondere Diabetes mellitus Typ 2 und/oder Fettleibigkeit.The invention relates to peptides z. B. are isolated from camel milk, and can be used as an active ingredient in pharmaceutical compositions, in particular for use in medical indications that can be treated by inhibiting human DPP4, zAAP and / or DPP8 and / or DPP9, especially diabetes mellitus type 2 and / or obesity.

Stand der TechnikState of the art

Drucker et al. (Nature Reviews 109–110 (2007)) beschreiben die Wirkung von Sitagliptinphosphat, das als Medikament bei Typ 2 Diabetes mellitus eingesetzt wird. Der Wirkungsmechanismus von Sitagliptin beruht auf der Inhibition von menschlicher Dipeptidylpeptidase 4 (DPP4), die das die Insulinsekretion von beta-Inselzellen fördernde Glukagon-like Peptid 1 (GLP1) und das Glucose-abhängige insulinotrophe Polypeptid (GIP) durch Proteolyse inaktiviert. Die Hemmung der proteolytischen Aktivität von DPP4 führt daher zu einer länger anhaltenden Aktivität der endogenen glucoregulatorischen Inkretine GIP und GLP1.Drucker et al. (Nature Reviews 109-110 (2007)) describe the effect of sitagliptin phosphate, which is used as a drug in type 2 diabetes mellitus. The mechanism of action of sitagliptin is based on the inhibition of human dipeptidyl peptidase 4 (DPP4), which inactivates the insulin secretion of beta islet cells promoting glucagon-like peptide 1 (GLP1) and the glucose-dependent insulinotropic polypeptide (GIP) by proteolysis. The inhibition of the proteolytic activity of DPP4 therefore leads to a prolonged activity of the endogenous glucoregulatory incretins GIP and GLP1.

Traditionelle Heilverfahren im arabischen Raum und Afrika setzen Kamelmilch als Nahrungsmittel zur Bekämpfung von Herz-Kreislauf-Krankheiten und Diabetes ein. Shabo et al. (Journal of Camel Practice and Research, 2008, 15(1): 55–59) offenbart, dass die orale Gabe unpasteurisierter Kamelmilch vorteilhaft gegen Infektionen des Verdauungstraktes wirkt. Wernery (Journal of Camel Practice and Research, 2006, 13: 15–26) lehrt, dass Kameltreiber die Wirkung von Kamelmilch in der Behandlung von Bauchwassersucht, Typhus und Arthritis schätzen.Traditional healing methods in the Arab world and Africa use camel milk as a food to combat cardiovascular diseases and diabetes. Shabo et al. (Journal of Camel Practice and Research, 2008, 15 (1): 55-59) discloses that the oral administration of unpasteurised camel milk is beneficial against digestive tract infections. Wernery (Journal of Camel Practice and Research, 2006, 13: 15-26) teaches camel drivers to appreciate the effect of camel milk in the treatment of ascites, typhoid, and arthritis.

Kappeler et al. (J. Dairy Science 2084–2093 (1999)) beschreiben die Klonierung und Aminosäuresequenzierung von Lactophorin A und dessen Variante Lactophorin B aus Kamelmilch. Für Lactophorin wurden gute emulgierende Eigenschaften und die Inhibition der spontanen Lipolyse durch Lipoproteinlipase gefunden. Das Lactophorin war nicht glykosyliert und zeigte Sequenzähnlichkeiten zu Glykosylierungs-abhängigen Zelladhäsionsmolekül-1-Proteinen (GlyCAM-1). Die Aminosäuresequenzen von Lactophorin A und B sind unter der Zugangsnummer AJ131714 bei EMBL bzw. GenBank hinterlegt.Kappeler et al. (J. Dairy Science 2084-2093 (1999)) describe the cloning and amino acid sequencing of lactophorin A and its variant lactophorin B from camel milk. For lactophorin, good emulsifying properties and inhibition of spontaneous lipolysis by lipoprotein lipase were found. The lactophorin was not glycosylated and showed sequence similarities to glycosylation-dependent cell adhesion molecule-1 proteins (GlyCAM-1). The amino acid sequences of lactophorin A and B are deposited under accession number AJ131714 at EMBL and GenBank, respectively.

Deacon (Diabetes, 2181–2189 (2004)) beschreibt, dass die Inhibierung von DPP4 aufgrund der verminderten Proteolyse von GLP1 antidiabetische Wirkung haben kann. Als Inhibitoren von DPP4 werden Valin-pyrrolidid und Isoleucin-thiazolidid genannt. Da der DPP4-Inhibitor Valin-pyrrolidid auch in Mausmutanten ohne GLP1-Rezeptor die Glucosetoleranz verbesserte, wird vermutet, dass die Inhibierung von DPP4 auch die Proteolyse exogenen GIPs vermindert. Bei Verabreichung des DPP4 – Inhibitors Isoleucin-thiazolidid an Vancouver-Zucker-diabetische fette Ratten wird neben der Verbesserung der Glucosetoleranz und der verbesserten Reaktion von β-Zellen auch eine Verminderung des gesamten Körpergewichts beobachtet.Deacon (Diabetes, 2181-2189 (2004)) describes that inhibition of DPP4 may have antidiabetic activity due to decreased proteolysis of GLP1. Inhibitors of DPP4 are valine pyrrolidide and isoleucine thiazolidide. Since the DPP4 inhibitor valine pyrrolidide also improved glucose tolerance in mouse mutants lacking the GLP1 receptor, it is believed that inhibition of DPP4 also reduces the proteolysis of exogenous GIPs. Administration of the DPP4 inhibitor isoleucine thiazolidide to Vancouver sugar diabetic fat rats also shows a decrease in total body weight in addition to the improvement in glucose tolerance and the improved response of β cells.

Die EP 0 995 440 A1 beschreibt pharmazeutische Zusammensetzungen, die einen Hemmstoff der DPP4 enthalten, zur Erhöhung des Blutzuckerspiegels. Als Hemmstoff der DPP4 werden allgemein Inhibitoren, Substrate, Pseudosubstrate, Expressionsinhibitoren, Bindeproteine und Antikörper genannt, insbesondere Alanyl-pyrrolidid und Isoleucyl-thiazolidid, N-Valyl-Prolyl sowie O-Benzoylhydroxylamin, insbesondere als Fumarat.The EP 0 995 440 A1 describes pharmaceutical compositions containing an inhibitor of DPP4 for increasing blood sugar levels. Inhibitors of DPP4 are generally called inhibitors, substrates, pseudo substrates, expression inhibitors, binding proteins and antibodies, in particular alanylpyrrolidide and isoleucyl-thiazolidide, N-valyl-prolyl and O-benzoylhydroxylamine, especially as fumarate.

Die WO 99/67 278 A1 beschreibt Vorläufersubstanzen von Isoleucylthiazolidid zur Verwendung als Inhibitor der DPP4.The WO 99/67278 A1 describes precursors of isoleucyl thiazolidide for use as inhibitor of DPP4.

Die WO 99/38 501 A2 beschreibt die Verwendung von Dipeptiden, nämlich von Pro-Pro, Ala-Pro und D-Ala-L-Ala, als Hemmstoff der DPP4 oder von GLP1.The WO 99/38501 A2 describes the use of dipeptides, namely Pro-Pro, Ala-Pro and D-Ala-L-Ala, as inhibitors of DPP4 or of GLP1.

Die WO 01/68 603 A2 beschreibt Inhibitoren der DPP4, die eine Pyrrolidingruppe mit einem gebundenen Cyclopropylrest aufweisen.The WO 01/68603 A2 describes inhibitors of DPP4 having a pyrroliding group with a bound cyclopropyl group.

WO 01/40 180 A1 beschreibt Verbindungen, die einen mit einer Nitrilgruppe sub- stituierten Pyrrolidinrest aufweisen, zu Verwendung als Inhibitor der DPP4. WO 01/40 180 A1 describes compounds having a pyrrolidine moiety substituted with a nitrile group for use as an inhibitor of DPP4.

Aufgabe der ErfindungObject of the invention

Gegenüber dem vorgenannten Stand der Technik ist es Aufgabe der Erfindung, einen alternativen Hemmstoff für die humane DPP4 bereitzustellen. Ferner liegt die Aufgabe in der Bereitstellung eines Hemmstoffs der humanen DPP4 für die medizinische Anwendung bei Diabetes, insbesondere Diabetes mellitus (Typ 2 Diabetes), sowie Fettleibigkeit.Compared to the aforementioned prior art, it is an object of the invention to provide an alternative inhibitor of human DPP4. Furthermore, the object is to provide a Inhibitor of human DPP4 for medical use in diabetes, especially diabetes mellitus (type 2 diabetes), as well as obesity.

Allgemeine Beschreibung der ErfindungGeneral description of the invention

Die Erfindung löst die vorgenannte Aufgabe durch die Bereitstellung von Peptiden, die aus Kamelmilch isolierbar sind und eine der Sequenzen aus SEQ-ID Nr. 1 (Lactophorin A), SEQ-ID Nr. 2 (Lactophorin B) oder SEQ-ID Nr. 7 aufweisen zur medizinischen Verwendung zur Inhibierung der DPP4 und DPP4-analoger Peptidasen, vorzugsweise in Kombination mit der Inhibierung von APN, zAAP und/oder DPP8 und DPP9, insbesondere bei der medizinischen Indikation Diabetes mellitus und/oder Fettleibigkeit. Als DPP4-ähnliche Enzyme und Peptidasen oder, gleichbedeutend verwendet, DPP4-analoge Enzyme und Peptidasen, werden vorliegend insbesondere Peptidasen mit regulatorischer Funktion bezeichnet, die vorzugsweise eine mit der DPP4 ähnliche Aminosäuresequenz aufweisen, z. B. eine zu mindestens 80 bis 90% identische Sequenz umfassen oder daraus bestehen. DPP4-analoge Peptidasen wirken vorzugsweise in vivo auf die selben Substrate wie DPP4, und sind insbesondere solche Peptidasen, die in vivo GLP-1, GLP-2 und/oder GIP und/oder NPY und/oder PYY spalten. Besonders bevorzugt sind DPP4-analoge Peptidasen solche, bei denen die Hemmung ihrer proteolytischen Aktivität eine der erfindungsgemäßen medizinischen Indikationen positiv beeinflusst.The invention achieves the aforementioned object by providing peptides which are isolatable from camel milk and one of the sequences from SEQ ID No. 1 (lactophorin A), SEQ ID No. 2 (lactophorin B) or SEQ ID No. 7 for medical use for inhibiting the DPP4 and DPP4-analogue peptidases, preferably in combination with the inhibition of APN, zAAP and / or DPP8 and DPP9, especially in the medical indication diabetes mellitus and / or obesity. As DPP4-like enzymes and peptidases or, equivalently, DPP4-analogous enzymes and peptidases, in the present case in particular peptidases are designated with regulatory function, which preferably have a similar to the DPP4 amino acid sequence, for. B. comprise or consist of at least 80 to 90% identical sequence. DPP4-analogous peptidases preferentially act in vivo on the same substrates as DPP4, and are particularly those peptidases which cleave in vivo GLP-1, GLP-2 and / or GIP and / or NPY and / or PYY. Particularly preferred DPP4-analogue peptidases are those in which the inhibition of their proteolytic activity positively influences one of the medical indications according to the invention.

Die Analyse und Identifikation einzelner Substanzen aus Kamelmilch hat überraschenderweise gezeigt, dass daraus isoliertes Lactophorin A und/oder Lactophorin B, sowie daraus abgeleitete Peptide mit bestimmter Aminosäuresequenz inhibitorische Wirkung gegen die humane DPP4 und DPP4-analoge Peptidasen, und vorzugsweise auch gegen die humane Aminopeptidase N (APN) und/oder gegen die humane zytosolische Alanylaminopeptidase (zAAP) und/oder gegen humane Dipeptidpeptidase 8 (DPP8) und/oder Dipeptidpeptidase 9 (DPP9) haben. Diese inhibitorische Wirkung gegenüber den vorgenannten Peptidasen, insbesondere gegenüber DPP4, wurde sowohl in in vitro Tests und in vitro in Zellkultur nachgewiesen, als auch im Versuchstier. Die pharmazeutische Wirksamkeit von Lactophorin A und Lactophorin B aus Kamelmilch und daraus abgeleiteten Peptiden, insbesondere solchen, die eine der Sequenzen aus SEQ-ID Nr. 1 (Lactophorin A), SEQ-ID Nr. 2 (Lactophorin B) oder SEQ-ID Nr. 7 aufweisen, kannte im Tierversuch für die Indikationen Diabetes mellitus Typ 2 gezeigt werden, sowie für die Indikation Fettleibigkeit. Vorzugsweise haben die erfindungsgemäßen Peptide neben der Wirkung gegen DPP4 auch eine signifikante inhibitorische Wirkung gegen eine oder mehrere aus der Gruppe, die humane APN, humane zAAP, humane DPP8 und/oder DPP9 umfasst, so dass eine Verstärkung der pharmazeutischen Wirkung der Peptide durch deren Hemmung von mindestens zwei Peptidasen aus der vorgenannten Gruppe erzielt wird.Surprisingly, the analysis and identification of individual substances from camel milk has shown that lactophorin A and / or lactophorin B isolated therefrom, as well as peptides derived therefrom with specific amino acid sequence inhibitory activity against the human DPP4 and DPP4 analog peptidases, and preferably also against the human aminopeptidase N (APN) and / or against human cytosolic alanylaminopeptidase (zAAP) and / or against human dipeptide peptidase 8 (DPP8) and / or dipeptide peptidase 9 (DPP9). This inhibitory activity against the aforementioned peptidases, in particular against DPP4, has been demonstrated both in in vitro tests and in vitro in cell culture, as well as in experimental animals. The pharmaceutical activity of lactophorin A and lactophorin B from camel milk and peptides derived therefrom, in particular those having one of the sequences from SEQ ID No. 1 (lactophorin A), SEQ ID No. 2 (lactophorin B) or SEQ ID no 7, animal diabetes mellitus type 2 and animal obesity were known. Preferably, in addition to the action against DPP4, the peptides of the invention also have a significant inhibitory activity against one or more of the group comprising human APN, human zAAP, human DPP8 and / or DPP9, thus enhancing the pharmaceutical effect of the peptides by inhibiting them of at least two peptidases from the aforementioned group is achieved.

Insbesondere konnte im Tierversuch gezeigt werden, dass die erfindungsgemäßen Peptide auch bei oraler Verabreichung gegen den Aufbau von Speicherfettgewebe, z. B. gegen Fettleibigkeit wirksam sind.In particular, it could be shown in animal experiments that the peptides according to the invention, even when administered orally against the build-up of storage fat tissue, eg. B. are effective against obesity.

Es wird vermutet, dass die Wirksamkeit erfindungsgemäßer Peptide gegen Fettleibigkeit neben der Reduktion der Proteolyse von Insulin auch darauf beruht, dass Neuropeptid Y (NPY) und/oder Peptid YY (PYY) bei Hemmung der Aktivität von DPP4 und deren membrangebundener Formen weniger stark abgebaut werden bzw. länger vorliegen. Als Folge ist ein durch NPY und/oder PYY erzeugtes Sättigungsgefühl stärker oder bleibt länger erhalten.It is believed that the effectiveness of peptides according to the invention against obesity, in addition to the reduction of proteolysis of insulin, is also due to the fact that neuropeptide Y (NPY) and / or peptide YY (PYY) are less degraded in inhibiting the activity of DPP4 and its membrane-bound forms or longer. As a result, a sense of satiety generated by NPY and / or PYY is stronger or longer lasting.

Die erfindungsgemäßen Peptide können durch orale Verabreichung oder durch Verabreichung per Injektion, z. B. i. m. oder i. v., von Fusionspeptiden, insbesondere in pharmazeutisch akzeptabler Formulierung appliziert werden, wobei Fusionspeptide zumindest eine der Sequenzen aus SEQ-ID Nr. 1 (Lactophorin A), SEQ-ID Nr. 2 (Lactophorin B) oder SEQ-ID Nr. 7 aufweisen.The peptides of the invention may be administered by oral administration or by administration by injection, e.g. I. m. or I. v., are applied by fusion peptides, in particular in pharmaceutically acceptable formulation, wherein fusion peptides at least one of the sequences of SEQ ID NO. 1 (Lactophorin A), SEQ ID NO. 2 (Lactophorin B) or SEQ ID No. 7 have ,

Die erfindungsgemäßen Peptide, die deren Fusionspeptide einschließen können, sind gegenüber bekannten Inhibitoren der DPP4 deshalb vorteilhaft, weil ihre Wirkung im Organismus nach Verabreichung von begrenzter Dauer ist, z. B. auf eine Hauptwirkungsdauer von ca. 1 bis 4 h. Diese begrenzte bzw. im Vergleich zu z. B. Sitagliptinphosphat signifikant kürzere Hauptwirkungsdauer bzw. Halbwertszeit führt dazu, dass die unerwünschte Reduktion der natürlichen Zell-Zell-Adhäsion signifikant geringer bzw. vermindert ist. Daher wird die zeitlich begrenzte Hauptwirkungsdauer der erfindungsgemäßen Peptide als Inhibitoren der DPP4 derzeit als Grund dafür angesehen, dass die Nebenwirkung der erfindungsgemäßen Peptide zur Erzeugung von Neoplasmen und insbesondere die Nebenwirkung einer Verstärkung der Metastasierung bestehender Tumore signifikant geringer ist, als bei bekannten DPP4-Inhibitoren.The peptides of the invention, which may include their fusion peptides, are advantageous over known inhibitors of DPP4 because their effect in the organism after administration is of limited duration, e.g. B. to a main duration of action of about 1 to 4 hours. This limited or compared to z. B. Sitagliptin phosphate significantly shorter main action duration or half-life leads to the fact that the unwanted reduction of the natural cell-cell adhesion is significantly lower or reduced. Therefore, the time-limited main duration of action of the peptides of the invention as inhibitors of DPP4 is currently considered to be the reason that the side effect of the peptides according to the invention for the production of neoplasms and in particular the side effect of enhancing the metastasis of existing tumors is significantly lower than in known DPP4 inhibitors.

Die Verwendung der erfindungsgemäßen Peptide zur Herstellung von pharmazeutischen Zusammensetzungen bzw. als Wirkstoff in pharmazeutischen Zusammensetzungen gegen Diabetes mellitus und/oder Fettleibigkeit hat daher den Vorteil geringer Nebenwirkungen, insbesondere ein geringeres Risiko neoplastischer Neuerkrankungen und/oder insbesondere ein geringeres Risiko der Metastasierung bestehender Neoplasmen, z. B. bei endometrialem Adenokarzinom, Melanomen, Prostatakarzinom, hämatologischen Tumoren, z. B. akute lymphatischer Leukämie und Hogdekin-Syndrom, gastrointestinalem Karzinom, humanem hepatozellulären Karzinom, Lungen-Adenokarzinom, Schilddrüsenkarzinom, papillärem und follikulärem Schilddrüsenkarzinom und Ovarialkarzinom. Als Ursache für die geringe Wirkung der erfindungsgemäßen Peptide zur Verstärkung bzw. Metastasierung von zumindest diesen Neoplasmen wird derzeit angenommen, dass die verminderte Expression von DPP4/CD26 auf neoplastischen Zellen durch Anwesenheit eines Inhibitors der DPP4 günstig beeinflusst wird. So führt z. B. die Anwesenheit erfindungsgemäßer Peptide zur Minderung der Aktivität zur Migration und Invasion, bzw. der Malignität neoplastischer Zellen im Vergleich zur Wirkung von z. B. Sitagliptinphosphat, da die Minderung der Zell-Zell-Adhäsion durch Inhibition der DPP4 durch erfindungsgemäße Peptide reduziert bzw. zeitlich begrenzt auftritt.The use of the peptides according to the invention for the preparation of pharmaceutical compositions or as an active ingredient in pharmaceutical compositions for diabetes mellitus and / or Obesity therefore has the advantage of low side effects, in particular a lower risk of neoplastic new diseases and / or in particular a lower risk of metastasis of existing neoplasms, z. In endometrial adenocarcinoma, melanoma, prostate carcinoma, hematological tumors, e.g. Acute lymphocytic leukemia and Hogdekin syndrome, gastrointestinal carcinoma, human hepatocellular carcinoma, lung adenocarcinoma, thyroid carcinoma, papillary and follicular thyroid carcinoma and ovarian carcinoma. The reason for the low effect of the peptides according to the invention for the amplification or metastasis of at least these neoplasms is currently believed to be that the reduced expression of DPP4 / CD26 on neoplastic cells is favorably influenced by the presence of an inhibitor of DPP4. So z. B. the presence of inventive peptides to reduce the activity of migration and invasion, or the malignancy of neoplastic cells compared to the effect of z. As sitagliptin phosphate, since the reduction of cell-cell adhesion by inhibition of DPP4 by peptides of the invention is reduced or occurs for a limited time.

Die zeitlich begrenzte Wirkung der erfindungsgemäßen Peptide wird derzeit darauf zurückgeführt, dass die Wirkstoffe keine synthetischen Derivatisierungen aufweisen und vom Organismus abgebaut werden können. Daher sind unerwünschte Nebenwirkungen bei Verabreichung der Verbindungen zu medizinischen Zwecken auch an Menschen im wesentlichen nicht zu beobachten bzw. im Vergleich mit bekannten Hemmstoffen der DPP4 signifikant reduziert.The temporary effect of the peptides of the invention is currently attributed to the fact that the active ingredients have no synthetic derivatizations and can be degraded by the organism. Therefore, unwanted side effects when administering the compounds for medical purposes are substantially unnoticeable to humans or significantly reduced compared to known inhibitors of DPP4.

Die erfindungsgemäßen Peptide und Fusionspeptide, deren proteolytische Spaltprodukte erfindungsgemäße Peptide enthalten, können durch übliche Syntheseverfahren oder aus natürlichen Quellen, insbesondere aus Kamelmilch isoliert werden. Peptide, die nicht die vollständige Sequenz von Lactophorin A oder Lactophorin B umfassen, können z. B. durch proteolytische Spaltung von Lactophorin A oder Lactophorin B, optional mit anschließender Aufreinigung hergestellt werden. Als Syntheseverfahren können chemische Peptidsynthesen verwendet werden, oder die heterologe Expression der Peptide von einer diese kodierenden DNA-Sequenz, die z. B. aus der Aminosäuresequenz abgeleitet ist und funktional zwischen einem Promotor und einem Terminator als Expressionskassette angeordnet ist und in einem Wirtsorganismus exprimiert wird.The peptides according to the invention and fusion peptides whose proteolytic cleavage products contain peptides according to the invention can be isolated by customary synthesis processes or from natural sources, in particular from camel milk. Peptides which do not comprise the complete sequence of lactophorin A or lactophorin B may e.g. B. by proteolytic cleavage of lactophorin A or lactophorin B, optionally be prepared with subsequent purification. As a synthetic method, chemical peptide syntheses can be used, or the heterologous expression of the peptides of a DNA sequence encoding them, the z. B. is derived from the amino acid sequence and is operably disposed between a promoter and a terminator as an expression cassette and is expressed in a host organism.

Aminosäuresequenzen von Peptiden sind in dieser Anmeldung vom N-Terminus zum C-Terminus angegeben.Amino acid sequences of peptides are given in this application from the N-terminus to the C-terminus.

Genaue Beschreibung der ErfindungDetailed description of the invention

Grundlage der vorliegenden Erfindung ist, dass die menschliche GPP4 in vitro und in vivo durch Peptide gehemmt wird, die eines der Tripeptide VPQ (Seq.-ID Nr. 3), KPQ (Seq.-ID Nr. 4), QPT (Seq.-ID Nr. 5) oder EPK (Seq.-ID Nr. 6) am N-Terminus aufweisen oder daraus bestehen.The basis of the present invention is that the human GPP4 is inhibited in vitro and in vivo by peptides containing one of the tripeptides VPQ (SEQ ID NO: 3), KPQ (SEQ ID NO: 4), QPT (Seq. ID No. 5) or EPK (SEQ ID NO: 6) at the N-terminus or consist thereof.

Erfindungsgemäße Peptide weisen die Aminosäuresequenz von Lactophorin A MKFFAVLLLASLAATSLASLNEPKDEIYMESQPTDTSAQVIMSNHQVSS EDLSMEPSISREDLVSKDDVVIKSARRHQNQNPKLLHPVPQESSFRNTA TQSEETKELTPGAATTLEGKLVELTHKIIKNLENTMRETMDFLKSLFPH ASEVVKPQ (Seq.-ID Nr. 1), die Aminosäuresequenz von Lactophorin B MKFFAVLLLASLAATSLASLNAAQVIMSNHQVSSEDLSMEPSISREDLV SKDDVVIKSARRHQNQNPKLLHPVPQESSFRNTATQSEETKELTPGAAT TLEGKLVELTHKIIKNLENTMRETMDFLKSLFPHASEVVKPQ (Seq.-ID Nr. 2) oder die Aminosäuresequenz eines bestimmten Spaltprodukts von Lactophorin A, nämlich EPKDEIYMESQPTDTS, auf.Peptides of the invention have the amino acid sequence of lactophorin A MKFFAVLLLASLAATSLASLNEPKDEIYMESQPTDTSAQVIMSNHQVSS EDLSMEPSISREDLVSKDDVVIKSARRHQNQNPKLLHPVPQESSFRNTA TQSEETKELTPGAATTLEGKLVELTHKIIKNLENTMRETMDFLKSLFPH ASEVVKPQ (SEQ ID NO. 1), the amino acid sequence of lactophorin B MKFFAVLLLASLAATSLASLNAAQVIMSNHQVSSEDLSMEPSISREDLV SKDDVVIKSARRHQNQNPKLLHPVPQESSFRNTATQSEETKELTPGAAT TLEGKLVELTHKIIKNLENTMRETMDFLKSLFPHASEVVKPQ (SEQ ID NO. 2) or the amino acid sequence of a specific cleavage product of lactophorin A, namely EPKDEIYMESQPTDTS, on.

Erfindungsgemäße Peptide umfassen daher neben Lactophorin A und/oder Lactophorin B auch Fusionsproteine natürlicher oder künstlicher Aminosäuresequenz, die ohne Umsetzung oder nach proteolytischer Spaltung zumindest eine der Sequenzen SEQ-ID Nr. 1 (Lactophorin A), SEQ-ID Nr. 2 (Lactophorin B) oder SEQ-ID Nr. 7 (EPKDEIYMESQPTDTS) aufweisen, um eine solche dreidimensionale Struktur anzunehmen, dass sie die proteolytische Aktivität von DPP4 signifikant inhibieren.Peptides according to the invention therefore comprise not only lactophorin A and / or lactophorin B but also fusion proteins of natural or artificial amino acid sequence which, without reaction or after proteolytic cleavage, comprise at least one of the sequences SEQ ID No. 1 (lactophorin A), SEQ ID No. 2 (lactophorin B ) or SEQ ID NO: 7 (EPKDEIYMESQPTDTS) to assume such a three-dimensional structure that they significantly inhibit the proteolytic activity of DPP4.

Für das proteolytische Spaltprodukt von Lactophorin A wurde ebenfalls bei oraler Verabreichung eine inhibitorische Wirkung auf DPP4 gefunden. Dieses Spaltprodukt, das die Aminosäuresequenz EPKDEIYMESQPTDTS (Seq.-ID Nr. 7) hat und ein Abschnitt der Aminosäuresequenz von Lactophorin A mit dem N-terminalen Tripeptid EPK (Seq.-ID Nr. 6) ist, zeigt in vitro und in vivo eine inhibierende Wirkung gegenüber APN. Entsprechend weisen erfindungsgemäße Zusammensetzungen vorzugsweise ein Peptid mit der Sequenz EPKDEIYMESQPTDTS (SEQ-ID Nr. 7) auf.For the proteolytic cleavage product of lactophorin A, an inhibitory effect on DPP4 was also found on oral administration. This cleavage product, which has the amino acid sequence EPKDEIYMESQPTDTS (SEQ ID NO: 7) and is a portion of the amino acid sequence of lactophorin A with the N-terminal tripeptide EPK (SEQ ID NO: 6), displays in vitro and in vivo inhibitory activity against APN. Accordingly, compositions of the invention preferably have a peptide having the sequence EPKDEIYMESQPTDTS (SEQ ID NO: 7).

Die erfindungsgemäßen Peptide umfassen auch solche Varianten und Abwandlungen ihrer Aminosäuresequenzen, die die inhibitorische Wirkung gegen DPP4 bzw. CD26 nicht signifikant beeinträchtigen. Insbesondere haben Varianten eine oder mehrere Austäusche, Deletionen oder Insertionen von Aminosäuren, insbesondere konservative Austausche.The peptides according to the invention also include those variants and modifications of their amino acid sequences which do not significantly impair the inhibitory activity against DPP4 or CD26. In particular, variants have one or more exchanges, deletions or insertions of amino acids, in particular conservative substitutions.

Die Erfindung wird nun anhand von Beispielen mit Bezug auf die Figuren näher erläutert, bei denenThe invention will now be described by way of example with reference to the figures, in which

1 eine grafische Darstellung der in vitro Inhibierung von DPP4 durch erfindungsgemäßes Peptid zeigt, 1 a graphic representation of the in vitro inhibition of DPP4 by peptide according to the invention,

2 eine grafische Darstellung der in vitro Inhibierung von DPP4 durch erfindungsgemäßes Peptid zeigt, 2 a graphic representation of the in vitro inhibition of DPP4 by peptide according to the invention,

3 die relative Hemmung von APN1 durch erfindungsgemäßes Peptid zeigt, 3 shows the relative inhibition of APN1 by peptide according to the invention,

4 eine grafische Darstellung der in vitro Inhibierung von DPP4 durch erfindungsgemäßes Peptid und von Actinonin als Vergleichssubstanz zeigt, 4 FIG. 2 shows a graphic representation of the in vitro inhibition of DPP4 by peptide according to the invention and of actinonin as comparison substance,

5 eine grafische Darstellung der in vitro Inhibierung von DPP8 und DPP9 durch erfindungsgemäßes Peptid und des DPP4-Inhibitors Actinonin als Vergleichssubstanz zeigt, 5 FIG. 2 shows a graphic representation of the in vitro inhibition of DPP8 and DPP9 by the peptide according to the invention and the DPP4 inhibitor actinonin as comparison substance,

6 eine grafische Darstellung der in vitro Inhibierung von zAAP durch erfindungsgemäßes Peptid zeigt, 6 shows a graphic representation of the in vitro inhibition of zAAP by peptide according to the invention,

7 eine grafische Darstellung der Wirkung erfindungsgemäßen Peptids auf die mitochondriale Aktivität zeigt, 7 a graphic representation of the effect of the peptide according to the invention on the mitochondrial activity,

8 die Hemmung der DPP4 durch erfindungsgemäßes Peptid in vivo zeigt, und 8th shows the inhibition of DPP4 by inventive peptide in vivo, and

9 die Wirkung erfindungsgemäßer Peptide auf die Reduktion der Zunahme des Gesamtgewichts bei Mäusen als Versuchstieren zeigt. 9 shows the effect of peptides of the invention on the reduction of the increase in the total weight in mice as experimental animals.

Beispiel 1: Hemmung der DPP4 durch FusionspeptidExample 1: Inhibition of DPP4 by fusion peptide

Bei der Fraktionierung von Peptiden aus Kamelmilch wurde für Lactophorin A und B gefunden, dass sie eine inhibitorische Wirkung auf die humane DPP4 haben. Ein erster in vitro Versuch, bei dem aufgereinigte humane rekombinante DPP4, die nach Korom (Transplantation 63, 1495–1500 (1997)) durch Expression in Zellkultur hergestellt und isoliert wurde, zeigt, dass Lactophorin A bei 100 ng/mL (Konz1), 200 ng/mL (Konz2), 500 ng/mL (Konz3), 1 μg/mL (Konz4) und 10 μg/mL (Konz5) die DPP4 inhibiert. Das Ergebnis ist in 1 dargestellt und zeigt, dass Lactophorin in den eingesetzten Konzentrationen die proteolytische Aktivität von DPP4 signifikant inhibiert. Zum Vergleich (control) ist die Aktivität von DPP4 ohne Zusatz eines Peptids im ansonsten identischen Versuch gezeigt. Die proteolytische Aktivität wurde als Umsetzung eines der Substrate GlyPro-AMC (Gly-Pro-Aminomethylcourmarin) oder Ala-Pro-Rhodamin110 (R110) bestimmt.When fractionating camel milk peptides, lactophorin A and B were found to have an inhibitory effect on human DPP4. A first in vitro experiment in which purified human recombinant DPP4 prepared and isolated according to Korom (Transplantation 63, 1495-1500 (1997)) by expression in cell culture shows that Lactophorin A was incubated at 100 ng / mL (Conc1), 200 ng / mL (conc2), 500 ng / mL (conc3), 1 μg / mL (conc4) and 10 μg / mL (conc5) which inhibits DPP4. The result is in 1 and shows that lactophorin in the concentrations used significantly inhibits the proteolytic activity of DPP4. For comparison, the activity of DPP4 is shown without addition of a peptide in the otherwise identical experiment. The proteolytic activity was determined as the conversion of one of the substrates GlyPro-AMC (Gly-Pro-Aminomethylcourmarin) or Ala-Pro-Rhodamine 110 (R110).

Generell wurden erfindungsgemäße Peptide in aufgereinigter Form in HEPES-Puffer (100 mM HEPES, pH 7,5) gelagert, vorzugsweise bei –20°C, was auch die Lagerstabilität der Peptide in Lösung bei Temperaturen unterhalb von 0°C, vorzugsweise bei –5 bis –70°C zeigt. Tests wurden bei 37°C durchgeführt. Die Messung der Hydrolyse von zugesetztem Substrat erfolgte nach Inkubation zusetzten Substrats für 2 min bei 37°C mit Enzym und Hemmstoff.In general, peptides according to the invention were stored in purified form in HEPES buffer (100 mM HEPES, pH 7.5), preferably at -20 ° C, which also the storage stability of the peptides in solution at temperatures below 0 ° C, preferably at -5 to -70 ° C shows. Tests were performed at 37 ° C. The hydrolysis of added substrate was measured after incubation of the substrate for 2 min at 37 ° C with enzyme and inhibitor.

Für Lactophorin A wurden für das Substrat GlyPro-AMC in vitro die folgenden Parameter bestimmt: Wert SA Vmax 6,59349 × 103 1,566 × 103 km 1,70005 × 104 4,829 × 10–5 ki 1,23528 × 10–3 7,461 × 10–5 For lactophorin A, the following parameters were determined for the substrate GlyPro-AMC in vitro: value SA V max 6.59349 × 10 3 1.566 × 10 3 k m 1.70005 × 10 4 4,829 × 10 -5 k i 1.23528 × 10 -3 7.461 × 10 -5

Der Ki-Wert wurde zu 1,235 × 10–3 mg/mL berechnet. Ähnliche Werte kannten für Lactophorin B bestimmt werden.The K i value was calculated to be 1.235 × 10 -3 mg / mL. Similar values could be determined for Lactophorin B.

Ein Vergleich der inhibitorischen Wirkung von Lactophorin A auf isolierte rekombinante humane DPP4 im in vitro Versuch ist in 2 im Vergleich zum bekannten DPP4-Inhibitor Lys-Z(nitro)-Pyrrolidid gezeigt. Zur Messung der Aktivität wurde nach Inkubation mit Lactophorin A bzw. Lys-Z(nitro)-Pyrrolidid über 2 h die Hydrolyse von anschließend zugesetztem Ala-Pro-Rhodamin110 (R110) fluorimetrisch bestimmt. Die Ergebnisse sind in 2 gezeigt und machen deutlich, dass Lactophorin A die humane DPP4 inhibiert. Die IC50 für Lactophorin A wurde für GlyPro-AMC zu 1,77 μM bestimmt, für Lys-Z(nitro)-Pyrrolidid zu 0,143 μM. A comparison of the inhibitory effect of Lactophorin A on isolated recombinant human DPP4 in the in vitro experiment is in 2 compared to the known DPP4 inhibitor Lys-Z (nitro) pyrrolidide. To measure the activity, the hydrolysis of subsequently added Ala-Pro-Rhodamin110 (R110) was determined by fluorimetry after incubation with Lactophorin A or Lys-Z (nitro) pyrrolidide for 2 hours. The results are in 2 demonstrated that lactophorin A inhibits human DPP4. The Lactophorin A IC50 was determined to be 1.77 μM for GlyPro-AMC and 0.143 μM for Lys-Z (nitro) pyrrolidide.

Bei Messung der inhibitorischen Wirkung von Lactophorin A mit dem Hydrolysesubstrat Gly-Pro-Aminomethylcoumarin (GlyPro-AMC) wurde eine IC50 = 6,9 μM für Lactophorin A gefunden, und von 0,39 μM für den bekannten DPP4-Inhibitor Actinonin. Die Daten sind in 4 gezeigt.Upon measuring the inhibitory effect of lactophorin A on the hydrolysis substrate gly-pro-aminomethylcoumarin (GlyPro-AMC), an IC50 = 6.9 μM was found for lactophorin A, and of 0.39 μM for the known DPP4 inhibitor actinonine. The data is in 4 shown.

Durch proteolytische Fragmentierung von Lactophorin A und Lactophorin B erhaltene Peptide wurden ebenfalls auf die Inhibition von DPP4 analysiert. Dabei wurde gefunden, dass die inhibitorische Wirkung von Lactophorin im Wesentlichen durch Peptide ausgeübt wird, die N-terminal eine der Aminosäuresequenzen VPQ (Seq.-ID Nr. 3) KPQ (Seq.-ID Nr. 4), QPT (Seq.-ID Nr. 5) oder EPK (Seq.-ID Nr. 6) aufweisen. Diese Peptide können als proteolytische Spaltprodukte aus Fusionspeptiden entstehen, die eine der Aminosäuresequenzen VPQ (Seq.-ID Nr. 3) KPQ (Seq.-ID Nr. 4), QPT (Seq.-ID Nr. 5) oder EPK (Seq.-ID Nr. 6) enthalten.Peptides obtained by proteolytic fragmentation of lactophorin A and lactophorin B were also analyzed for inhibition of DPP4. It was found that the inhibitory effect of lactophorin is essentially exerted by peptides which have N-terminally one of the amino acid sequences VPQ (SEQ ID NO: 3) KPQ (SEQ ID NO: 4), QPT (SEQ. ID No. 5) or EPK (SEQ ID NO: 6). These peptides may arise as proteolytic cleavage products from fusion peptides having one of the amino acid sequences VPQ (SEQ ID NO: 3) KPQ (SEQ ID NO: 4), QPT (SEQ ID NO: 5) or EPK (Seq. ID No. 6).

Anhand der folgenden isolierten Peptide konnte gezeigt werden, dass Peptide, die eine der Aminosäuresequenzen VPQ (Seq.-ID Nr. 3), KPQ (Seq.-ID Nr. 4), QPT (Seq.-ID Nr. 5) oder EPK (Seq.-ID Nr. 6) N-terminal enthalten, die erfindungsgemäße inhibitorische Wirkung auf DPP4 und/oder Aminopeptidase N haben:
VPQ (Seq.-ID Nr. 3) und das natürliche proteolytische Spaltprodukt aus Lactophorin A mit N-terminaler Seq.-ID Nr. 6, nämlich Seq.-ID Nr. 7.From the following isolated peptides it was possible to show that peptides having one of the amino acid sequences VPQ (SEQ ID NO: 3), KPQ (SEQ ID NO: 4), QPT (SEQ ID NO: 5) or EPK (SEQ ID NO: 6) N-terminal, have the inhibitory effect according to the invention on DPP4 and / or aminopeptidase N:
VPQ (SEQ ID NO: 3) and the natural proteolytic cleavage product of lactophorin A with N-terminal SEQ ID NO: 6, namely SEQ ID NO: 7.

Beispiel 2: Inhibierung von APN durch Lactophorin AExample 2: Inhibition of APN by Lactophorin A

Die Aktivität von Lactophorin A auf APN konnte im in vitro Test nachgewiesen werden.The activity of Lactophorin A on APN was demonstrated in the in vitro test.

Humane rekombinante APN, die nach Lendecke et al. (BioChem. 384 (2003)) hergestellt und isoliert war, wurde im Puffer von Beispiel 1 mit Lactophorin A zu 10 μg/mL (2 in 3), 5 μg/mL (3 in 3) oder 100 ng/mL (4 in 3) inkubiert. Zum Vergleich ist die Aktivität von APN ohne Zusatz gezeigt (1 in 3). Die Aktivität von APN wurde als Umsetzung des Substrats AMC spektrophotometrisch zu 0 min und 90 min bestimmt, die Ergebnisse sind in der nachfolgenden Tabelle zusammengefasst: Hemmung der APN durch Lactophorin A Konz. 0 min 90 min Aktivität über 90 min 10 μg/mL 0,0437 0,0594 0,017 5 μg/mL 0,0506 0,0688 0,0132 0,1 μg/mL 0,0456 0,6066 0,556 Human recombinant APN, which according to Lendecke et al. (BioChem 384 (2003)) was isolated and isolated in the buffer of Example 1 with Lactophorin A at 10 μg / mL (2 in 3 ), 5 μg / mL (3 in 3 ) or 100 ng / mL (4 in 3 ). For comparison, the activity of APN without additive is shown (1 in 3 ). The activity of APN was determined spectrophotometrically as the conversion of the substrate AMC to 0 min and 90 min, the results are summarized in the following table: Inhibition of APN by Lactophorin A Conc. 0 min 90 min Activity over 90 min 10 μg / mL 0.0437 0.0594 0,017 5 μg / mL 0.0506 0.0688 0.0132 0.1 μg / mL 0.0456 .6066 0.556

Die Werte zeigen, dass Lactophorin A die Aktivität von APN mit zunehmender Konzentration zunehmend inhibiert. Als Positivkontrolle für die Inhibierung wurde Actinonin verwendet.The data show that lactophorin A increasingly inhibits the activity of APN with increasing concentration. Actinonin was used as a positive control for inhibition.

Beispiel 3: Inhibierung von DPP8/DPP9 durch Lactophorin AExample 3: Inhibition of DPP8 / DPP9 by Lactophorin A.

DPP8/DPP9 wurde aus Lebern von CD26-K.O.-Mäusen (Black6, nach Marguet et al., PNAS (2000)), solubilisiert in PBS mit 1% Triton X100 teilgereinigt. Die Mischung aus DPP8/DPP9 wurde in HEPES-Puffer mit Lactophorin A bei 37°C für 2 h inkubiert. Anschließend wurde das Substrat Gly-Pro-AMC zugesetzt und als Kontrolle der DPP4-spezifische Inhibitor 3 und der für DPPB/DPP9 spezifische Inhibitor 4, wie von Lankas et al. (Diabetes 54 (10), 2988–2994 (2005)) beschrieben.DPP8 / DPP9 was partially purified from livers of CD26-K.O. mice (Black6, according to Marguet et al., PNAS (2000)) solubilized in PBS with 1% Triton X100. The mixture of DPP8 / DPP9 was incubated in HEPES buffer with lactophorin A at 37 ° C for 2 h. Subsequently, the substrate Gly-Pro-AMC was added and as control the DPP4 specific inhibitor 3 and the DPPB / DPP9 specific inhibitor 4 as described by Lankas et al. (Diabetes 54 (10), 2988-2994 (2005)).

Die Ergebnisse sind in 5 gezeigt und machen deutlich, dass Lactophorin A DPP8 und/oder DPP9 inhibiert. Für DPP8/DPP9 wurde hier für Lactophorin A eine IC50 von 21 μM bestimmt, für den DPP8/DPP9-Inhibitor eine IC50 von 0,009 μM und für den DPP4-Inhibitor eine IC50 > 31,25 μM.The results are in 5 and demonstrate that Lactophorin A inhibits DPP8 and / or DPP9. For DPP8 / DPP9, an IC50 of 21 μM was determined for lactophorin A, an IC50 of 0.009 μM for the DPP8 / DPP9 inhibitor and an IC50> 31.25 μM for the DPP4 inhibitor.

Die Hemmung von DPP8/DPP9 konnte auch für die Peptide der Seq.-ID Nrn. 3 bis 6 und erfindungsgemäße Fusionspeptide gezeigt werden, deren Aminosäuresequenz N-terminal eine Sequenz der Seq.-ID Nr. 3, Seq.-ID Nr. 4, Seq.-ID Nr. 5 oder Seq.-ID Nr. 6 aufwies. The inhibition of DPP8 / DPP9 could also be demonstrated for the peptides of SEQ ID NOS: 3 to 6 and fusion peptides according to the invention, whose amino acid sequence is N-terminally a sequence of SEQ ID NO: 3, SEQ ID NO: 4 , SEQ ID NO: 5, or SEQ ID NO: 6.

Beispiel 4: Inhibierung von zAAP durch Lactophorin AExample 4: Inhibition of zAAP by Lactophorin A.

zAAP wurde aus kultivierten Jurkat-Zellen aufgereinigt. zAAP wurde in HEPES-Puffer mit 0,25 mM DTT mit Lactophorin A bei 37°C für 2 h inkubiert. Anschließend wurde das Substrat Ala-Rhodamin110 (R110) zugesetzt und die Hydrolyse nach 60 min spektrometrisch bestimmt.zAAP was purified from cultured Jurkat cells. zAAP was incubated in HEPES buffer with 0.25mM DTT with lactophorin A at 37 ° C for 2h. Subsequently, the substrate Ala-Rhodamin110 (R110) was added and the hydrolysis was determined spectrometrically after 60 min.

Die Ergebnisse sind in 6 gezeigt und machen deutlich, dass Lactophorin A zAAP inhibiert. Für Lactophorin A wurde unter diesen Versuchsbedingungen gegenüber zAAP eine IC50 von > 62,5 μM bestimmt.The results are in 6 and demonstrate that Lactophorin A inhibits zAAP. For lactophorin A, an IC50 of> 62.5 μM was determined under these experimental conditions with respect to zAAP.

Die Hemmung von zAAP konnte auch für die Peptide der Seq.-ID Nrn 3 bis 6 und erfindungsgemäße Fusionspeptide gezeigt werden, deren Aminosäuresequenz N-terminal eine Sequenz der Seq.-ID Nr. 3, Seq.-ID Nr. 4, Seq.-ID Nr. 5 oder Seq.-ID Nr. 6 aufwies.The inhibition of zAAP could also be demonstrated for the peptides of SEQ ID Nos. 3 to 6 and fusion peptides according to the invention, whose amino acid sequence is N-terminal to a sequence of SEQ ID NO: 3, SEQ ID NO: 4, Seq. ID No. 5 or SEQ ID NO: 6.

Beispiel 5: Zytotoxizität von PeptidenExample 5: Cytotoxicity of peptides

Zur Bestimmung der Zytotoxizität erfindungsgemäßer Peptide wurde stellvertretend Lactophorin A in der Lebendfärbung mit Trypanblau (Celltiter-Blue-Test) mit kultivierten U937-Zellen eingesetzt. Die Ergebnisse sind in 7A für Zellen ohne Zusatz gezeigt, für Zellen mit Zusatz von Lactophorin A oder zur Kontrolle mit Natriumazid (Na-Azid) in 7B, jeweils in log 2-Verdünnungsschritten. Das Ergebnis zeigt am Beispiel von Lactophorin A, dass erfindungsgemäße Peptide keine wesentliche zytotoxische Wirkung haben.To determine the cytotoxicity of peptides of the invention, representative Lactophorin A was used in the live staining with trypan blue (Celltiter-Blue test) with cultivated U937 cells. The results are in 7A for cells without additive, for cells supplemented with lactophorin A or for control with sodium azide (Na-azide) in 7B , each in log 2 dilution steps. The result shows, using the example of lactophorin A, that peptides according to the invention have no significant cytotoxic effect.

Beispiel 6: inhibitorische Wirkung der Peptide auf DPP4 in vivoExample 6: Inhibitory effect of the peptides on DPP4 in vivo

Die inhibitorische Wirkung erfindungsgemäßer Peptide gegen DPP4 wurde in Blutplasma einer Ratte, der zuvor ein erfindungsgemäßes Peptid verabreicht worden war, anhand der Hydrolyse eines Substrats der DPP4 gemessen. Als Beispiel für erfindungsgemäße Peptide wurde Lactophorin A in Salzlösung (0,154 M, 0,1% RSA (Rinderserumalbumin)) verwendet. Blutplasma wurde aus einer katheterisierten Ratte nach Fasten über Nacht injiziert (Zeitpunkt 0). Zu den in 8 angegebenen Zeitpunkten wurden Blutproben genommen und heparinisiert. Für die Analyse der Aktivität von DPP4 wurden 100 μL heparinisiertes Blut mit 10 μL 1 M Citratpuffer, pH 3,0 versetzt, zentrifugiert und gekühlt, oder bis zur Analyse bei –20°C gelagert.The inhibitory effect of peptides according to the invention against DPP4 was measured in blood plasma of a rat to which a peptide according to the invention had previously been administered by hydrolysis of a substrate of DPP4. As an example of peptides of the invention, lactophorin A was used in saline (0.154 M, 0.1% BSA (bovine serum albumin)). Blood plasma was injected from a catheterized rat after fasting overnight (time 0). To the in 8th At time points, blood samples were taken and heparinized. For the analysis of the activity of DPP4, 100 μL of heparinized blood were spiked with 10 μL of 1M citrate buffer, pH 3.0, centrifuged and cooled, or stored at -20 ° C until analyzed.

25 mg Lactophorin A wurden in 5 mL 0,1% RSA in der Salzlösung gelöst und zu Aliquots von 500 μL bei –20°C eingefroren. Von dieser Lösung von Lactophorin A wurden 10 μL (0,05 mg) zu den Plasmaproben (ca. 50 μL) zugesetzt. Für den Test wurden 20 μL des mit Lactophorin A versetzten Plasmas mit 80 μL HEPES-Puffer und dem Substrat Gly-Pro-pNA versetzt und nach einer Inkubation von 2 min bei 30°C über 1 min bei 30°C spektrophotometrisch vermessen. Das Ergebnis dieses Tests ist in 8 gezeigt. Es wird deutlich, dass ausgehend von der ursprünglichen Aktivität von 12,28 mU/mL (–10 min und 0 min) DPP4 im Plasma der Ratte die Aktivität von DPP4 durch Injektion von Lactophorin A im Plasma auf 7,46 mU/mL bei 5 und 10 min nach der Injektion vermindert wurde, gefolgt von einem leichten Anstieg auf etwa 9 mU/mL. Die ursprüngliche Aktivität von DPP4 wurde in den 120 min der Beobachtung nicht wieder erreicht. Insgesamt zeigt daher dieses Experiment, dass Lactophorin A DPP4 im Serum um etwa 40% während der ersten 10 min nach der Verabreichung der Injektion inhibierte, gefolgt von einer anschließenden Inhibierung um etwa 25% für die nächsten 110 min. Die Ergebnisse sind in 8 dargestellt. Die Langzeituntersuchung ergab, dass ca. 4 h nach Verabreichung des Peptids die ursprüngliche Aktivität der DPP4 wieder vorhanden war. Daher kann diesem Versuch entnommen werden, dass zumindest in diesen Konzentrationen erfindungsgemäße Peptide die proteolytische Aktivität von DPP4 in vivo innerhalb kurzer Zeit nach Verabreichung, z. B. innerhalb von ca. 10 min hemmen, diese Hemmwirkung für mindestens ca. 110 min effektiv ist, und nach ca. 4 h die Hemmwirkung auf DPP4 beendet ist. Dieses Ergebnis belegt den Vorteil der erfindungsgemäßen Peptide, dass die Hemmwirkung auf die proteolytische Aktivität zumindest von DPP4 zeitlich begrenzt bzw. im Säugerorganismus reversibel ist.25 mg lactophorin A was dissolved in 5 mL 0.1% BSA in saline and frozen to aliquots of 500 μL at -20 ° C. From this solution of Lactophorin A, 10 μL (0.05 mg) was added to the plasma samples (approximately 50 μL). For the test, 20 μL of the Lactophorin A-added plasma was mixed with 80 μL HEPES buffer and the substrate Gly-Pro-pNA and spectrophotometrically measured after incubation for 2 min at 30 ° C for 1 min at 30 ° C. The result of this test is in 8th shown. It can be seen that, starting from the original activity of 12.28 mU / mL (-10 min and 0 min) DPP4 in rat plasma, the activity of DPP4 was reduced to 7.46 mU / mL by injecting Lactophorin A into the plasma and decreased 10 minutes after the injection, followed by a slight increase to about 9 mU / mL. The original activity of DPP4 was not recovered in the 120 min of observation. Overall, therefore, this experiment shows that lactophorin A inhibited DPP4 in serum by about 40% during the first 10 min after the administration of the injection, followed by a subsequent inhibition of about 25% for the next 110 min. The results are in 8th shown. The long-term study revealed that about 4 hours after administration of the peptide, the original activity of DPP4 was restored. Therefore, it can be seen from this experiment that peptides according to the invention, at least in these concentrations, have the proteolytic activity of DPP4 in vivo within a short time after administration, e.g. B. inhibit within about 10 min, this inhibitory effect is effective for at least about 110 min, and after about 4 h the inhibitory effect on DPP4 is completed. This result demonstrates the advantage of the peptides according to the invention that the inhibitory effect on the proteolytic activity of at least DPP4 is limited in time or reversible in the mammalian organism.

Die inhibitorische Wirkung erfindungsgemäßer Peptide konnte am Beispiel von Lactophorin A auch im Plasma einer gesunden Ratte nachgewiesen werden, wenn mit Citratpuffer stabilisiertem Plasma Lactophorin A und Substrat für die DPP4 zugesetzt wurde. Im Einzelnen wurden Blutproben von einer gesunden katheterisierten Ratte genommen, der noch kein erfindungsgemäßes Peptid verabreicht worden war. Aus den Proben wurde wie oben beschrieben Plasma hergestellt und mit Citratpuffer stabilisiert. Als Substrat für die DPP4-Aktivität wurde Gly-Pro-pNA in HEPES-Puffer eingesetzt. Zu einzelnen Serumproben wurde 0,05 mg Lactophorin A zugesetzt. Es konnte gezeigt werden, dass Lactophorin A im Serum die Aktivität von DPP4 von etwa 11,4 mU/mL auf 3,51 mU/mL inhibierte.The inhibitory effect of peptides according to the invention could also be demonstrated in the plasma of a healthy rat on the example of lactophorin A, when plasma stabilized with citrate buffer was added with lactophorin A and substrate for the DPP4. Specifically, blood samples were taken from a healthy catheterized rat to which no peptide of the invention had been administered. Plasma was prepared from the samples as described above and stabilized with citrate buffer. As a substrate for DPP4 activity Gly-Pro-pNA was used in HEPES buffer. Individual serum samples were 0.05 mg lactophorin A added. It could be shown that lactophorin A in the serum inhibited the activity of DPP4 from about 11.4 mU / mL to 3.51 mU / mL.

Vergleichsversuche, bei denen nur Puffer zugesetzt wurde, oder Lactophorin A ohne Citratpuffer zeigten, dass die inhibierende Wirkung von Lactophorin A im Wesentlichen von den Puffersubstanzen unabhängig war.Comparative experiments in which only buffer was added or lactophorin A without citrate buffer showed that the inhibitory effect of lactophorin A was essentially independent of the buffer substances.

In der nachfolgenden Tabelle sind die Versuchsansätze im Einzelnen gezeigt: Aktivität Plasma + 10 μL Citratpuffer Plasma + 10 μL Citratpuffer + 10 μL HEPES-Puffer Plasma + 10 μL Citratpuffer + 0,05 mg Lactophorin A in HEPES-Puffer Plasma + 0,05 mg Lactophorin A ohne Citratpuffer DPP4 (mU/mL) 11,40 10,53 3,51 4,39 ΔE/min 0,013 0,12 0,004 0,005 In the following table the experimental approaches are shown in detail: activity Plasma + 10 μL citrate buffer Plasma + 10 μL citrate buffer + 10 μL HEPES buffer Plasma + 10 μL citrate buffer + 0.05 mg lactophorin A in HEPES buffer Plasma + 0.05 mg lactophorin A without citrate buffer DPP4 (mU / mL) 11.40 10.53 3.51 4.39 AE / min 0,013 0.12 0,004 0.005

Dieser Versuch zeigt, dass erfindungsgemäße Peptide die Aktivität von DPP4 in Plasma von Säugern, denen kein DPP4-Inhibitor verabreicht wurde, inhibiert.This experiment demonstrates that peptides of the invention inhibit the activity of DPP4 in mammalian plasma which has not been administered DPP4 inhibitor.

Beispiel 7: Wirkung der Peptide gegen Fettleibigkeit bei SäugernExample 7: Effect of Peptides Against Obesity in Mammals

Die Wirkung von erfindungsgemäßen Peptiden gegen Fettleibigkeit von Säugern wurde am Beispiel von Lactophorin A gezeigt, das 6 von 12 Mäusen (Balb6) mit einem anfänglichen Gewicht von 20 g oral mit dem Futter verabreicht wurde. Die Mäuse wurden mit Standardfutter und Wasser ad libitum gefüttert. Eine Gewichtskontrolle der Mäuse vor dem Versuch und nach 3 Wochen zeigte, dass die orale Verabreichung von erfindungsgemäßem Peptid das Körpergewicht und vor allem den Teil an Körperfett reduzierte. Für den Versuch wurde 6 Tieren 0,5 mg/kg Lactophorin A pro Tag ins Futter gemischt, 6 Kontrolltiere erhielten keine weiteren Zusätze zum Futter.The effect of peptides against mammalian obesity according to the invention was demonstrated by the example of Lactophorin A administered orally to the feed of 6 of 12 mice (Balb6) with an initial weight of 20 g. The mice were fed standard diet and water ad libitum. Weight control of the mice before and after 3 weeks showed that oral administration of the peptide of the invention reduced body weight and especially body fat. For the experiment, 6 animals were mixed with 0.5 mg / kg lactophorin A per day into the feed, 6 control animals received no further additives to the feed.

Das Ergebnis ist in 9 gezeigt und belegt, dass die Verabreichung von erfindungsgemäßem Peptid unter ansonsten gleichen Fütterungs- und Bewegungsbedingungen zu einer signifikant reduzierten Gewichtszunahme führt, hier am Beispiel von Lactophorin A. Bei den jeweils paarweise angeordneten Balken in 9 steht der jeweils linke Balken für das Endgewicht der Mäuse, denen Lactophorin A verabreicht wurde, und der jeweils rechte Balken für unbehandelte Mäuse.The result is in 9 demonstrated and demonstrated that the administration of peptide according to the invention under otherwise identical feeding and movement conditions leads to a significantly reduced weight gain, here with the example of Lactophorin A. In each paired bars in 9 the leftmost bar represents the final weight of the mice given Lactophorin A and the right one represents the untreated mice.

Die Verminderung der Gesamtgewichtszunahme bei mit erfindungsgemäßem Peptid behandelten Mäusen betrug im Vergleich zu unbehandelten Mäusen unter ansonsten gleichen Bedingungen betrug ca. jeweils 5 g. Anatomische Analysen zeigten, dass die mit erfindungsgemäßem Peptid behandelten Mäuse einen signifikant reduzierten Anteil an Speicherfett aufwiesen, während im übrigen keine wesentlichen anatomischen oder histologischen Veränderungen gegenüber unbehandelten Mäusen festzustellen waren.The reduction in the total weight gain in mice treated with the peptide according to the invention was about 5 g in each case compared to untreated mice under otherwise identical conditions. Anatomical analyzes showed that the mice treated with the peptide according to the invention had a significantly reduced amount of storage fat, whereas, moreover, no significant anatomical or histological changes were found in comparison with untreated mice.

Eine detaillierte histologische Analyse der Versuchstiere ergab, dass die Verabreichung des erfindungsgemäßen Peptids keine Gewebsanomalien, insbesondere keine Neoplasmen zur Folge hatte.Detailed histological analysis of the experimental animals revealed that the administration of the peptide according to the invention did not result in any tissue abnormalities, in particular no neoplasms.

SEQUENCE LISTING

Figure 00160001
SEQUENCE LISTING
Figure 00160001

Figure 00170001
Figure 00170001

Figure 00180001
Figure 00180001

Claims (4)

Verwendung eines Peptids, das eine der Sequenzen SEQ-ID Nr. 1 (Lactophorin A), SEQ-ID Nr. 2 (Lactophorin B) oder SEQ-ID Nr. 7 aufweist, zur Behandlung einer Krankheit, die durch Hemmung der humanen DPP4 therapierbar ist und aus der Gruppe ausgewählt ist, die aus Diabetes mellitus oder Fettleibigkeit besteht.Use of a peptide having one of the sequences SEQ ID No. 1 (lactophorin A), SEQ ID No. 2 (lactophorin B) or SEQ ID No. 7 for the treatment of a disease that is treatable by inhibition of human DPP4 and is selected from the group consisting of diabetes mellitus or obesity. Verwendung nach Anspruch 1, dadurch gekennzeichnet, dass das Peptid auch die Aktivität der humanen APN, der humanen zAAP und/oder der humanen DPP8 und/oder die DPP9 hemmt.Use according to claim 1, characterized in that the peptide also inhibits the activity of human APN, human zAAP and / or human DPP8 and / or DPP9. Verwendung nach einem der voranstehenden Ansprüche, dadurch gekennzeichnet, dass das Peptid zur oralen Verabreichung oder zur Injektion formuliert ist.Use according to any one of the preceding claims, characterized in that the peptide is formulated for oral administration or for injection. Verwendung nach einem der voranstehenden Ansprüche, dadurch gekennzeichnet, dass die Krankheit durch Hemmung der humanen DPP8 und/oder DPP9 behandelbar ist.Use according to any one of the preceding claims, characterized in that the disease is treatable by inhibition of human DPP8 and / or DPP9.
DE102008062136A 2008-12-16 2008-12-16 Pharmaceutical composition based on peptide of camel milk Active DE102008062136B4 (en)

Priority Applications (2)

Application Number Priority Date Filing Date Title
DE102008062136A DE102008062136B4 (en) 2008-12-16 2008-12-16 Pharmaceutical composition based on peptide of camel milk
PCT/EP2009/008768 WO2010072327A2 (en) 2008-12-16 2009-12-08 Pharmaceutical composition based on peptide from camel milk

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
DE102008062136A DE102008062136B4 (en) 2008-12-16 2008-12-16 Pharmaceutical composition based on peptide of camel milk

Publications (2)

Publication Number Publication Date
DE102008062136A1 DE102008062136A1 (en) 2010-06-17
DE102008062136B4 true DE102008062136B4 (en) 2012-05-03

Family

ID=42168685

Family Applications (1)

Application Number Title Priority Date Filing Date
DE102008062136A Active DE102008062136B4 (en) 2008-12-16 2008-12-16 Pharmaceutical composition based on peptide of camel milk

Country Status (2)

Country Link
DE (1) DE102008062136B4 (en)
WO (1) WO2010072327A2 (en)

Families Citing this family (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20150018566A1 (en) 2011-08-25 2015-01-15 The Provost, Fellows, Foundation Scholars, & the Other Members of Board, of The College of the Holy Tubulin binding agents
US9617300B2 (en) 2012-03-09 2017-04-11 Morinaga Milk Industry Co., Ltd. Dipeptidyl peptidase-IV inhibitor
JP6517732B2 (en) * 2016-06-01 2019-05-22 株式会社ニッピ DPP-4 inhibitor, blood sugar level elevation inhibitor and food for inhibiting DPP-4
US10336817B2 (en) 2016-10-14 2019-07-02 Sultan Qaboos University Therapeutic composition of camel milk
CN109645123A (en) * 2018-11-06 2019-04-19 新疆金驼投资股份有限公司 A kind of probiotics JT6 bactrian camel milk compound powder with adjusting lipid metaboli function

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
DE102004040452A1 (en) * 2004-08-20 2006-02-23 N.V. Nutricia peptide mixture
WO2006068840A1 (en) * 2004-12-16 2006-06-29 Bausch & Lomb Incorporated Dot radial ringed placido

Family Cites Families (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
DE04029691T1 (en) 1998-02-02 2007-11-08 Trustees Of Tufts College, Medford Use of dipetidylpeptidase inhibitors to regulate glucose metabolism
DE19828113A1 (en) 1998-06-24 2000-01-05 Probiodrug Ges Fuer Arzneim Prodrugs of Dipeptidyl Peptidase IV Inhibitors
ATE222121T1 (en) * 1998-07-15 2002-08-15 Ursapharm Arzneimittel Gmbh USE OF BROMELAIN PROTEASES TO INHIBIT BLOOD CLOTTING
DE19834591A1 (en) 1998-07-31 2000-02-03 Probiodrug Ges Fuer Arzneim Use of substances that decrease the activity of dipeptidyl peptidase IV to increase blood sugar levels, e.g. for treating hypoglycemia
GB9819137D0 (en) * 1998-09-02 1998-10-28 Cortecs Uk Ltd Component of bromelain
GB9928330D0 (en) 1999-11-30 2000-01-26 Ferring Bv Novel antidiabetic agents
US6395767B2 (en) 2000-03-10 2002-05-28 Bristol-Myers Squibb Company Cyclopropyl-fused pyrrolidine-based inhibitors of dipeptidyl peptidase IV and method
ATE542896T1 (en) * 2004-12-23 2012-02-15 Campina Nederland Holding Bv PROTEIN HYDROLYZATE ENRICHED WITH DPP-IV INHIBITING PEPTIDES AND USE THEREOF
JP4915833B2 (en) * 2005-07-01 2012-04-11 雪印メグミルク株式会社 Dipeptidyl peptidase IV inhibitor

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
DE102004040452A1 (en) * 2004-08-20 2006-02-23 N.V. Nutricia peptide mixture
WO2006068840A1 (en) * 2004-12-16 2006-06-29 Bausch & Lomb Incorporated Dot radial ringed placido

Non-Patent Citations (4)

* Cited by examiner, † Cited by third party
Title
CABA-Abstract 2005:76501 zu Konuspayeva G. [u.a.]: Lactoferrin of camel milk of Kazakhstan. In: Desertification combat and food safety: the added value of camel producers, Ashkabad, Turkmenistan, 19-21 April 2004, (2005) S.158-167 *
CABA-Abstract 2006:192424 zu Wernery,U.: Camel milk, the white gold the desert. In: Journal of Camel Practice and Research, 2006, Vol.13, No.1, S.15-26 *
CABA-Abstract 2008:257088 zu Shabo,Y. [u.a.]: Etiology of Crohn's disease and camel milk treatment. In: Journal of Camel Practice and Research, 2008, Vol.15, No.1, S.55-59 *
Kappeler S. [u.a.]: Alternative Splicing of Lactophorin mRNA from Lactating Mammary Gland of the Camel (Camelus dromedarius). In: J. Dairy Sci. 1999, Vol.82, S.2084-2093 *

Also Published As

Publication number Publication date
DE102008062136A1 (en) 2010-06-17
WO2010072327A3 (en) 2010-12-29
WO2010072327A2 (en) 2010-07-01

Similar Documents

Publication Publication Date Title
EP0885961B1 (en) Novel insulin derivatives with rapid onset of action
DE60012721T2 (en) ANALOGUE OF THE MAGENTA-INHIBITING PEPTIDE AND ITS USE IN THE TREATMENT OF DIABETES
EP1398030B1 (en) Dipeptidyl peptidase IV effectors
DE69737916T2 (en) Use of GLP-1 peptides
DE69737479T4 (en) GLP-1 DERIVATIVES
EP2041169B1 (en) Amidated glargine insulin
DE69722397T2 (en) INSULIN DERIVATIVES AND THEIR USE
DE69719798T2 (en) PERIPHERAL ADMINISTRATION OF GLP-1 ANALOGS AND DERIVATIVES FOR REGULATING OBESITY
DE69936446T2 (en) INOTROPIC AND DIETIC EFFECTS OF EXENDIN AND GLP-1
DE60035987T2 (en) METABOLIC INTERVENTION WITH GLP-1 OR ITS BIOLOGICALLY ACTIVE ANALOGS TO IMPROVE THE FUNCTION OF THE ISCHEMIC AND RECHAPTERED BRAIN
DE3326473A1 (en) PHARMACEUTICAL AGENT FOR TREATING THE DIABETES MELLITUS
EP0140084B1 (en) Process for the preparation of insulin derivatives with a c-terminally elongated b-chain, basically modified insulin derivatives, compositions containing them and their use
DE10150203A1 (en) Use of dipeptidyl peptidase IV inhibitor in treatment of cancer
DE102008003566A1 (en) New insulin analogs useful for treating diabetes
EP2229406A2 (en) Novel insulin derivatives having an extremely delayed time-action profile
DE102008003568A1 (en) New insulin analogs useful for treating diabetes
EP2451471A1 (en) Slow-acting insulin preparations
WO2011003822A2 (en) Insulin preparations containing methionine
WO2009087081A2 (en) Novel insulin derivatives having an extremely delayed time-action profile
DE10154689A1 (en) Substituted amino ketone compounds
DE102008062136B4 (en) Pharmaceutical composition based on peptide of camel milk
EP0427162B1 (en) Novel insulin derivatives, their preparation and use, and a pharmaceutical composition thereof
DE69819488T2 (en) USE OF GLP-2 AGONISTS TO IMPROVE THE EFFECT OF THE UPPER GASTROINTESTINAL TRACT
CH650678A5 (en) PHARMACEUTICAL AGENT FROM HUMAN INSULIN AND HUMAN PROINSULIN.
CH650679A5 (en) AGAINST DIABETES MELLITUS ACTIVE PHARMACEUTICAL AGENT.

Legal Events

Date Code Title Description
OP8 Request for examination as to paragraph 44 patent law
R016 Response to examination communication
R016 Response to examination communication
R018 Grant decision by examination section/examining division
R081 Change of applicant/patentee

Owner name: KAMAMED GMBH, DE

Free format text: FORMER OWNER: KAMAMED UG, 30539 HANNOVER, DE

Effective date: 20120628

R082 Change of representative

Representative=s name: PFENNING MEINIG & PARTNER GBR, DE

Effective date: 20120628

Representative=s name: PFENNING, MEINIG & PARTNER MBB PATENTANWAELTE, DE

Effective date: 20120628

R020 Patent grant now final

Effective date: 20120804