CN1541226A

CN1541226A - Antibodes specific for CD44V6

Info

Publication number: CN1541226A
Application number: CNA028101561A
Authority: CN
Inventors: I; 冈瑟·阿道夫; 埃林伯格·奥斯特曼; 埃里克·帕特泽尔特; 马利斯·斯普罗尔; ��ġ��; 卡尔-海因茨·海德; J; 约翰·J·米格利塔; ��Ŧ˹��A��M��S��Ƹ�; 奥古斯蒂纽斯·A·M·S·范唐根
Original assignee: Boehringer Ingelheim International GmbH; Boehringer Ingelheim Pharmaceuticals Inc
Current assignee: Boehringer Ingelheim International GmbH; Boehringer Ingelheim Pharmaceuticals Inc
Priority date: 2001-05-18
Filing date: 2002-05-17
Publication date: 2004-10-27
Also published as: EP1397387A1; WO2002094879A1; PL365735A1; YU91403A; SK15592003A3; BR0210905A; CZ20033476A3; AR036154A1; EE200300569A; CA2443437A1; EA200301169A1; MXPA03010523A; HUP0400030A3; PE20021098A1; ECSP034838A; ZA200307365B; JP2005504517A; HUP0400030A2

Abstract

The present invention belongs to the field of oncology. The invention relates to antibodies with specified sequence which are specific for an epitope which is coded by the variant exon v6 of the CD44 gene and to derivatives of said antibody. The invention also provides nucleic acid molecules encoding said antibody proteins. The invention furthermore pertains to methods for producing said antibody proteins. The invention also provides pharmaceutical compositions comprising said antibody proteins. The invention furthermore is concerned with the use in the manufacture of a medicament for the treatment of cancer.

Description

The specific antibody of CD44v6

Technical field

The invention belongs to oncology. The present invention is the antibody that relevant tool spy shows sequence, its be the coded epi-position tool specificity of CD44 genetic mutation extron v6, and the derivative of relevant this antibody. The present invention's also propose to encode nucleic acid molecules of this antibody protein. The present invention further is the method for relevant this antibody protein of preparation. The present invention also proposes to contain the pharmaceutical composition of this antibody protein. The present invention moreover be that the relevant medicine of making is with the usage for the treatment of cancer.

Background technology

In recent years illustrate, for causing so-called non-metastatic pancreas in rat JEG-3 and the autonomous displacement behavior of non-metastatic rat fibrosarcoma cell strain, the expression of surface glycoprotein CD44 variant is necessary and enough. (Gunthert et al., 1991). And minimum CD44 homotype, standard type CD44s (or CD44std), wide expression is in comprising epithelial different tissues, some CD44 splice variant (CD44v, CD44var) is only expressed at a certain subgroup epithelial cell. The CD44 variant is produced by other montage, and its mode is so that the sequence of 10 extrons (v1-v10) fully excision in CD44s but can appear at (Screation et al., 1992 in the variant larger under the various combination; Tolg et al., 1993; Hofmann et al., 1991). Amino acid sequence has different variant, and some position of part embeds outside albuminous cell. This variant in various human tumor cells and mankind tumor tissue, can survey and. So, the expression of CD44 variant recent studied in the process of the carcinogenic principle of colorectum (Heider et al., 1993a). The expression of CD44 variant does not exist in the normal human subject colonic epithelium, and only can survey and weak expression in gland nest proliferative cell. In the late phase of tumour progression, as in gland cancer, all malignant cells all can give expression to the CD44 variant. The high-caliber tissue expression of variant CD44 also bear down menacingly non--(Koopman et al., 1993) appear in the hodgkin's lymphomas.

As if extron v6 especially play the part of special role in shifting the process of scattering. (Rudy et al., 1993). In animal model, grow up to (Seiter et al., 1993) that the antibody of anti-v6 specific epitopes can prevent the fixing of transitional cell and shift thing. In colon cancer, v6 expresses and tumour progression mutual relevant (Wielenga et al., 1993). In cancer of the stomach, it is an important diagnosis target that v6 expresses, and visible peristalsis visible intestinal peristalsis tumour and diffused can be distinguished (Heider et al., 1993b). In rear two publications, it is to utilize the antibody of anti-v6 specific epitopes to determine that v6 expresses.

Be a kind of antigen relevant with tumour because CD44v6 has illustrated, in human tumor and normal structure, advantageously express (Herder et al., 1995; Heider et al., 1996), therefore can be applicable to take antibody-for (Heider et al., 1996 on basic diagnosis and the methods for the treatment of; WO 95/33771; WO 97/21104).

Have serious problems and occur when utilizing the non-human antibody to be applied to human body, namely it can generate human resisting-non--mankind's reaction very rapidly, can lower antibody in patient's effectiveness, and destroys the administration that continues. For overcoming this problem, in technology, develop " humanization " non--idea of human antibodies. In first approach, constructed the non--mankind/chimeric human antibody, attempt the humanization non-human antibody, wherein non--human variable region is connected to human constant region (Boulianne G.L., Hozumi N.and Shulman, M.J. (1984) Production of functional chimeric mouse/human antibody Nature 312:643). The chimeric antibody that so generates is possessed originally binding specificity and the affinity of non--human antibodies. Yet, chimeric antibody, although significantly be better than mouse antibodies, still can in the mankind, induce out anti--chimeric reaction (LoBuglio A.F., Wheeler R.H., Trang J., Haynes A., Rogers K., Harvey E.B., Sun L., Ghrayeb J.and Khazaeli M.B. (1989) Mouse/human chimeric monoclonal antibody in man:Kinetics and Immune response.Proc.Natl.Acad.Sci.86:4220). This approach by further minimizing non--human sequence's amount and obtain concise, be about to complementarity-determining region (CDRs) grafting from non--human variable region to human variable region, again these " mankind of transformation " variable regions are connected to human constant region (Riechmann L., Clark M., Waldmann H.and Winter G. (1988) Reshaping human antibodies for therapy.Nature 332:323). The human antibodies CDR-grafting or that transform contain few or there is no protein sequence can be identified in derived from the mouse-anti body. Although humanized antibody still can induce some immune response by the CDR-grafting, such as anti--allograft (anti-allotype) or anti--idiotype (anti-idiotypic) reaction (even using natural human antibodies also to can be observed these reactions), the antibody mediated immunity originality of CDR-grafting significantly is lower than mouse antibodies, therefore to patient the treatment that more prolongs can be arranged.

Yet, can not generate the antibody of enough binding affinities when realizing soon independent CDR-grafting. CDR-grafted antibody and its parental generation be non--and human antibodies is relatively more lower, and quite not good binding characteristic is arranged, and this is because also have more amino acid to be involved in antigen in conjunction with event except the amino acid in CDR ' s. Therefore, the CDR-grafted antibody that binding affinity is not good can't be considered as useful in treatment. Therefore, attempt generating the antibody that combination has CDR-grafted antibody reduced immunogenicity and non--human parental generation antibody good combination characteristic. Therefore except the CDR-grafting, also develop a conception of species, namely must keep as the residue of rodent donor source at one in the humanization framework region to several amino acid, to possess binding affinity (Queen et al., (1989) Proc.Natl.Acad.Sci.86:10029-10033).

Because highly potential value, this antibody can be applicable to diagnosis and treatment, therefore need there be tool to improve the antibody of characteristic, it is applicable to the treatment of human cancer.

Basic problem of the present invention provides to compare with known CD44v6 specific antibody the significantly antibody of better characteristic.

Summary of the invention

Above technical problem can be solved by the specific embodiments of identifying in claims and the specification. By claims of the present invention and specification, can overcome shortcoming above-mentioned in the technology.

In order to address the above problem, the present inventor designs and produces the special humanized antibody of a kind of CD44v6, is called BIWA8, and it has CDR-grafting and framework sudden change, and the reduced immunogenicity combination is arranged with high-affinity.

Yet the present inventor can generate to have even the antibody of more super treatment value, is called BIWA4. Although and BIWA8 is relatively lower, this person has relatively poor binding affinity, when it can better bio distribution and the tumour of surprising demonstration absorb during in administration in vivo.

The invention belongs to oncology. The present invention is the antibody that relevant tool spy shows sequence, its with by the coded epi-position tool specificity of CD44 genetic mutation extron v6, and relevant for the derivative of this antibody. The present invention also provides the nucleic acid molecules of this antibody protein of coding. The present invention further is the method for relevant this antibody protein of preparation. The present invention also provides the pharmaceutical composition that contains this antibody protein. The present invention further is the relevant usage of making the drug therapy cancer.

The accompanying drawing summary

(also seeing embodiment 1)

Fig. 1: the assessment of the RA of in competitive cell ELISA, testing. The concentration of IC50:cMAb and hMAbs, this moment, mMAb BIWA1 was bonded to the A431 Leukopenia 50% through adhering to. IC50 value with respect to BIWA2 also is shown among the figure.

Fig. 2: HNX-OE heterograft-mouse, under 3 or 4 days p.i., altogether injection¹²⁵I-reaches¹³¹The bio distribution of the CD44v6-specificity MAbs of I-mark (10 micromicrocuries, 50 micrograms). Three groups of mouse, or acceptance (A)¹³¹I-U36 (black line) reaches¹²⁵I-BIWA1 (shade) (n=5), (B)¹³¹I-BIWA4 (black line) reaches¹²⁵I-BIWA2 (shade) (n=6) or accept (C)¹³¹I-BIWA4 (black line) reaches¹²⁵I-BIWA8 (shade) (n=6). Behind injection 3 (A) or 4 days (B, C), to the mouse blood sampling, put to death, dissect and the assessment tumour, the radioactivity level in blood and the many organs (the %ID/ gram ± s.e.m.). (Blk: blood, Tum: tumour, Liv: liver, Spl: spleen, Kid: kidney, Hrt: the heart, Stm: stomach, Ilm: ileum, Cln: colon, Blr: bladder, Str: breastbone, Msc: muscle, Lng: lung, Skn: skin, Tng: tongue).

Fig. 3: in HNX-OE heterograft-nude mice,¹⁸⁶The treatment of the special MAbs of CD44v6-of Re-mark is renderd a service. Mouse is accepted 300 micromicrocuries¹⁸⁶Re-U36 (--, figure A), 300 micromicrocuries¹⁸⁶Re-BIWA 1 (--, figure A), 300 micromicrocuries¹⁸⁶Re-BIWA 4 (--, figure B), 300 micromicrocuries¹⁸⁶Re-BIWA 2 (--, figure B), 400 micromicrocuries¹⁸⁶Re-BIWA4 (--, figure C), 400 micromicrocuries¹⁸⁶Re-BIWA8 (--, figure C), or salt solution (--, figure A, B, C) be control group. Control group is identical in figure A and B, the mean tumour volume of tumor size during with treatment (± s.e.m.) represent it with respect to the mean tumour volume at the beginning for the treatment of.

Fig. 4: BIWA 4 intravenous fluids to 10 patient, in the A part Study, the correlation between the MAb dosage of institute's administration and observed AUC.

Fig. 5: BIWA 4 intravenous fluids to 10 patient, in the A part Study, the correlation between the MAb dosage of institute's administration and observed maximum blood plasma BIWA 4 concentration.

The preferred embodiment of the invention

In specific embodiments of the present invention, must be noted that to reach in this shown in the appended claims, symbol " a ", " an " reach " the " unless shown in comprising that the plural number content directly has in addition. Therefore, comprise the plural number of this antibody such as " a kind of antibody ", and " cell " is more than one cell, and its equivalent well known by persons skilled in the art etc. Unless in addition to some extent definition, used all technology and scientific terminology all have and belong to the general apprehensible identical definition of those skilled in the art of the present invention in this. Carry out or test the present invention in, although similar or be equivalent to any method described in this and material all can use, better method, device and material are described at present. All publications described in this are based on describing and disclosing cell line, and the purpose of carrier and method has been classified this case reference as, and above cell line, carrier and method are to be reported in the publication, can cooperate the present invention to use. Can be used as the restriction of license in this without one, i.e. the present invention not vest right can expect this announcement via previous invention.

So-called " antibody molecule " or " antibody protein " or " antibody " in this used being considered as is equal to.

" complementarity-determining region of monoclonal antibody " is interpreted as those amino acid sequences that relate to the antigen-specific combination, such as (Kabat E.A. as described in the Kabat, Wu T.T., Perry H.M., Gottesman K.S. and Foeller C. (1991) Sequences of Proteins of Immunological Interest (5^thEd.) NIH Publication No.91-3242.U.S.Department of Health and Human Services, Public Health Service, National Institutes of Health, Bethesda, MD.) and Chothia and described (Chothia and Lesk (1987) J.Mol.Biol. of Lesk196：901-917)。

Used in this, " framework modification " refers to around each complementarity-determining region in the variable region, single or multiple amino acid whose exchange, disappearance or add. Framework is modified the immunogenicity for antibody protein, and productibility or binding specificity are influential.

The invention provides the antibody molecule that contains variable region of heavy chain, be characterized as amino acid sequence in the SEQ ID No.1 definition, or its fragment, allele variant, functional variant, glycosylation variant, fusion molecule or chemical derivative. Antibody BIWA 4 and BIWA 8 contain variable region of heavy chain, are characterized as the amino acid sequence of SEQ ID No.1.

" fragment " is a kind of short antibody molecule according to the present invention, i.e. any polypeptide subgroup, and short nucleic acid molecules of nucleic acid molecules of following discloses is coded thus to be characterised in that it, yet still possesses its antibody binding activity.

Foundation antibody molecule of the present invention " functional variant " is the antibody molecule with biologically active (or on function or on the structure), this biologically active is similar in fact antibody molecule of the present invention, that is, the in fact similarly cracking of substrate (substrate) specificity or substrate. So-called " functional sex change " also comprises " fragment ", " allele variant ", " functional variant ", " be basic variant according to the degenerate core acid code " or " chemical derivative ". This " functional variant " as, can carry one or more point mutation, one or more nucleic acid exchanges, disappearance or embed, or one or more amino acid exchanges, disappearance or embed. This functional variant is still possessed its biologically active, and is such as antibody binding activity, at least part of or even with this bioactive improvement.

" the functional variant " of antibody molecule is the antibody molecule with biologically active (or on function or on the structure) according to the present invention, this biologically active is similar in fact according to antibody molecule of the present invention, that is, in fact similarly the combination of target molecules is active. So-called " functional variant " also comprises " fragment ", " allele variant ", " functional variant ", " take the variant of degenerate core acid code as the basis " or " chemical derivative ".

" allele variant " is because the variant due to the allelic variation, such as the difference on human two allele. This variant is still possessed its biologically active, and is in conjunction with activity, at least part of or even with this bioactive improvement such as the antibody target target.

The variant that " take the degeneracy of the genetic code variant as the basis " is due to the fact that, it is coded that namely some amino acid can be many different nucleotide triplets. This variant is still possessed its biologically active, and is such as antibody binding activity, at least part of or even with this bioactive improvement.

" fusion molecule " can be antibody molecule according to the present invention and merges to reporter molecules, such as radioactively labelled substance, and chemical molecular such as toxin or fluorescent labelling thing, or other any molecules as known in the art.

Used in this, " chemical derivative " is according to antibody molecule of the present invention according to the present invention, and through chemical modification or contain extra chemical part, and this chemical part is not the part of this molecule usually. This part can be improved the activity of molecule, maybe can improve its solubility, absorption, biological half-life etc. such as the destruction (such as the kill tumor cell) of target.

If two molecules have basic similarly structure or biologically active, then this molecule and another molecule are " substantially similar ". Therefore, if two molecules have similar activity, it can be considered variant, term as used in the present invention, if even the structure of one of molecule do not see another molecule, if or the sequence of amino acid residue not identical.

For many purposes of antibody of the present invention, hope can have minimum possible antigen-combination, i.e. CD44v6-bonding unit. Therefore in another better specific embodiments, be Fab fragment (Fab=Fab) according to antibody protein of the present invention. These CD44v6-specific antibody protein comprise the variable region of two chains, and it is connected by adjacent constant region. These can be formed by protease hydrolytic, as utilize pepsin, and hydrolysis is from traditional antibody, but similarly the Fab fragment also can be utilized the genetic engineering method preparation. In another better specific embodiments, be F (ab ') 2 fragments according to antibody protein of the present invention, it can be prepared by the capable proteolysis of pepsin.

Utilize genetic engineering method, might be able to produce the antibody fragment of weak pointization, it only contains the variable region (VH) of heavy chain, and the variable region (VL) of light chain. These are referred to as Fv fragment (fragment of variable region fragment=variable part). In another better specific embodiments, be this Fv fragment according to CD44v6-specific antibody molecule of the present invention. Because these Fv-fragments lack two chain covalency bonds by the cysteine of constant chain, the Fv fragment often is stable. With the variable region of heavy chain and light chain with a small peptide fragment, at 10 to 30 amino acid, better 15 amino acid, connection is useful. In this way, can obtain being formed by VH and VL, by the single peptide chain of peptide connexon connection. Known strand-the Fv of the antibody protein of this type (scFv). By this type scFv-antibody protein example known in the prior art, be set forth in Huston et al. (1988, PNAS 16:5879-5883). Therefore, in another better specific embodiments, be strand-Fv protein (scFv) according to CD44v6-specific antibody protein of the present invention.

In recent years, scFv is prepared into the polymer derivative and has developed various strategies. This particularly can generate recombinant antibodies, has improved pharmacokinetics and bio distribution characteristic, and have increase in conjunction with affinity. In order to reach the multimerization of scFv, scFv is prepared into the fused protein of multimerization functional domain. The multimerization functional domain can be the CH3 zone such as IgG, or helical form coil structure (helical structure), such as leucine-slide fastener functional domain. Yet, also have a kind of strategy be reciprocation with the VH/VL interval of scFv be used for multimerization on (such as two-, three-and five yuan of antibody (pentabodies)). Therefore, in another better specific embodiments, be the special diploid antibody of CD44v6-(diabody) fragment according to antibody protein of the present invention. And diploid, those skilled in the art represent it is the same dimerization scFv derivative (Hu et al., 1996, PNAS 16:5879-5883) of divalence. Connexon in the scFv molecule is foreshortened to 5-10 amino acid, can cause the formation of homodimer, the VH/VL-that interchain wherein can occur is overlapping. Diploid can be stablized by including in of disulfide bond bridge in addition. Diploid of the prior art-antibody protein example is found in Perisic et al. (1994, Structure 2:1217-1226).

And corpusculum (minibody), the person represents it is divalence to be familiar with the technique, with the scFv derivative of dimerization. It is comprised of fused protein, and this fusion contains immunoglobulin (Ig), better is IgG, the CH3 of IgG1 zone preferably, and as the dimerization zone, it is via hinge area (as also from IgG1) and connect the subarea and be connected to scFv. Disulfide bond bridge in hinge area forms in more high cell mostly, but not at prokaryotic. In another better specific embodiments, be CD44v6-specificity corpusculum antibody fragment according to antibody protein of the present invention. Corpusculum in the prior art-antibody protein example is found in Hu et al. (1996, Cancer Res.56:3055-61).

And triplet (triabody), those skilled in the art represent it is the scFv derivative (Kortt et al.1997 Protein Engineering 10:423-433) of trivalent trimerization. The scFv derivative, wherein VH-VL directly merges under without the connexon sequence, generates tripolymer.

Those skilled in the art also know so-called little antibody (miniantibody), and it has two, three, or the tetravalence structure, and are derived from scFv. The multimerization effect is by two, three, or the coil structure of quaternary spiral is carried out (Pack et al., 1993 Biotechnology 11:1271-1277; Lovejoy et al.1993 Science 259:1288-1293; Pack et al., 1995 J.Mol.Biol.246:28-34).

Therefore in better specific embodiments, be take the CD44v6-special poly molecule of above-mentioned antibody fragment as the basis according to antibody protein of the present invention, and can be such as triplet, the little antibody of tetravalence, or penton.

In a better specific embodiments, the present invention is relevant antibody molecule, and wherein the variable region of heavy chain is comprised of the amino acid sequence of SEQ ID No.1.

In another better specific embodiments, the present invention is the relevant antibody molecule that contains variable region of light chain, be characterized as amino acid sequence such as SEQ ID No.2 defines, or the fragment of this antibody molecule, allele variant, functional variant, glycosylation variant, fusion molecule or chemical derivative. Antibody BIWA 4 is the used variable region of containing light chain in this, such as in the SEQ ID No.2 amino acid sequence definition.

In another better specific embodiments, the present invention is relevant antibody molecule, and wherein the variable region of light chain is comprised of the amino acid sequence of SEQ IDNo.2.

In another better specific embodiments, the present invention is the relevant antibody molecule that contains variable region of light chain, be characterized as amino acid sequence such as SEQ ID No.3 defines, or the fragment of this antibody molecule, allele variant, functional variety, glycosylation variant, fusion molecule or its chemical derivative. Antibody BIWA 8 contains the variable region of light chain, is characterised in that the amino acid sequence of SEQ ID No.3.

In another better specific embodiments, the present invention is relevant antibody molecule again, and wherein the variable region of light chain is comprised of the amino acid sequence of SEQ ID No.3.

In another better specific embodiments, the present invention is relevant to antibody molecule of the present invention, the variable region of containing heavy chain is characterized as such as defined amino acid sequence among the SEQ ID No.1, and contains the variable region of light chain, be characterized as the defined amino acid sequence such as SEQ ID No.2, or the fragment of this antibody molecule, allele variant, functional variant, glycosylation variant, fusion molecule or chemical derivative. Antibody BIWA 4 contains the variable region of heavy chain, is characterised in that the amino acid sequence of SEQ ID No.1, and defined in the variable region of light chain such as the SEQ ID No.2 amino acid sequence.

In best specific embodiments, the present invention is relevant antibody molecule according to invention, and wherein the variable region of heavy chain is comprised of the amino acid sequence of SEQ ID No.1, and wherein the variable region of light chain is comprised of the amino acid sequence of SEQ ID No.2.

In another better specific embodiments, the present invention is relevant to antibody molecule of the present invention, the variable region of containing heavy chain, be characterized as amino acid sequence in the SEQ ID No.1 definition, and contain the variable region of light chain, be characterized as such as defined amino acid sequence among the SEQ ID No.3, or the fragment of this antibody molecule, allele variant, functional variant, glycosylation variant, fusion molecule or chemical derivative. Antibody BIWA 8 contains the variable region of heavy chain, is characterised in that the amino acid sequence of SEQ ID No.1, and the variable region of light chain, such as in the SEQ ID No.3 amino acid sequence definition.

In another best specific embodiments, the present invention is relevant antibody molecule according to invention, and wherein the amino acid sequence of SEQ ID No.1 is contained in the variable region of heavy chain, and wherein the amino acid sequence of SEQ ID No.3 is contained in the variable region of light chain.

In another better specific embodiments, the present invention is relevant antibody molecule, contain by the coded variable region of heavy chain of defined nucleotide sequence among the SEQ ID No.4, or the fragment of this antibody molecule, allele variant, functional variant is take variant, fusion molecule or the chemical derivative of degenerate core acid code as the basis. Antibody BIWA 4 and BIWA 8 contain the variable region of heavy chain, are characterized as the nucleotide sequence of SEQ ID No. 4.

In another better specific embodiments, the present invention is relevant antibody molecule, and wherein the variable region of heavy chain is that the defined nucleotide sequence of SEQ ID No.4 is coded.

In another better specific embodiments, the present invention is the variable region that relevant antibody contains light chain, for defined nucleotide sequence among the SEQ ID No.5 coded, or the fragment of this antibody molecule, allele variant, functional variant is take variant, fusion molecule or the chemical derivative of degenerate core acid code as the basis. Antibody BIWA 4 is used for this and comprises the variable region of light chain, defines such as SEQ ID No.5 nucleotide sequence.

In another better specific embodiments, the present invention is relevant antibody molecule, and wherein the variable region of light chain is that the defined nucleotide sequence of SEQ ID No.5 is coded.

In another better specific embodiments, the present invention is relevant antibody molecule, contain by the coded variable region of light chain of the defined nucleotide sequence of SEQ ID No.6, or the fragment of this antibody molecule, allele variant, functional variant is take variant, fusion molecule or the chemical derivative of degenerate core acid code as the basis. Antibody BIWA 8 contains the variable region of light chain of SEQ ID No.6 nucleotide sequence.

In another better specific embodiments, the present invention is relevant antibody molecule, and wherein the variable region of light chain is that the defined nucleotide sequence of SEQ ID No.6 is coded.

In another better specific embodiments, the present invention is that relevant foundation antibody molecule of the present invention (contains the coded variable region of heavy chain of promising SEQ ID nucleotide sequence that No.4 defines, and such as SEQ ID No. 5 the coded variable region of light chain of definition nucleotide sequence), or its fragment, allele variant, functional variant is take variant, fusion molecule or the chemical derivative of degeneracy nucleic acid password as the basis. Antibody BIWA 4 contains the variable region of heavy chain, is characterised in that the nucleotide sequence of SEQ ID No.4, and such as defined variable region of light chain in the SEQ ID No.5 nucleotide sequence.

Again in another best specific embodiments, the present invention is relevant to antibody molecule of the present invention, wherein the variable region of heavy chain is that the defined nucleotide sequence of SEQ ID No.4 is coded, and wherein the variable region of light chain is coded by the defined nucleotide sequence of SEQ ID No.5.

In another better specific embodiments, the present invention is that relevant foundation antibody molecule of the present invention (contains by the coded variable region of heavy chain of defined nucleotide sequence among the SEQ ID No.4, and contain by the coded variable region of light chain of SEQ ID nucleotide sequence that No.6 defines), or its fragment, allele variant, functional variant is take variant, fusion molecule or the chemical derivative of degeneracy nucleic acid password as the basis. Antibody BIWA 8 contains the variable region of heavy chain, is characterised in that the nucleotide sequence of SEQ ID No.4, and such as defined variable region of light chain in the SEQ ID No.6 nucleotide sequence.

In another best specific embodiments, the present invention is relevant to antibody molecule of the present invention, wherein the variable region of heavy chain is that the defined nucleotide sequence of SEQ ID No.4 is coded, and wherein the variable region of light chain is that the defined nucleotide sequence of SEQ ID No.6 is coded.

For producing humanized CD44v6-specific antibody protein, the nucleotide sequence that discloses can be expressed (seeing below and example) by molecular biology method as known in the art.

The variable region of antibody protein of the present invention is connected at least part of constant region for immunoglobulin (Fc), normally the constant region of human immunoglobulin usually. Human constant region dna sequence dna can separate in the various kinds human cell according to knowing step, but better is Immortalized B cell (see Kabat et al., hereinafter, reach WO 87/02671). Therefore, antibody protein of the present invention can contain all or the constant region of part only, as long as the combination that it can be special with the CD44v6 antigen presentation. The selection of constant region type and scope according to effector function why and decide, such as complement fixation or ADCC, and the pharmacological property of wanting to ask according to antibody protein and deciding. Normally a kind of tetramer of antibody protein of the present invention contains two light chain/heavy chains pair, but also can be dimer, namely contains a light chain/heavy chain pair, such as Fab or Fv fragment.

Therefore, be relevant to antibody protein of the present invention in the further specific embodiments of the present invention, be characterised in that it has variable light chain district and variable heavy chain district, is connected to human constant region separately. In special words, the variable region of light chain is connected to human κ constant region, and the variable region of heavy chain is connected to human γ-1 constant region. Also can be the expert for chimeric other human constant regions light and heavy chain uses.

Known method can reach the humanization effect of rodent antibody variable region in this area. EP 0239400 discloses the CDRs grafting of the muroid variable region framework to human variable region. WO 90/07861 discloses the method for the variable region of transforming the CDR-grafting, is to introduce extra framework to modify. WO 92/11018 discloses the method for preparing humanization Ig, is the receptor's framework composition with donor CDRs and donor frame height homology. WO 92/05274 discloses the preparation of the antibody of the framework sudden change that starts from rodent antibody. Turn into relevant other prior art with reference to having with muroid monoclonal antibody human source: EP 0368684; EP 0438310; WO 92/07075, or WO 92/22653.

In another better specific embodiments, the present invention is relevant to antibody molecule of the present invention, it is characterized in that the variable region of light chain and the variable region in heavy chain district are connected to respectively human constant region separately.

In another better specific embodiments, the present invention is relevant to antibody molecule of the present invention, and wherein the human constant region of this light chain is human κ constant region.

In another better specific embodiments, the present invention is relevant to antibody protein of the present invention, and wherein the human constant region of this heavy chain is IgG 1 constant region.

The preferably also has the antibody that contains heavy chain, is characterised in that the amino acid sequence of SEQ ID No.7 and/or light chain are characterised in that the amino acid sequence of SEQ ID No.8, or is characterised in that the amino acid sequence of SEQ ID No.9.

Therefore, another important specific embodiments is according to antibody molecule of the present invention, contain heavy chain and be characterised in that the defined amino acid sequence of SEQ ID No.7, and contain light chain and be characterised in that the defined amino acid sequence of SEQ ID No.8, or the fragment of this antibody molecule, allele variant, functional variant, glycosylation variant, fusion molecule or chemical derivative. Antibody BIWA 4 contains heavy chain, is characterised in that the amino acid sequence of SEQ ID No.7, and the variable region of light chain, defines such as SEQ ID No.8 amino acid sequence.

In best specific embodiments, the present invention is that relevant heavy chain wherein contains the amino acid of SEQ ID No.7 amino acid sequence according to antibody molecule of the present invention, and wherein light chain contains the amino acid of SEQ ID No. eight amino acid sequence. Antibody BIWA4 contains the sequence (heavy chain) that discloses in the SEQ ID No.7 amino acid sequence and the amino acid sequence (light chain) of SEQ ID No.8. BIWA4 is a kind of antibody of CDR-grafting, frameless modification. Surprisingly, except low binding affinity, this antibody contains splendid treatment to be renderd a service, and better bio distribution and tumour absorb, and surpass the antibody BIWA 8 (seeing example) of framework-sudden change. This is the humanization version of above-mentioned antibody VFF-18 (=BIWA 1), has the complementarity-determining region of muroid monoclonal antibody VFF-18 in complete people's class framework, and a human constant region. Therefore it is the antibody of tool utmost point reduced immunogenicity in human body, has favourable feature. Yet, because its nothing makes the combination of antigen more attain perfect muroid framework residue, the remarkable lower antigen-binding affinity than its parental generation antibody VFF-18 is arranged, and the curative drug candidate that therefore is not considered to be. Unexpectedly, found BIWA4 except its not good binding affinity, had bio distribution and tumour absorption in the extremely useful body, made it more be better than other humanization versions of the VFF-18 with higher binding affinity.

Another important specific embodiments is that (containing heavy chain is characterised in that such as defined amino acid sequence among the SEQ ID No.7 according to antibody molecule of the present invention, and contain light chain, be characterized as defined amino acid sequence among the SEQ ID No. 9), or its fragment, allele variant, functional variant, glycosylation variant, fusion molecule or chemical derivative. Antibody BIWA 8 contains heavy chain, is characterised in that the amino acid sequence of SEQ ID No.7, and the variable region of light chain, defines such as SEQ ID No.9 amino acid sequence.

In best specific embodiments, the present invention is that relevant wherein heavy chain contains the amino acid of SEQ ID No.7 amino acid sequence according to antibody molecule of the present invention, and wherein light chain contains the amino acid of SEQ ID No.9 amino acid sequence. Antibody BIWA 8 contains the sequence (heavy chain) that discloses in the SEQ ID No.7 amino acid sequence, and the amino acid sequence (light chain) of SEQ ID No.9. BIWA 8 is a kind of antibody of CDR-grafting, and the framework sudden change is arranged. This antibody has the 4 remarkable higher binding affinities (seeing example) than BIWA.

Better also is such antibody, and it contains by the coded heavy chain of SEQ ID No.10 nucleotide sequence and/or by the coded light chain of SEQ ID No.11 nucleotide sequence, or is characterised in that the nucleotide sequence of SEQ ID No.12. This sequence comprises non-translated sequence, and targeting sequencing is as being cloned among the carrier pAD-CMV1/pAD-CMV19.

Therefore, another important specific embodiments is according to antibody molecule of the present invention, contain the coded heavy chain of promising SEQ ID nucleotide sequence that No.10 defines, and contain just like the coded light chain of SEQ ID nucleotide sequence that No.11 defines, or the fragment of this antibody molecule, allele variant, functional variant, take variant, fusion molecule or the chemical derivative of degeneracy nucleic acid password as the basis. Antibody BIWA 4 contains just like the coded heavy chain of SEQ ID No.10 nucleotide sequence, and such as the coded variable region of light chain of SEQ ID No.11 nucleotide sequence.

In best specific embodiments, the present invention is relevant to antibody molecule of the present invention, and wherein heavy chain is that SEQ ID No.10 nucleotide sequence is coded, and wherein light chain is that SEQ ID No.12 nucleotide sequence is coded. Another important specific embodiments is (to contain just like the coded heavy chain of the defined nucleotide sequence of SEQ ID No.10 according to antibody molecule of the present invention, and contain the light chain just like SEQ ID nucleotide sequence that No.12 defines), or its fragment, allele variant, functional variant, take variant, fusion molecule or the chemical derivative of degeneracy nucleic acid password as the basis. Antibody BIWA 8 contains just like the coded heavy chain of SEQ ID No.10 nucleotide sequence, and the coded variable region of light chain of SEQ ID No.12 nucleotide sequence.

In best specific embodiments, the present invention is relevant to antibody molecule of the present invention, and wherein heavy chain is that SEQ ID No.10 nucleotide sequence is coded, and wherein light chain is coded by SEQ ID No.12 nucleotide sequence.

Preferably such antibody, it contains the coded heavy chain of SEQ ID No.13 nucleotide sequence and/or by the light chain of SEQ ID No.14 nucleotide sequence, or is characterised in that the nucleotide sequence of SEQ ID No.15. This sequence comprises the targeting sequencing that is cloned among the carrier N5KG1val.

Therefore, another important specific embodiments is (to contain the coded heavy chain of promising SEQ ID nucleotide sequence that No.13 defines according to antibody molecule of the present invention, and contain the light chain just like SEQ ID nucleotide sequence that No.14 defines), or its fragment, allele variant, functional variant is take variant, fusion molecule or the chemical derivative of degeneracy nucleic acid password as the basis. Antibody BIWA4 contains just like the coded heavy chain of SEQ ID No.13 nucleotide sequence, and the coded variable region of light chain of SEQ ID No.14 nucleotide sequence.

In best specific embodiments, the present invention is relevant to antibody molecule of the present invention, and wherein heavy chain is that SEQ ID No.13 nucleotide sequence is coded, and wherein light chain is that SEQ ID No.14 nucleotide sequence is coded.

Another important specific embodiments is (to contain just like the coded heavy chain of the defined nucleotide sequence of SEQ ID No.13 according to antibody molecule of the present invention, and contain light chain and be characterised in that SEQ ID No. 15 defined nucleotide sequences), or its fragment, allele variant, functional variant, take variant, fusion molecule or the chemical derivative of degeneracy nucleic acid password as the basis. Antibody BIWA 8 contains just like the coded heavy chain of SEQ ID No.13 nucleotide sequence, and is the coded variable region of light chain of SEQ ID No.15 nucleotide sequence.

In a best specific embodiments, the present invention is relevant to antibody molecule of the present invention, and wherein heavy chain is that SEQ ID No.13 nucleotide sequence is coded, and wherein light chain is that SEQ ID No.15 nucleotide sequence is coded. Best is such antibody protein, contain promising SEQ ID No.16 nucleotide sequence coded heavily reach light chain. This sequence includes targeting sequencing, is cloned in the carrier N5KG1val.

Therefore, the specific embodiments of another high-importance is according to antibody molecule of the present invention (contain heavily reach light chain be that the defined nucleotide sequence of SEQ ID No.16 is coded), or its fragment, allele variant, functional variant, take variant, fusion molecule or the chemical derivative of degeneracy nucleic acid password as the basis. Antibody BIWA 4 contain promising SEQ ID No.16 nucleotide sequence coded heavily reach light chain.

In best specific embodiments, the present invention is relevant to antibody molecule of the present invention, and wherein heavily reaching light chain is that SEQ ID No.16 nucleotide sequence is coded. The whole antibody BIWA 4 of this sequential coding.

Antibody protein therapeutic agent target CD44v6 antigen of the present invention is to provide the instrument of high special. Therefore, on the other hand, the present invention is relevant to antibody protein of the present invention, and wherein this antibody protein can be connected to therapeutic agent. In numerous therapeutic agent known in the art, therapeutic agent is selected from following comprising: radio isotope, and toxin, toxoid, proinflammatory agent, enzyme, antisense molecule, the peptide class, cell factor, and chemotherapeutant is the preferably. In radio isotope, with γ, β and α-gamma ray activity isotope can be useed therapeutic agent as. The beta rays radio isotope is better therapeutic radiation line isotope.¹⁸⁶Rhenium,¹⁸⁸Rhenium,¹³¹Iodine reaches⁹⁰Yttrium has proved to be realized local irradiation and destroys the useful especially beta-ray isotope in malignant cell aspect. Therefore, be selected from and comprise¹⁸⁶Rhenium,¹⁸⁸Rhenium,¹³¹Iodine reaches⁹⁰The radio isotope of yttrium is the especially preferred therapeutic agent that is connected to antibody protein of the present invention. For example, the radioiodination effect of antibody of the present invention, having a method to be disclosed in WO 93/05804 can be for using.

Therefore, preferred aspect of the present invention is that wherein this therapeutic agent is to be selected to comprise radio isotope, toxin, toxoid, the therapeutic agent of prodrug and chemotherapeutant according to antibody protein of the present invention.

Preferred aspect of the present invention is according to antibody protein of the present invention, wherein this therapeutic agent can be connected to antibody protein via being selected from following connexon, comprise MAG-3 (US 5082930 A, EP 0247866 B1 (p2 55-56 row-p3 1-23 row)); MAG-2 GABA (US 5681927 A, EP 0284071 B1 (p69-29)); And N2S2 ((=phenol sulfuric ester) US 4897255 A, US 5242679 A, EP 0188256 B1 (18 are listed as for p2,38 row-p3)), more than all classify this case reference as.

Described connexon is following formula:

Preferred aspect of the present invention is that therapeutic agent wherein is connected to antibody protein via MAG-2 GABA according to antibody protein of the present invention.

Preferred aspect of the present invention is that wherein this radio isotope is the beta rays radio isotope according to antibody protein of the present invention.

Preferred aspect of the present invention is that wherein this radio isotope is selected from following comprising according to antibody protein of the present invention¹⁸⁶Rhenium,¹⁸⁸Rhenium,¹³¹Iodine reaches⁹⁰Yttrium.

Preferred aspect of the present invention is that wherein this radio isotope is according to antibody protein of the present invention¹⁸⁶Rhenium.

The further aspect of the present invention is relevant to antibody protein of the present invention, is characterised in that it is through mark. The special antibody of the CD44v6-of this mark makes the CD44v6 antigen can be in vitro and/or be positioned in the body and/or detect. Label is defined as a kind of mark, can be detected directly or indirectly. Indirect labelling may be defined as can't detected mark itself, but but need to the mark of the special direct-detection of indirect labelling. Realize that better label of the present invention is detectable mark. From the detectable mark of various kinds, detectable label is selected from the following enzyme that comprises, dyestuff, and radio isotope, foxalin (digoxygenin), and take biotin as best.

Therefore, preferred aspect of the present invention is according to antibody protein of the present invention, is characterised in that it is through mark. Preferably according to antibody protein of the present invention, wherein this label is detectable mark. Simultaneously preferably according to antibody protein of the present invention, wherein detectable mark be selected from following: comprise enzyme, dyestuff, radio isotope, foxalin, or biotin.

The present invention is relevant to antibody protein of the present invention on the other hand, but is characterised in that it is to be connected to developer. But the developer of various kinds, especially radio isotope are that this area is obtainable. Be to implement the present invention, with the gamma-radiation isotope for better. The best is¹²⁵Iodine.

Therefore, preferred aspect of the present invention is antibody protein of the present invention, but it is to be connected to developer. Preferred aspect of the present invention is according to antibody protein of the present invention, but wherein developer is a kind of radio isotope. Preferred aspect of the present invention is that wherein this radio isotope is the gamma ray activity isotope according to antibody protein of the present invention. Preferred aspect of the present invention is that wherein this radio isotope is according to antibody protein of the present invention¹²⁵I。

Therefore, preferred aspect of the present invention is to be connected to such as above-mentioned radioisotopic antibody protein, antibody protein wherein has by about 0.5 specific activity to about 15 millicurie/milligrams, or have by about 0.5 to about 14 millicurie/milligrams, better about 1 to about 10 millicurie/milligrams, better about 1 to about 5 millicurie/milligrams, and the specific activity of best 2 to 6 millicurie/milligrams or 1 to 3 millicurie/milligram.

Another better specific embodiments of the present invention is pharmaceutical composition, contains according to antibody of the present invention, and pharmaceutically acceptable carrier or excipient.

Pharmaceutically acceptable carrier can contain physiologically acceptable compound, its effect as: can stablize or increase the AMPA glutamate receptor agonists, the absorption of short of money dose or adjusting control agent. This physiologically acceptable compound comprises such as carbohydrate, such as glucose, sucrose or dextrose, antioxidant such as ascorbic acid or glutathione, chelating agent, low molecular weight protein or other stabilizing agents or excipient (also seeing such as Remington ' s Pharmaceutical Sciences (1990) 18th ed.Mack Publ., Easton). Those skilled in the art know selecting of pharmaceutically acceptable carrier, comprise physiologically acceptable compound, can be according to such as the administration path of composition and decide.

In animal or human's body, demonstrate,proved and known that it is useful utilizing above-mentioned pharmaceutical composition, can be via intravenous or other paths, such as general, zone ground or be applied to partly emphasis tissue or organ is decided according to the pattern of the disease of wish processing or problem and source, such as tumour. For example, when different organs or tract are that the systemic effect pattern is wanted to ask when needing treatment, as at the general autoimmune disease, or irritated, or the transplanting of external organ or tissue, or tumour diffusion or when being difficult to locate. When only expection has local tumour or immunization, during such as regional tumour, can consider local binding mode.

The pharmaceutical composition that contains antibody protein of the present invention can be used in different application well known by persons skilled in the art path, it should be noted that intravenous injection or directly injects in the target tissue. When general was used, with intravenous, in the tube chamber, in the muscle, in the artery, in the peritonaeum, the interior path of oral or sheath was for better. More zonal application can be through subcutaneous, and intracutaneous is intracardiac, between leaf (intralobally), in the marrow, in the lung, directly reach or near wish process tissue (knot forms-, bone-, muscle-, neural-, epithelium-tissue). Render a service and decide according to course for the treatment of of wanting to ask and treatment, but drug antibody composition administration one or several, also can be off and on, administration a couple of days on the basis of every day for example, several weeks or several months, and with different dosage.

The pharmaceutical composition that is fit to that contains antibody preparation in preparation is during for above-mentioned application, and those skilled in the art can use known injectable, physiologically acceptable sterile solution. In preparation inject outward for intestines or infuse be available solution the time, aqueous isotonic solutions can easily obtain such as salt solution or suitable plasma proteins solution. Pharmaceutical composition can be freeze drying pattern or anhydrous formulation, and it can directly recombinate it with known Injectable solution before use under aseptic condition, as the assembly kit. The final preparation of antibody compositions of the present invention can be made into for injection, transfusion or perfusion are used, to mix with acceptable solution on the sterile physiological according to purified antibody of the present invention, wherein can add with known carrier mass and/or additive (such as seralbumin, dextrose, sodium hydrogensulfite, EDTA).

The dosage that antibody is used is decided according to the essence of disease. In some patient, be contained in " exposing " antibody consumption in the pharmaceutical composition, can be at 0.1 and 100 milligram/meter²Between, better 5 and 50 milligrams/meter², use better 10 milligrams/meter at every turn²To about 40 milligrams/meter², better 10 milligrams/meter²To about 30 milligrams/meter², also better be 20 milligrams/meter²To about 30 milligrams/meter², and preferably about 25 milligrams/meter²Body surface area. The best is that antibody protein dosage is about 50 milligrams/meter simultaneously²Body surface area.

Each administration is applied to patient's radioactivity dosage and wants enough high just effective, but must be lower than toxicity dose limitation (dose limiting toxicity) (DLT). For the pharmaceutical composition that contains through radio-labeled antibody, if any¹⁸⁶The composition of rhenium must will determine maximum tolerated dose (MTD), and it can not surpass treatment and set. Radio-labeled antibody is applied to cancer patient can carry out through repetition (the per month or weekly) intravenous infusion of the dosage that is lower than MTD (seeing Welt et al. (1994) J.Clin.Oncol.12:1193-1203). With multiple dosing for better, usually take week as the interval; Yet, should be with the administration of longer gap, namely every 4-24 week, better every 12-20 week through radiolabeled material. Yet those skilled in the art can select, administration be divided into secondary or use more than the secondary, but each interval very short time use, or in some other predetermined gap scope, as from 1 day to using in 1 week.

Moreover applied radioactivity dosage can be complied with following criterion. Generally speaking, the radioactivity dosage of each administration should be at 30 and 75 millicurie/rice²Between the body surface area (BSA). Therefore, the amount of radio-labeled antibody in pharmaceutical composition of the present invention, preferably with¹⁸⁶Rhenium,¹⁸⁸Rhenium,^99mTechnetium,¹³¹Iodine reaches⁹⁰Yttrium, preferably with¹⁸⁶The amount of the antibody of rhenium mark, being applied to patient is 10,20,30,40,50 or 60 millicurie/rice², better be 50 millicurie/rice² In better specific embodiments, the present invention is relevant pharmaceutical composition, and wherein the dosage of this radio-labeled antibody is MTD according to the present invention, better is 50 millicurie/rice² This has detailed demonstration in the clinical research of example 3 to 6.

Simultaneously better also has according to pharmaceutical composition of the present invention, wherein contain antibody protein and be connected to the radio isotope that defines as mentioned according to the present invention, wherein the specific activity of antibody protein serves as reasons about 0.5 to about 15 millicurie/milligrams, or by about 0.5 to about 14 millicurie/milligrams, better about 1 to about 10 millicurie/milligrams, better about 1 to about 5 millicurie/milligrams, and best 2 to 6 millicurie/milligrams or 1 to 3 millicurie/milligram.

Better also comprises according to pharmaceutical composition of the present invention, contain antibody protein and be connected to the radio isotope that defines as mentioned according to the present invention, wherein this antibody or antibody derivatives be in the aqueous solution pH by about 7 to about 8, and concentration by about 0.5 to about 2.0 mg/ml.

Better specific embodiments is according to pharmaceutical composition of the present invention, further contains one or more radioprotectant, is selected to comprise ascorbic acid, gentianic acid, reductic acid, erythritic acid (erythrorbic acid), Para-Aminobenzoic, 4-HBA, niacin, niacinamide, 2,5-dihydroxy-1, the 4-benzenedisulfonic acid, general dimension ketone (povidone), inositol, and/or citrate.

Preferably according to pharmaceutical composition of the present invention, radioprotectant wherein is ascorbic acid.

Another better specific embodiments is according to pharmaceutical composition of the present invention, wherein this antibody protein contains antibody molecule, be selected from antibody molecule BIWA 4 or BIWA 8, as indicated above, and be connected to 186 rheniums (via MAG-2 GABA), and further contain the radioprotectant ascorbic acid.

Another better specific embodiments of the present invention is the usage according to antibody protein of the present invention, can be made into medicine with the treatment cancer. In better specific embodiments, the present invention is relevant usage according to antibody protein of the present invention, can be connected to therapeutic agent described above, with the treatment cancer. Cancer comprises any disease relevant with malignancy, such as solid tumor, and sarcoma and leukaemia. The prerequisite of this disease necessity is the expression of CD44v6. Foundation cancer of the present invention comprises following, but is not limited to this:

1) epitheliomatous treatment comprises breast, lung, colorectum, head and neck, pancreas, ovary, bladder, stomach, skin, inner membrance, ovary, testis, esophagus, the cancer in prostate and kidney source;

2) bone and soft tissue sarcoma: osteosarcoma, chondrosarcoma, fibrosarcoma, MFH (MFH), leiomyosarcoma;

3) hematopoiesis system cancerates: suddenly Jin Shi and Fei Huojin lymphomas, leukaemia;

4) neuroectodermal tumors: peripheral nerve tumour, astrocytoma, melanoma;

5) celiothelioma.

The example of the cancerous disease states relevant with solid tumor comprises following, but is not limited to this: colorectal cancer, non-small cell lung cancer, breast cancer, head and neck cancer, oophoroma, lung cancer, carcinoma of urinary bladder, the metastatic carcinoma of cancer of pancreas and brain.

Therefore, better specific embodiments is the usage according to antibody protein of the present invention, and wherein this cancer is selected from the following colorectal cancer that comprises, non-small cell lung cancer, breast cancer, head and neck cancer, oophoroma, lung cancer, carcinoma of urinary bladder, the metastatic carcinoma of cancer of pancreas and brain.

Comprise also better that according to antibody protein of the present invention as hereinbefore defined, can be made into medicine with the treatment cancer, wherein the amount of antibody protein is applied as 0.1 and 100 milligram/meter at every turn²Between, better be 5 and 50 milligrams/meter², better be 10 milligrams/meter²To about 40 milligrams/meter², better 10 milligrams/meter²To about 30 milligrams/meter², also better be 20 milligrams/meter²To about 30 milligrams/meter², and preferably about 25 milligrams/meter²Body surface area. Preferably about 50 milligrams/meter simultaneously²The antibody protein dosage of body surface area. The better antibody protein that also has is connected to the radioisotopic usage that defines as mentioned according to the present invention, can be made into medicine with the treatment cancer, and wherein the radioactivity dosage of each administration is 30 and 75 millicurie/rice²Between the body surface area (BSA). Preferably antibody protein is connected to the radioisotopic usage that defines as mentioned according to the present invention, can be made into medicine with the treatment cancer, wherein according to antibody protein radio-labeled of the present invention with¹⁸⁶Rhenium,¹⁸⁸Rhenium,^99mTechnetium,¹³¹Iodine or⁹⁰Yttrium, and preferably mark with¹⁸⁶Rhenium. In another better specific embodiments, the present invention is that relevant antibody protein is connected to according to radioisotopic usage of the present invention, to make the drug therapy cancer again, the isotopic dosage that wherein is connected to antibody is 10,20,30,40,50 or 60 millicurie/rice², 50 millicurie/rice preferably² This has abundant demonstration in the clinical research of example 3 to 6.

The better antibody protein that also has is connected to the radioisotopic usage that defines as mentioned according to the present invention, can be made into medicine with the treatment cancer, wherein the specific activity of this antibody protein serves as reasons about 0.5 to about 15 millicurie/milligrams, or by about 0.5 to about 14 millicurie/milligrams, better about 1 to about 10 millicurie/milligrams, better about 1 to about 5 millicurie/milligrams, and best 2 to 6 millicurie/milligrams or 1 to 3 millicurie/milligram.

The better antibody protein that also has is connected to the radioisotopic usage that defines as mentioned according to the present invention, can be made into medicine with the treatment cancer, wherein this antibody or antibody derivatives be at pH by about 7 to about 8 the aqueous solution, and concentration by about 0.5 to about 2.0 mg/ml.

The present invention further is the method for relevant treatment of cancer, wherein foundation antibody protein administration one of the present invention is to for several times to having in the required experimenter, this antibody protein optionally is bonded to CD44v6, destroy tumour cell via the therapeutic agent that is connected to antibody protein, and whether monitor therapy is successful. That this antibody protein can be is exposed/without modified antibodies protein, and modified antibody protein, such as fused protein, or antibody protein is connected to therapeutic agent, comprising tumour is contacted with this antibody of effective dose. The method for the treatment of cancer described above, in body or external all be effective. Cancer is above-mentioned any cancer.

The dosage that antibody is used is decided according to the essence of disease. At cancer patient, the amount of application of " exposing " antibody can be at 0.1 and 100 milligram/meter²Between, better be 5 to 50 milligrams/meter²Each application, better 10 milligrams/meter²To about 40 milligrams/meter², better 10 milligrams/meter²To about 30 milligrams/meter², also better 20 milligrams/meter²To about 30 milligrams/meter², and preferably about 25 milligrams/meter²Body surface area. Best is that antibody protein dosage is about 50 milligrams/meter simultaneously²Body surface area.

Each administration is applied to patient's radioactivity dosage and wants enough high just effective, but must be lower than toxicity dose limitation (DLT). For through radiolabeled antibody, as with¹⁸⁶The antibody of rhenium mark, maximum tolerated dose (MTD) must be determined that it can not surpass treatment and set. Can carry out via (the per month or weekly) intravenous infusion that repeats to the application of cancer patient through radiolabeled antibody, its dosage is to be lower than MTD (as seeing Welt et al. (1994) J.Clin.Oncol.12:1193-1203). With multiple dosing for better, usually take week as the interval; Yet should come administration with longer interval through radiolabeled material, namely every 4-24 week, better every 12-20 week. Yet those skilled in the art should select minute secondary or the above administration of secondary, and the interval utmost point short time is used separately, or in some other predetermined space scope, as by 1 day to using in 1 week.

Moreover the radioactivity dosage of application should be decided according to following criterion. Generally speaking, the radioactivity of each administration should be at 30 and 75 millicurie/rice²Between the body surface area (BSA). Therefore, through radiolabeled antibody, better be marked with¹⁸⁶Rhenium,¹⁸⁸Rhenium,^99mTechnetium,¹³¹Iodine or⁹⁰Yttrium preferably is marked with¹⁸⁶The dosage of the antibody of rhenium, being applied to patient is 10,20,30,40,50 or 60 millicurie/rice², better 50 millicurie/rice² In better specific embodiments, the present invention is relevant methods for the treatment of, and wherein radiolabeled antibody administration described above is to the patient of the hardship that is subjected to cancer, and wherein the dosage of this radiolabeled antibody is MTD, better is 50 millicurie/rice², this cancer can be prevented or treat thus. This has abundant demonstration in the clinical research of example 3 to 6.

Better also has according to cancer treatment method of the present invention (on seeing), wherein antibody protein is connected to the radio isotope that defines as mentioned according to the present invention, its have specific activity by about 0.5 to about 15 millicurie/milligrams, or by about 0.5 to about 14 millicurie/milligrams, better about 1 to about 10 millicurie/milligrams, better about 1 to about 5 millicurie/milligrams, and best 2 to 6 millicurie/milligrams or 1 to 3 millicurie/milligram.

The better method (as above) that also has according to treatment of cancer of the present invention, wherein antibody protein is connected to according to radio isotope of the present invention, its be in the pH value by about 7 to about 8 the aqueous solution, and concentration by about 0.5 to about 2.0 mg/ml.

Better, the present invention is relevant to method of the present invention, and wherein tumour is to be selected from following comprising: colorectal cancer, non-small cell lung cancer, breast cancer, head and neck cancer, oophoroma, lung cancer, carcinoma of urinary bladder, the metastatic carcinoma of cancer of pancreas and brain.

The further aspect of the present invention is nucleic acid, it is characterized in that codified is according to antibody protein of the present invention. This nucleic acid can be RNA, or better is DNA. But this dna molecular chemical synthesis. At first, and can the methods known in the art synthetic oligonucleotides that is fit to (such as Gait, M.J., 1984, Oligonucleotide Synthesis.A Practical Approach.IRL Press, Oxford, UK), it can be used to produce synthetic gene. The method that produces synthetic gene is known in the art (such as Stemmer et al.1995, Single-step assembly of a gene and entire plasmid from large numbers of oligodeoxyribonucleotides, Gene 164 (1): 49-53; Ye et al.1992, Gene synthesis and expression in E.coli for pump, a human matrix metalloproteinase, Biochem Biophys Res Commun 186 (1): 143-9; Hayden et Mandecki 1988, Gene synthesis by serial choning of oligonucleotides, DNA 7 (8): 571-7). These methods can be used to synthesize any dna molecular that discloses in this case, the DNA of the BIWA 4 that for example encodes.

Also better, be characterised in that according to nucleic acid of the present invention it contains 5 ' or 3 ' or 5 ' and 3 ' non-translational region. Can contain other non-translational region upstream and/or downstreams according to nucleic acid of the present invention. Non-translational region can contain controlling element, as transcribes and open beginning unit's (promoter) or add hadron. This promoter can be composing type, but induction type, or the promoter of growth control type. Better, do not get rid of other known promoters, the constitutive promoter of human cytomegalovirus (CMV) and Rous sarcoma virus (RSV) is arranged, and simian virus 40 (SV40) and herpe simplex promoter. Foundation inducible promoters of the present invention comprises the promoter to antibiotic tool resistance, heat-shock promoter, but " tumor virus promoter " and the metallothionein promoter of hormone-induction type. Also better, it is synthetic according to antibody protein fragment of the present invention to be characterised in that according to nucleic acid of the present invention it can instruct. This refers to the part according to polypeptide of the present invention.

Better, be such as SEQ ID No.4 according to nucleic acid of the present invention, 5,6,10,11,12,13,14,15 and/or 16 nucleic acid that disclose. Best, this nucleic acid is the nucleic acid of SEQ ID No.16.

Another importance of the present invention is a kind of recombinant DNA carrier, it is characterized in that it contains according to nucleic acid of the present invention. Better, this carrier contains nucleic acid and is characterised in that SEQ ID No.4,5,6,10,11,12,13,14,15 and/or 16 nucleic acid that disclose. Best, this carrier contains the nucleic acid that is characterised in that SEQ ID No.16.

The example of viral vectors has, vaccinia virus for example, Semliki-Forest-virus and adenovirus. The carrier that can be used for the COS-cell has the origin of replication of SV40. Can make plasmid obtain high copy number, can be used for the carrier of insect cell, such as the Escherichia coli transfer vector, and contain and for example can instruct synthetic polyhedrosis DNA as promoter.

Another preferred aspect of the present invention is according to recombinant DNA carrier of the present invention, is characterised in that it is carrier pAD-CMV or its functional derivatives. This derivative such as pAD-CMV1, pAD-CMV19 or pAD-CMV25.

Another preferred aspect of the present invention is according to recombinant DNA carrier of the present invention, it is characterized in that it is SEQ ID No.17, or its functional derivatives.

Another preferred aspect of the present invention is according to recombinant DNA carrier of the present invention, it is characterized in that it is SEQ ID No.18 or its functional derivatives.

Simultaneously also better, this carrier contains one or more nucleic acid molecules, feature such as SEQ ID No.4,5,6,10,11,12,13,14,15 and/or 16.

The carrier that better also discloses just like US 5648267 A or US US 5733779 A contains according to nucleotide sequence of the present invention. Better, this carrier contains one or several nucleic acid molecules, feature such as SEQ ID No.4,5,6,10,11,12,13,14,15 and/or 16. Another preferred aspect of the present invention is according to recombinant DNA carrier of the present invention, is characterised in that it is carrier N5KG1Val or derivatives thereof.

Another importance is the host, is characterised in that it contains according to carrier of the present invention.

Another importance is according to host of the present invention, is characterised in that it is eukaryotic host cell. Comprise fungi according to eukaryotic host cell of the present invention, such as pichia pastoris phaff (Pichia pastoris), saccharomyces cerevisiae (Saccharomyces cerevisiae), fission yeast (Schizo saccharo myces), wood mould (Tricho derma), insect cell is (as from meadow mythimna separata (Spodoptera frugiperda) Sf-9, baculovirus expression system is arranged), plant cell, as from tobacco (Nicotiana tabacum), mammalian cell is such as the COS cell, BHK, CHO or myeloma cell.

In the filial generation of immune system cell, wherein antibody protein also forms in we's body, is especially fully folding and glycosylated according to antibody protein of the present invention. Mammalian host cell better is that CHO or COS cell are for better. Such as CHO DG44 (Urlaub and Chasin, Proc.Natl. Acad.Sci.U.S.A.77 (7): 4216-20 (1980)), or CHO-K1 (ATCC CCL-61) cell. Therefore, another preferred aspect is according to host of the present invention, is characterised in that it is BHK, HCO or COS cell, preferably CHO DG44 or CHO-K1 (ATCC CCL-61) cell.

Another preferred aspect is according to host of the present invention, it is characterized in that it is bacteriophage.

Another preferred aspect is according to host of the present invention, it is characterized in that it is prokaryotic host cell. The example of prokaryotic host cell has: Escherichia coli, hay bacillus, streptomysin or proteus mirabilis (proteum mirabilis).

The present invention further is that relevant preparation is according to the method for antibody protein of the present invention, it is characterized in that it contains following steps: can be at this antibody protein under the condition of this host cell expression according to host of the present invention and cultivate, and isolate this antibody protein. Can be prepared as follows according to antibody of the present invention. The nucleic acid molecules of coding light chain and heavy chain can the standard method chemistry and enzyme process synthetic. At first, the oligonucleotides that is fit to is with methods known in the art synthetic (above describing in detail). The method that produces synthetic gene from oligonucleotides is (describing in detail above) known in the art. Encoding antibody heavily reaches these nucleic acid molecules of light chain, can be cloned in the expression vector (or two chains are all in a carrier molecule, or each chain is to minute other carrier molecule), it introduces host cell again. Host cell better is mammal contracting chief cell (above describing in detail), such as COS, CHO or bhk cell, it better is Chinese hamster ovary (CHO) cell, host cell is incubated at suitable culture medium again, the condition at place can produce antibody, and antibody separates according to standard step in culture medium again. Step from recombinant DNA generation antibody in host cell and expression vector separately is (as seeing WO 94/11523, WO 97/9351, and EP 0481790) well known in the art.

The present invention is relevant preferably to is characterized in that according to method of the present invention this host is mammalian cell, better is CHO or COS cell.

The present invention better is relevant foundation method of the present invention, it is characterized in that this host cell by two kinds of plasmid cotransfections, and this plasmid carries the ceneme of light or heavy chain.

Following examples are in order to further specify the present invention; But wish does not consist of the restriction of the present invention's scope that discloses in this.

Embodiment

Embodiment 1 RIT

Material and method

Monoclonal antibody. (it is the hybridoma cell strain secretion to mMAb BIWA 1=VFF 18, be deposited in DSM-Deutsche Sammlung fur Mikroorganismen und Zellkulturen GmbH on June 7th, 1994 with preserving number DSM ACC2174, Mascheroder Weg 1b, D-38124 Braunschweig, Deutschland; Also see WO 95/33771) the glutathione S-transferase fused protein immunity inoculation BALB/c mouse that contains human CD44 functional domain v3-v10 produces (Heider et al., 1996). Can by the epi-position of BIWA 1 identification, fix on amino acid 360-370 among the CD44 functional domain Vb (according to the numbering (1992) of Kugelman et al.). Batch process that is used for this research can get at protein-G Sepharose purifying and after to the PBS dialysis.

MAb U36 (IgG1) derives after with HNSCC cell line UM-SCC-22B immunized mice, and can identify in the CD44v6 and the BIWA 1 different epi-position of identifying. U36 is with in the up affinity chromatography of a-protein-Sepharose and the certainly concentrated purifying in the culture supernatant of organizing, and further purifying on Q-Sepharose.

The generation of chimeric MAbs and humanization MAbs. MRNA separates from BIWA 1 hybridoma cell strain, utilizes QuickPrep mRNA purification kit (Pharmacia, Uppsala, Sweden). CDNA is from variable heavy chain (V_H) and (V that can lighten_L) chain, and produced by RT-PCR.

Above-mentioned fragment is cloned into TA cloning vector pCR II (Invitrogen, Groningen, The Netherlands) and checks order it. Two expression vectors (Himmler et al., 1990) derived from plasmid pAD CMV1 are consisted of, and wherein carry respectively the constant region of human γ-1 and the constant region of human κ light chain. Next, the V of BIWA 1_HAnd V_LFragment is cloned in the corresponding expression vector, before constant region. Chimeric antibody called after cMAb BIWA 2. The humanization version (being produced by the CDR grafting) that BIWA 1 heavily reaches variable region of light chain is cloned into before the constant region for immunoglobulin of above-mentioned expression vector. For constructing humanized antibody, used human variable region, to be the human immunoglobulin fragment of S31669 derived from data bank GenPept accession number in heavy chain, and be to spread out from human immunoglobulin HUMIGKAX (rearrangement anti--marrow phosphatide (anti-myelin) κ chain) in light chain, the Genbank accession number is M29469. The MAbs that generates is called after hMAb BIWA4 and BIWA 8 respectively. BIWA 8 contains the amino acid of two mouse class parental generation antibodies at light chain framework 2, and BIWA 4 does not contain mouse class residue in framework.

Restructuring MAbs can stably express in the Chinese hamster ovary cell of dihyrofolate reductase disappearance, is undertaken by electroporation heavily to reach the light chain expression plasmid. Cell is implanted in the 96 hole microtiter plates with the density kind in 500 and 100 cells/well holes, in selective medium (α-MEM is added with 10% hyclone through dialysis). When colony becomes visible (after～14 days), with the IgG content in the ELISA mensuration medium supernatant, and amplification produces the maximum colony of IgG amount. In the presence of the cumulative concentration of methotrexate (20-500nM), cultivate, to carry out the amplification of gene.

In the standard medium that contains 1% hyclone, carry out the laboratory scale preparation of chimeric MAbs and humanization MAbs. But the IgG fraction is purifying in the up affinity chromatography self-organizing of a-protein sepharose culture supernatant. Purity is with SDS-PAGE and the test of high-performance size exclusion chromatography method.

The assessment of affinity of antibody. In BIAcore 2000 systems, carry out the detection (BIAcore AB, Uppsala, Sweden) of dynamics and affinity constant with recombinant antigen. GST fusion protein matter (the GST/CD44v3-v10 that contains human CD44v3-v10 functional domain; 20 ug/ml) be solidificated in CM5 with amino couling process and experience on the sheet, according to the operation indication, utilize the 10mM sodium acetate, pH 5.0 is coupling cushioning liquid. The MAb of 35 microlitres under each concentration (8-67nM) injects the surface that is coated with antigen in HBS (10mM HEPES, pH 7.4,150mM NaCl, 3.4mN EDTA, 0.05%BIAcore surfactant P20), and flow velocity is 5 little liter/mins. The dissociation 5 minutes of (HBS) assessment MAb in cushioning liquid flows. Between secondary analysis, described surface is with the Sing plus regeneration of 15 microlitre 30mM HCl. With the BIA assessment software of BIAcore, 2.1 editions estimations of carrying out data analysis and kinetic constant. And to all antibody assessment association rate (k_a), dissociation rate (k_d), and dissociation constant (K_d)。

Also assess RA via competitive cell ELISA. Human A431 cell is derived from the Epithelial cancer of vulva, and knownly expresses high-caliber CD44v6, plants the tissue culturing plate in 96 holes, has 200 microlitres to contain the RPMI 1640 of 10% hyclone in every hole, and density is 2.5-5 * 10⁵Cells/ml. This culture plate is in 37 ℃, 5%CO₂The moist incubation case of air in one night of incubation. And after removing culture medium, cell is washed once with PBS, fixes 1 minute with 96% ethanol, washs with PBS again. CMAb BIWA 2, hMAb BIWA 4 and hMAb BIWA 8 (carry out ahead of schedule and be diluted to 10 ug/ml) were with 1: 2 serial dilution (8 dilution step), with 100 microlitres/hole, be diluted in the PBS/0.5% BSA/0.05% polysorbas20 (analysis cushioning liquid), use and incubation 30 minutes at room temperature. The mMAb BIWA 1 (20 nanograms/milliliter) that adds 100 microlitre beforehand dilutions, this culture plate again in convolution concussion groove with room temperature incubation 2 hours. Control sample only contains the sample of beforehand dilution, without BIWA 1 (0% control group) or BIWA 1 is only arranged without any competitive antibody (100% control group). After washing three times with the PBS/0.05% polysorbas20 (washing buffer solution), (goat of peroxidase-connection resists-mouse Fc to add 100 microlitre SAs, with 1: 15,000 is diluted in the analysis cushioning liquid, DAKO Copenhagen, Denmark) detecting mMAb BIWA 1, and this culture plate in the cyclotron oscillation groove under room temperature incubation 1 hour. After with washing buffer solution washing three times, this culture plate is with 100 microlitres/hole tetramethyl benzidine substrate solution colour developing (Kierkegaad and Perry Laboratories, Gaithersbure, USA). Reaction stopped with the 1M phosphoric acid in 50 microlitres/hole after 15 minutes. In ELISA culture plate counter, under 450 nanometers, detect absorbance. (reference wavelength is the 610-690 nanometer).

The radioiodination effect of antibody. Carry out the iodination of MAbs, basically as described in the Haisma et al. (1986), utilize¹²⁵I (100 millicurie/milliliter) or¹³¹I (200 millicurie/milliliter), the two is all available from Amersham, Aylesbury, England. 1 milligram of MAb IgG is dissolved in 500 microlitre PBS, pH=7.4, and mix 1 millicurie¹²⁵I or¹³¹I is in the bottle that is coated with 75 microgram Iodogen (Pierce, Oud Bijerland, The Netherlands). At room temperature incubation is after 5 minutes, the gel filtration and remove (Pharmacia-LKB, Woerden, The Netherlands) on the PD10-post of free state iodine. Remove unconjugated¹²⁵I or¹³¹Behind the I, determine that with TLC and HPLC method radiochemical purity surpasses 97% all the time, described method is above stated (Van Gog et al., 1997). With the HPLC analysis and evaluation, there is no aggregation or fragment and form.

The preparation of the MAbs of rhenium 186-mark.¹⁸⁶The MAbs of Re-mark is standby according to the multi-step legal system, wherein uses chelating agent S-benzyl acyl group sulfydryl acyl group triglycine (S-benzyl acyl group-MAG3) (Van Gog et al., 1997a) as discussed previously. In this step,¹⁸⁶After the solid phase of the preparation of Re-MAG3 is synthetic, continue with the esterification of 2,3,5,6-tetrafluoro phenol (TFP), and with reactivity¹⁸⁶The Re-MAG3-TFP ester is connected to MAb. Behind the connection function,¹⁸⁶The MAb of Re-mark is purifying on the PD10-post. Remove unconjugated¹⁸⁶Behind the Re, radiochemical purity surpasses 98% all the time.

The binding analysis of radio-labeled antibody. Be used for bio distribution and treatment research through the MAbs of mark in external binding characteristic, in immunoreactivity is analyzed, determine basically (Van Gog et al., 1997a) as discussed previously. For the test iodate or¹⁸⁶The combination of the MAbs of Re-mark uses the UM-SCC-11B cell to be fixed on 0.1% glutaraldehyde. UM-SCC-11B cell generosity derives from Dr.T.E.Carey, University of Michigan, Ann Arbor, MI. (scope is by every pipe 5 * 10 to prepare 5 serial dilutions with 1%BSA in PBS⁶Cell is to every pipe 3.1 * 10⁵Individual cell). Excessive unmarked MAb IgG adds in the second pipe, and the cell that is added with least concentration is to measure non-specific combination. With mark with 10,000cpm's¹²⁵I， ¹³¹I or¹⁸⁶The IgG of Re adds to each pipe, and sample is 4 ℃ of one nights of lower incubation. Cell centrifugation, radioactivity in agglomerate and the supernatant is detected (LKB-Wallace 1282 CompuGamma, Kabi Pharmacia, Woerden in gamma counter, and the percentage of radioactivity that calculate mating type and free state The Netherlands). Data graphical analysis on modified Lineweaver Burk figure is extended down to outward under the condition that represents unlimited antigen excess by linearity and determines immunoreactivity.

In with the nude mice of HNSCC, carry out biodistribution research. In the bio distribution experiment, carry out (Van Gog et al., 1997a) as discussed previously with the nude mice that carries the human HNSCC xenograft of subcutaneous implantation (HNX-OE). Female mice (Hsd: athymia nu/nu, 25-32 gram, Harlan CPB, Zeist, The Netherlands) is that 8-10 week is large when experiment. Carry out three bio distribution experiments, to carry 1 or 2 scope by 30 to 470 millimeters³The tumor line mouse carry out. In first experiment, 10 micromicrocuries (50 microgram)¹³¹The mMAb U36 of I-mark and 10 micromicrocuries (50 microgram)¹²⁵The mMAb BIWA 1 of I mark is injected with 133 ± 28 millimeters simultaneously³In the Mice Body of tumour (n=20 mouse, 37 tumours). In second experiment, 10 micromicrocuries (50 microgram)¹³¹The hMAb BIWA 4 of I mark and 10 micromicrocuries (50 microgram)¹²⁵The cMAb BIWA 2 of I-mark is injected with 167 ± 31 millimeters jointly³In the Mice Body of tumour (n=21 mouse, 32 tumours). In the 3rd experiment, 10 micromicrocuries (50 microgram)¹³¹The hMAb BIWA 4 of I mark and 10 micromicrocuries (50 microgram)¹²⁵The hMAb BIWA 8 of I-mark is injected with 130 ± 21 millimeters jointly³In the mouse of tumour (n=23 mouse, 40 tumours). Conjugate is after being diluted in 0.9%NaCl, with the volume intravenous injection of 100 microlitres. For the comparable blood of the MAbs that obtains common injection/body clearance rate, only be mixed with the MAbs of same mouse or human homotype (isotype). Selecting of antibody dosage (every mouse totally 100 micrograms) is should be enough high to avoid MAb elimination effect (Sharkey et al. of homotype-relevant (isotype-related) fast from blood, 1991, Van Gog et al., 1997b), also to enough hang down and just can avoid the saturated of antigen in the tumour.

During time point shown in after injection, with mouse anesthesia, blood sampling is killed and is dissected. Except tumour, also shift out following organ: liver, spleen, kidney, the heart, stomach, ileum, colon, bladder, breastbone, muscle, lung, skin and tongue. After weighing, (LKB-Wallace 1282 CompuGamma) count in tumour in dual-isotope gamma counter, blood and intraorganic radioactivity,¹²⁵Automatic calibration during the I window is set¹³¹The I-Compton (¹³¹I-comptons). Radioactivity picked-up in these tissues organizes the percentage of implantation dosage to calculate (%ID/ gram) with every gram.

Until MAb administration day, mouse is conventional closes under the condition of SFF, at the equal controlled clean cell of the built-in humidity in aseptic hurdle and temperature, is the 2000th grade according to Federal Standard 209d. The injection same day, mouse moves to Radio Nuclide Center, and under aseptic condition in fume hood the aseptic radio-immunity conjugate of administration.

The research of RIT in nude mice. Carry out animal RIT research, with mark relatively with¹⁸⁶The treatment of the different MAbs of Re is renderd a service. The immunoreactivity part of conjugate surpasses 75% all the time. Carrying 1 or 2 HNX-OE tumour, and scope is at 45 to 195 millimeters³Mouse carry out three treatment experiments. Select¹⁸⁶Re dosage is in maximum tolerated dose (MTD) level (i.e. 400 micromicrocuries) or lower (300 micromicrocurie). The MTD level is defined as the dosage that causes body weight 5-15% forfeiture. In first experiment, mouse gives or 300 micromicrocuries (100 microgram)¹⁸⁶The mMAb U36 of Re-mark or 300 micromicrocuries (100 microgram)¹⁸⁶The mMAb BIWA 1 azygos vein injection of Re-mark. In second experiment, administration or 300 micromicrocuries (100 microgram)¹⁸⁶The hMAb BIWA 4 of Re-mark and 300 micromicrocuries (100 microgram)¹⁸⁶The cMAb BIWA 2 of Re-mark, and in the 3rd experiment, or 400 micromicrocuries (100 microgram)¹⁸⁶The hMAb BIWA 4 of Re-mark or 400 micromicrocuries (100 microgram)¹⁸⁶The hMAb BIWA 8 of Re-mark. Mean tumour volume in all experiment groups is all similar. Experiment 1:95 millimeter³± 34 millimeters³(n=7 mouse, 12 tumours) in¹⁸⁶In the Re-mMAb U36 processed group, 91 millimeters³± 15 millimeters³(n=7 mouse, 12 tumours) in¹⁸⁶In Re-mMAb BIWA 1 processed group, and 99 millimeters³± 54 millimeters³(n=6 mouse, 11 tumours) are in control group. Experiment 2:101 millimeter³± 35 millimeters³(n=7 mouse, 12 tumours) in¹⁸⁶Re-hMAb BIWA 4 processed group, 92 millimeters³± 43 millimeters³(n=7 mouse, 12 tumours) in¹⁸⁶Re-cMAb BIWA 2 processed group, and control group is identical with experiment 1. Experiment 3:105 millimeter³± 43 millimeters³(n=8 mouse, 13 tumours) in¹⁸⁶Re-hMAb BIWA 4 processed group, 100 millimeters³± 42 millimeters³(n=8 mouse, 13 tumours) in¹⁸⁶Re-hMAb BIWA 8 processed group, and 110 millimeters³± 46 millimeters³(n=7 mouse, 11 tumours) are in control group. In processing procedure, tumour is surveyed weekly secondary, and estimates with respect to the gross tumor volume at the beginning of processing. Detect weekly the body weight secondary with monitoring toxicity. When one of tumour above 1000 millimeters³The time can put to death mouse.

Statistics. On each time point, the difference that tissue is taken between the MAbs that statistical analysis is injected altogether, paired data are utilized Student ' s t-test. When each time point, the difference of mean tumour volume between each RIT processed group of statistical analysis adopts Student ' s t-test to independent sample.

The result

The In vitro Binding Characteristics of the special MAbs of CD44v6-. Utilize recombinant antigen and human tumor cell line, analyze the binding affinity of 5 kinds of MAbs. Utilize surperficial plasmid gene group resonance (surface plasmon resonance), take GST/CD44v3-v10 as solidifying antigen, can assess dynamics and affinity constant. Table 1 illustrates association rate (k_a), dissociation rate (k_d) and dissociation constant (K_d). MMAb BIWA 1 and cMAb BIWA 2 contain identical variable region, have similar k_a，k _dAnd K_d, and demonstrate the highest affinity. Opposite, mMAb U36 and hMAb BIWA 4 have lower k_aAnd higher K_d, cause significantly lower dissociation constant (being respectively constant (factor) 35.0 and 10.5). HMAb BIWA 8 contains the muroid residue in light chain framework region 2, demonstrates the k of remarkable attenuating_d, cause the increase of affinity.

Table 1 is dynamics and the affinity constant of the MAbs of antagonism CD44v6 directly

Antibody k_a(M ^-1s ^-1) k _d(s ^-1) K _d(M) with respect to the K of mouse BIWA1_d
	Mouse BIWA1 1.3 * 10⁵ 4.2×10 ^-5 3.2×10 ^-101.0 mouse U36 1.5 * 10⁴ 1.7×10 ^-4 1.1×10 ^-835.0 chimera BIWA2 1.7 * 10⁵ 4.1×10 ^-5 2.4×10 ^-100.7 humanization BIWA4 6.5 * 10⁴ 2.2×10 ^-4 3.4×10 ^-910.5 humanization BIWA8 7.5 * 10⁴ 6.3×10 ^-5 8.4×10 ^-10 2.6

Also the RA of assessment cMAb and hMAb in competitive cell ELISA utilizes human A431 tumour cell (Fig. 1). Detect according to the affinity on recombinant antigen, cMAb BIWA 2 is the most effective competitors, and that continue is hMAb BIWA 8 and hMAb BIWA4. Can obtain similar as a result (not shown) with other two kinds human HNSCC cell lines (FaDu and LICR-LON-NH5).

Bio distribution in carrying the nude mice of HNSCC. In the nude mice that carries the HNX-OE xenograft, carry out biodistribution research. Two MAbs that same mouse or human homotype are arranged, mark with¹²⁵I or¹³¹I, and simultaneously injection (each 50 microgram, 10 micromicrocuries). Select each MAbs pair, provide progressively attenuating with the difference in affinity: the affinity of mMAb U36 is than mMAb BIWA 1 low 35.0 times (experiment 1), and hMAb BIWA 4 has than cMAb BIWA 2 low 14.0 times affinity (experiment 2) and hMAb BIWA 8 low 4.0 times the affinity (experiment 3) than hMAb BIWA are arranged. The immunoreactivity part (fraction) of all iodate MAbs postpones at least 74% (table 2) outside.

The immunoreactivity part of table 2 iodate MAbs is by being bonded to

UM-SCC-11R cell and determining

Experiment antibody labeling thing is bonded to extrapolation

Numbering 5 * 10⁶Cell (%) combination^a(％)

1 mouse U36¹³¹I 59.7 87.4

Mouse BIWA1¹²⁵I 91.1 91.1

2 humanization BIWA4¹³¹I 77.4 82.3

Chimeric BIWA2¹²⁵I 80.5 79.9

3 humanization BIWA4¹³¹I 77.3 74.5

Humanization BIWA8¹²⁵I 91.8 92.1

^aCan measure immunoreactivity by linear extrapolation to the condition that represents unlimited antigen excess: see material and method

In experiment 1 bio distribution, after injection, measure 1,2,3 and 7 days the time; In experiment 2 and 3 bio distribution, after injection, measure 1,2,4 and 7 days the time. The average %ID/ gram through estimating of the tumour of all three experiments and blood is shown in Table 3.

After table 3 is injected to altogether and carries the HNX-OE mouse, different affinity are arranged

Tumour and blood levels through the special MAbs of the CD44v6-of iodate

Conjugate A (%ID/ gram) Conjugate B (%ID/ gram) Conjugate A: B ratioThe tumor blood tumor blood tumor blood time after the experiment numbers injection
	1. conjugate A:¹³¹I-mMAb U36 1d 15.7 17.9 13.0 17.8 1.2 1.0 conjugate B:¹²⁵I-mMAb BIWA1 2d 18.4 15.0 13.4 14.9 1.4 1.0 3d 20.6 11.8 13.7 11.0 1.5 1.1 7d 16.5 7.1 7.8 4.8 2.1 1.5
2. conjugate A:¹³¹I-hMAb BIWA4 1d 10.8 10.2 9.1 10.6 1.2 1.0 conjugate B:¹²⁵I-eMAb BIWA2 2d 12.4 10.2 9.8 10.1 1.3 1.0 4d 12.9 7.2 8.9 7.2 1.5 1.0 7d 7.6 3.3 4.8 2.7 1.6 1.2
	3. conjugate A:¹³¹I-hMAb BIWA4 1d 10.5 11.1 9.5 11.4 1.1 1.0 conjugate B:¹²⁵I-hMAb BIWA8 2d 10.9 10.0 9.6 9.8 1.1 1.0 4d 11.7 6.2 9.6 5.9 1.2 1.0 7d 10.1 4.2 7.8 3.9 1.3 1.1

To common injection MAbs, the assimilation ratio of tumour and blood is shown in each. Tumour, blood and each organ the 3rd (experiment 1) or 4 days p.i. (experiment 2 and 3) average %ID/ gram and s.e.m. be shown in Fig. 2.

Two mouse MAbs directly relatively in, when the tumour of low-affinity U36 is absorbed in all time points, all be significantly higher than the absorption p of high-affinity BIWA1＜0.001 (table 3). Opposite, these MAbs absorb between numerical value in blood and the normal structure when 1,2 and 3 day p.i. and have no significant difference. When the 7th day p.i., the BIWA1 level significantly is lower than (p＜0.05) U36 level in blood and most of organ, shows the interior clearance rate of BIWA1 autoblood/body more hurry up. When the 3rd day p.i., compare with BIWA1, the tumour of U36 high 50% is taken in Fig. 2 A and is illustrated.

Visible similarly correlation when other two couples of MAb of assessment. HMAb BIWA4 though lower affinity is arranged, all demonstrates when all time points than cMAb BIWA2 and the significantly higher tumour of hMAb BIWA8 and takes in (P＜0.001) (table 3). Opposite, at 1,2 and 4 day p.i., the MAb level in blood and normal structure is similar to these MAbs. At the 7th day p.i., BIWA2 and BIWA8 level were significantly to be lower than (P＜0.05) BIWA4 level in blood and most of organ, and pointing out in these MAb autoblood/bodies has faster clearance rate. With BIWA2 relatively the time, BIWA4 has and exceeds 45% tumour and take in, and illustrates in Fig. 2 B, and with BIWA8 relatively the time, and BIWA4 has and exceeds 20% tumour and take in, and illustrates that in Fig. 2 C this is for injecting rear time point 4 days.

By obtaining consistent result (data are not shown) in the extra experiment, wherein exchange radio-labeled:¹²⁵I-BIWA4 pair¹³¹I-BIWA8 changes¹³¹I-BIWA4 pair¹²⁵I-BIWA8. Can get rid of a possibility in the data of testing later thus, namely radiolabeled pattern can affect the pharmacokinetics behavior through mark MAb.

RIT in carrying the nude mice of HNSCC. In the experiment of three bio distribution, as if can to show MAbs than high-affinity higher and have more optionally tumour and take in for the MAbs of low-affinity, and therefore may be fit to RIT. For testing this possibility, in RIT research, following processed group, utilize the heterograft mouse that carries HNX-OE to carry out:

Experiment 1: with 300 micromicrocuries¹⁸⁶Re-U36 or 300 micromicrocuries¹⁸⁶Re-BIWA1 or salt solution are contrast. Experiment 2:300 micromicrocurie¹⁸⁶Re-BIWA4 or 300 micromicrocuries¹⁸⁶Re-BIWA2 or salt solution are contrast. Experiment 3:400 micromicrocurie¹⁸⁶Re-BIWA4 or 400 micromicrocuries¹⁸⁶Re-BIWA8 or salt solution are contrast.

In Fig. 3, the average relative gross tumor volume of control group and processed group (representing with the gross tumor volume percentage at the 0th day) was mapped to the time. In all three experiments, demonstrate logarithmic growth in the tumour of control group small mouse, and the time that gross tumor volume doubles is about 7 days. With¹⁸⁶In the MAbs processed group of Re-mark, tumour stops growing, and with the disappearing of tumour, this occurs after injecting conjugate immediately in some example. Yet, the final all regrowths of all tumours.

In experiment 1, administration 300 micromicrocuries¹⁸⁶Re-BIWA1 causes tumor growth rate to slow down, but the average tumor size does not reduce. Administration 300 micromicrocuries¹⁸⁶Re-U36 can cause mean tumour volume to reduce, after the injection between the 7th day and the 17th day by 185 millimeters³Be reduced to 120 millimeters³, tumour begins regrowth afterwards. ¹⁸⁶In the Re-U36 processed group, in the 14th day, the average relative gross tumor volume was significantly less than (P＜0.001),¹⁸⁶The Re-BIWA1 processed group.

In experiment 2, administration 300 micromicrocuries¹⁸⁶Re-BIWA4 or 300 micromicrocuries¹⁸⁶Re-BIWA2 caused checking of tumor growth at the 7th day, and began growth at the 17th day p.i. again. Since the 14th day, aspect RIT, BIWA4 was effective than BIWA2, but the significant difference between the average relative gross tumor volume is detected in the 14th day p.i. (P＜0.05).

In experiment 3, mouse is with 400 micromicrocuries¹⁸⁶Re-BIWA4 or BIWA8 process, and it causes, and relative tumour volume reduces to minimum in the time of 19 days, is respectively 80 ± 62% and 98 ± 81%. Afterwards, tumour begins regrowth.

These data show that on RIT, low-affinity MAb BIWA4 higher affinity MAbs cBIWA2 and BIWA8 are more effective.

List of references

Gunthert，U.，Hofmann，M.，Rudy，W.，Reber，S.，Zoller，M.，Hauβmann，I.， Matzku，S.，Wenzel，A.，Ponta，H.，and Herrlich，P.A new variant of glycoprotein CD44 confers meta-static potential to rat carcinoma cells.Cell 65：13-24(1991).

Haisma，H.J.，Hilgers，J.，and Zurawski，V.R.Jr.Iodination of monoclonal antibodies for diagnosis and therapy using a convenient one vial method.J.Nucl. Med.，27：1890-1895，1986.

Heider，K.-H.，Hofmann，M.，Horst，E.，van den Berg，F.，Ponta，H.，Herrlich， P.，and Pals，S.T.A human homologue of the rat metastasis-associated variant of CD44 is expressed in colorectal carcinomas and adenomatous polyps.J.Cell Biol.120：227-233(1993a).

Heider，K-H.，Dammrich，J.，Skroch-Angel，P.，Muller-Hermelink，H-K.， Vollmers，H-P.，Herrlich，P.，and Ponta，H. Differential expression of CD44 splice variants in intestinal-and diffuse-type human gastric carcinomas and normal gastric mucosa.Cancer Res.53：4197-4203(1993b).

Heider KH，Mulder JWR，Ostermann E，Susani S，Patzelt E，Pals ST，Adolf GRA.Splice variants of the cell surface glycoprotein CD44 associated with metastatic tumor cells are expressed in normal tissues of humans and cynomolgus monkeys.Eur.J.Cancer 31A：2385-2391，1995.

Heider KH，Sproll M，Susani S，Patzelt E，Beaumier P，Ostermann O，Ahorn H，Adolf GRA.Characterization of a high affinity monoclonal antibody specific for CD44v6 as candidate for immunotherapy of squamous cell carcinomas. Cancer Immunlology Immunotherapy 43：245-253，1996.

Himmler，A.，Maurer-Fogy，I.，Kronke，M.，Scheurich，P.，Pfizenmaier，K.， Lantz，M.，Olsson，L，Hauptmann，R.，Stratowa，C.，and Adolf，G.R.Molecular cloning and expression of human and rat tumor necrosis factor receptor chain (p60)and its soluble derivative，tumor necrosis binding protein.DNA & Cell Biol.，9：705-715，1990.

Hormann，M.，Rudy，W.，Zoller，M.，Tolg，C.，Ponta，H.，Herrlich P.，and Gunthert，U.CD44 splice variants confer metastatic behavior in rats：

homologous sequences are expressed in human tumor cell lines.Cancer Res.51： 5292-5297(1991).

Kugelman，L.C.，Gangluly，S.，Haggerty，J.G.，Weissman，S.M.，and Milstone，L.M.The core protein of epican，a heparan sulfate proteoglycan on keratinocytes，is an alternative form of CD44.J.Invest，Dermatol.，99：886-891， 1992.

Koopman，G.，Heider，K.-H.，Horts，E.，Adolf，G.R.，van den Berg，F.，Ponta， H.，Herrlich，P.，Pals，S.T.Activated human lymphocytes and aggressive Non-Hodgkin′s lymphomas express a homologue of the rat metastasis-associated variant of CD44.J.Exp.Med.177：897-904(1993).

Rudy，W.，Hofmann，M.，Schwartz-Albiez，R.，Zoller，M.，Heider，K.-H.， Ponta，H.，Herrlich，P.The two major CD44 proteins expressed on a metastatic rat tumor cell line are derived from different splice variants：Each one individually suffices to confer metastatic behaviour.Cancer Res.53： 1262-1268(1993).

Screaton，G.R.，Bell，M.V.，Jackson，D.G.，Cornelis，F.B.，Gerth，U.，and Bell， J.I.Genomic structure of DNA encoding the lymphocyte homing receptor CD44 reveals at least 12 alternatively spliced exons.Proc.Natl.Acad.Sci.U.S.A. 89：12160-12164(1992).

Sharkey，R.M.，Natale，A.，Goldenberg，D.M.，and Mattes，M.J.Rapid blood clearance of immunoglobulin G2a and immunoglobulin G2b in nude mice.

CancerRes.，51：3102-3107，1991.

Tolg，C.，Hofmann，M.，Herrlich，P.，and Ponta，H.Splicing choice from ten variant exons establishes CD44 variability.Nucleic Acids.Res.21： 1225-1229(1993).

Van Gog，F.B.，Visser，G.W.M.，Stroomer，J.W.G.，Roos，J.C.，Snow，G.B.， and Van Dongen，G.A.M.S.High dose ¹⁸⁶Re-labeling of monoclonal antibodies for clinical application：pitfalls and solutions.Cancer，80：2360-2370，1997a.

Van Gog，F.B.，Brakenhoff，R.H.，Snow，G.B.，and Van Dongen，G.A.M.S. Rapid elimination of mouse/human chimeric monoclonal antibodies in nude mice. Cancer Immunol.Immunother.，44：103-111，1997b.

Wielenga，V.J.M.，Heider，K.-H.，Offerhaus，G.J.A.，Adolf，G.R.，van den Berg，F.M.，Ponta，H.，Herrlich，P.，Pals，S.T.Expression of CD44 variant proteins in human colorectal cancer is related to tumor progression.Cancer Res. 53：4754-4756(1993).

Example 2 sequences describe in detail

This example illustrates detailed sequence, such as the position of cloning site, and the zone of targeting sequencing and untranslated.

Abbreviation:

Aa=amino acid

The nt=nucleotide sequence

SEQ ID No.1 VH BIWA 4/8aa

EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYDMSWVRQAPGKGLEWVSTISSGGSY

TYYLDSIKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARQGLDYWGRGTLVTVSS

SEQ ID No.2 VL BIWA 4aa

EIVLTQSPATLSLSPGERATLSCSASSSINYIYWYQQKPGQAPRLLIYLTSNLASGVPAR

FSGSGSGTDFTLTISSLEPEDFAVYYCLQWSSNPLTFGGGTKVEIK

SEQ ID No.3 VL BIWA 8aa

EIVLTQSPATLSLSPGERATLSCSASSSINYIYWLQQKPGQAPRILIYLTSNLASGVPARF

SGSGSGTDFTLTISSLEPEDFAVYYCLQWSSNPLTFGGGTKVEIK

SEQ ID No.4 VH BIWA 4/8nt

GAAGTGCAGCTGGTGGAGTCTGGGGGAGGCTTAGTGAAGCCTGGAGGGTCCCTAAGACTCTCC

TGTGCAGCCTCTGGATTCACTTTCAGTAGCTATGACATGTCTTGGGTTCGCCAGGCTCCGGGG

AAGGGGCTGGAGTGGGTCTCAACCATTAGTAGTGGTGGTAGTTACACCTACTATCTAGACAGT

ATAAAGGGCCGATTCACCATCTCCAGAGACAATGCCAAGAACTCCCTGTACCTGCAAATGAAC

AGTCTGAGGGCTGAGGACACGGCCGTGTATTACTGTGCAAGACAGGGGTTGGACTACTGGGGT

CGAGGAACCTTAGTCACCGTCTCCTCA

SEQ ID No.5 VL BIWA 4nt

GAAATTGTTCTCACCCAGTCTCCAGCAACCCTGTCTCTGTCTCCAGGGGAGAGGGCCACCCTG

TCCTGCAGTGCCAGCTCAAGTATAAATTACATATACTGGTACCAGCAGAAGCCAGGACAGGCT

CCTAGACTCTTGATTTATCTCACATCCAACCTGGCTTCTGGAGTCCCTGCGCGCTTCAGTGGC

AGTGGGTCTGGAACCGACTTCACTCTCACAATCAGCAGCCTGGAGCCTGAAGATTTTGCCGTT

TATTACTGCCTGCAGTGGAGTAGTAACCCGCTCACATTCGGTGGTGGGACCAAGGTGGAGATT

AAA

SEQ ID No.6 VL BIWA 8nt

GAAATTGTTCTCACCCAGTCTCCAGCAACCCTGTCTCTGTCTCCAGGGGAGAGGGCCACCCTG

TCCTGCAGTGCCAGCTCAAGTATAAATTACATATACTGGCTCCAGCAGAAGCCAGGACAGGCT

CCTAGAATCTTGATTTATCTCACATCCAACCTGGCTTCTGGAGTCCCTGCGCGCTTCAGTGGC

AGTGGGTCTGGAACCGACTTCACTCTCACAATCAGCAGCCTGGAGCCTGAAGATTTTGCCGTT

TATTACTGCCTGCAGTGGAGTAGTAACCCGCTCACATTCGGTGGTGGGACCAAGGTGGAGATT

AAA

SEQ ID No.7 heavy chain (variable+fixing) BIWA 4/8aa

EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYDMSWVRQAPGKGLEWVSTISSGGSY

TYYLDSIKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARQGLDYWGRGTLVTVSS

ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQ

SSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEL

LGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKP

REEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQV

YTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL

YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

SEQ ID No.8 light chain (variable+fixing) BIWA 4aa

EIVLTQSPATLSLSPGERATLSCSASSSINYIYWYQQKPGQAPRLLIYLTSNLASGVPAR

FSGSGSGTDFTLTISSLEPEDFAVYYCLQWSSNPLTFGGGTKVEIKRTVAAPSVFIFPPS

DEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSST

LTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

SEQ ID No.9 light chain (variable+fixing) BIWA 8aa

EIVLTQSPATLSLSPGERATLSCSASSSINYIYWLQQKPGQAPRILIYLTSNLASGVPARF

SGSGSGTDFTLTISSLEPEDFAVYYCLQWSSNPLTFGGGTKVEIKRTVAAPSVFIFPPSD

EQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL

TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

SEQ ID No.10 heavy chain (variable+fixing) BIWA4/8nt; Intron in pAD-CMV1/pAD-CMV19 contains introne (little letter disk) at the CH1-hinge area, hinge area-CH2, and between CH2-CH3, targeting sequencing represents that with underscore non-translated sequence is italics, the cloning site overstriking

aagctttgacagacgcacaaccctggactcccaagtctttctcttcagtgacaaacacagacataggatatcaca

tttgcttctgacacaactgtgttcactagcagcctcaaacagacacc ATGAACTTTGGGCTCAGCTTGATTTTCC

TTGTCCTAATTTTAAAAGGTGTCCAGTGTGAAGTGCAGCTGGTGGAGTCTGGGGGAGGCTTAGTGAAGCCTGGAG

GGTCCCTAAGACTCTCCTGTGCAGCCTCTGGATTCACTTTCAGTAGCTATGACATGTCTTGGGTTCGCCAGGCTC

CGGGGAAGGGGCTGGAGTGGGTCTCAACCATTAGTAGTGGTGGTAGTTACACCTACTATCTAGACAGTATAAAGG

GCCGATTCACCATCTCCAGAGACAATGCCAAGAACTCCCTGTACCTGCAAATGAACAGTCTGAGGGCTGAGGACA

CGGCCGTGTATTACTGTGCAAGACAGGGGTTGGACTACTGGGGTCGAGGAACCTTAGTCACCGTCTCCTCAGCTA

GCACCAAGGGCCCATCGGTCTTCCCCCTGGCACCCTCCTCCAAGAGCACCTCTGGGGGCACAGCGGCCCTGGGCT

GCCTGGTCAAGGACTACTTCCCCGAACCGGTGACGGTGTCGTGGAACTCAGGCGCCCTGACCAGCGGCGTGCACA

CCTTCCCGGCTGTCCTACAGTCCTCAGGACTCTACTCCCTCAGCAGCGTGGTGACCGTGCCCTCCAGCAGCTTGG

GCACCCAGACCTACATCTGCAACGTGAATCACAAGCCCAGCAACACCAAGGTGGACAAGAAAGTTggtgagaggc

cagcacagggagggagggtgtctgctggaagcaggctcagcgctcctgcctggacgcatcccggctatgcagccc

cagtccagggcagcaaggcaggccccgtctgcctcttcacccggagcctctgcccgccccactcatgctcaggga

gagggtcttctggctttttcccaggctctgggcaggcacaggctaggtgcccctaacccaggccctgcacacaaa

ggggcaggtgctgggctcagacctgccaagagccatatccgggaggaccctgcccctgacctaagcccaccccaa

aggccaaactctccactccctcagctcggacaccttctctcctcccagattccagtaactcccaatcttctctct

gcaGAGCCCAAATCTTGTGACAAAACTCACACATGCCCACCGTGCCCAggtaagccagcccaggcctcgccctcc

agctcaaggcgggacaggtgccctagagtagcctgcatccagggacaggccccagccgggtgctgacacgtccac

ctccatctcttcctcaGCAcCTGAACTCCTGGGGGGACCGTCAGTCTTCCTCTTCCCCCCAAAACCCAAGGACAC

CCTCATGATCTCCCGGACCCCTGAGGTCACATGCGTGGTGGTGGACGTGAGCCACGAAGACCCTGAGGTCAAGTT

CAACTGGTACGTGGACGGCGTGGAGGTGCATAATGCCAAGACAAAGCCGCGGGAGGAGCAGTACAACAGCACGTA

CCGGGTGGTCAGCGTCCTCACCGTCCTGCACCAGGACTGGCTGAATGGCAAGGAGTACAAGTGCAAGGTCTCCAA

CAAAGCCCTCCCAGCCCCCATCGAGAAAACGATCTCCAAAGCCAAAggtgggacccgtggggtgcgagggccaca

tggacagaggccggctcggcccaccctctgccctgagagtgaccgctgtaccaacctctgtcctacaGGGCAGCC

CCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGATGAGCTGACCAAGAACCAGGTCAGCCTGACCTGCCT

GGTCAAAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTACAAGAC

CACGCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACAAGAGCAGGTGGCA

GCAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCACTACACGCAGAAGAGCCTCTCCCT

GTCTCCGGGTAAATGAgtgcgacggccgcgaattc

SEQ ID No.11 light chain (variable+fixing) BIWA 4nt; Line under the sequence in pAD-CMV1/pAD-CMV19, targeting sequencing, non-translated sequence is italics, the cloning site overstriking

aagcttgatcttcaggatatcacatttgcttctgacacaactgtgttcactagcaacctcaaacagacacc ATGG

ATTTTCAGGTGCAGATTTTCAGCTTCCTGCTAATGAGTGCCTCAGTCATAATGTCCAGGGGAGAAATTGTTCTCA

CCCAGTCTCCAGCAACCCTGTCTCTGTCTCCAGGGGAGAGGGCCACCCTGTCCTGCAGTGCCAGCTCAAGTATAA

ATTACATATACTGGTACCAGCAGAAGCCAGGACAGGCTCCTAGACTCTTGATTTATCTCACATCCAACCTGGCTT

CTGGAGTCCCTGCGCGCTTCAGTGGCAGTGGGTCTGGAACCGACTTCACTCTCACAATCAGCAGCCTGGAGCCTG

AAGATTTTGCCGTTTATTACTGCCTGCAGTGGAGTAGTAACCCGCTCACATTCGGTGGTGGGACCAAGGTGGAGA

TTAAACGGACTGTGGCTGCACCATCTGTCTTCATCTTCCCGCCATCTGATGAGCAGTTGAAATCTGGAACTGCTA

GCGTTGTGTGCCTGCTGAATAACTTCTATCCCAGAGAGGCCAAAGTACAGTGGAAGGTGGATAACGCCCTCCAAT

CGGGTAACTCCCAGGAGAGTGTCACAGAGCAGGACAGCAAGGACAGCACCTACAGCCTCAGCAGCACCCTGACGC

TGAGCAAAGCAGACTACGAGAAACACAAAGTCTACGCCTGCGAAGTCACCCATCAGGGCCTGAGCTCGCCCGTCA

CAAAGAGCTTCAACAGGGGAGAGTGTTAGgaattc

SEQ ID No.12 light chain (variable+fixing) BIWA 8nt; Sequence exists

Among the pAD-CMV1/pAD-CMV19, line under the targeting sequencing, non-translated sequence is italics, the cloning site overstriking

aagcttgatcttcaggatatcacatttgcttctgacacaactgtgttcactagcaacctcaaacagacacc ATGG

ATTTTCAGGTGCAGATTTTCAGCTTCCTGCTAATGAGTGCCTCAGTCATAATGTCCAGGGGAGAAATTGTTCTCA

CCCAGTCTCCAGCAACCCTGTCTCTGTCTCCAGGGGAGAGGGCCACCCTGTCCTGCAGTGCCAGCTCAAGTATAA

ATTACATATACTGGCTCCAGCAGAAGCCAGGACAGGCTCCTAGAATCTTGATTTATCTCACATCCAACCTGGCTT

CTGGAGTCCCTGCGCGCTTCAGTGGCAGTGGGTCTGGAACCGACTTCACTCTCACAATCAGCAGCCTGGAGCCTG

AAGATTTTGCCGTTTATTACTGCCTGCAGTGGAGTAGTAACCCGCTCACATTCGGTGGTGGGACCAAGGTGGAGA

TTAAACGGACTGTGGCTGCACCATCTGTCTTCATCTTCCCGCCATCTGATGAGCAGTTGAAATCTGGAACTGCTA

GCGTTGTGTGCCTGCTGAATAACTTCTATCCCAGAGAGGCCAAAGTACAGTGGAAGGTGGATAACGCCCTCCAAT

CGGGTAACTCCCAGGAGAGTGTCACAGAGCAGGACAGCAAGGACAGCACCTACAGCCTCAGCAGCACCCTGACGC

TGAGCAAAGCAGACTACGAGAAACACAAAGTCTACGCCTGCGAAGTCACCCATCAGGGCCTGAGCTCGCCCGTCA

CAAAGAGCTTCAACAGGGGAGAGTGTTAGgaattc

SEQ ID No.13 heavy chain (variable+fixing) BIWA 4/8nt; Sequence does not contain introne in N5KG1Val, line under the targeting sequencing

ATGGAGTTTGGGCTGAGCTGGCTTTTTCTTGTGGCTATTTTAAAAGGTGTCCAGTGTGAAGTG

CAGCTGGTGGAGTCTGGGGGAGGCTTAGTGAAGCCTGGAGGGTCCCTAAGACTCTCCTGTGCA

GCCTCTGGATTCACTTTCAGTAGCTATGACATGTCTTGGGTTCGCCAGGCTCCGGGGAAGGGG

CTGGAGTGGGTCTCAACCATTAGTAGTGGTGGTAGTTACACCTACTATCTAGACAGTATAAAG

GGCCGATTCACCATCTCCAGAGACAATGCCAAGAACTCCCTGTACCTGCAAATGAACAGTCTG

AGGGCTGAGGACACGGCCGTGTATTACTGTGCAAGACAGGGGTTGGACTACTGGGGTCGAGGA

ACCTTAGTCACCGTCTCCTCAGCTAGCACCAAGGGCCCATCGGTCTTCCCCCTGGCACCCTCC

TCCAAGAGCACCTCTGGGGGCACAGCGGCCCTGGGCTGCCTGGTCAAGGACTACTTCCCCGAA

CCGGTGACGGTGTCGTGGAACTCAGGCGCCCTGACCAGCGGCGTGCACACCTTCCCGGCTGTC

CTACAGTCCTCAGGACTCTACTCCCTCAGCAGCGTGGTGACCGTGCCCTCCAGCAGCTTGGGC

ACCCAGACCTACATCTGCAACGTGAATCACAAGCCCAGCAACACCAAGGTGGACAAGAAAGTT

GAGCCCAAATCTTGTGACAAAACTCACACATGCCCACCGTGCCCAGCACCTGAACTCCTGGGG

GGACCGTCAGTCTTCCTCTTCCCCCCAAAACCCAAGGACACCCTCATGATCTCCCGGACCCCT

GAGGTCACATGCGTGGTGGTGGACGTGAGCCACGAAGACCCTGAGGTCAAGTTCAACTGGTAC

GTGGACGGCGTGGAGGTGCATAATGCCAAGACAAAGCCGCGGGAGGAGCAGTACAACAGCACG

TACCGTGTGGTCAGCGTCCTCACCGTCCTGCACCAGGACTGGCTGAATGGCAAGGAGTACAAG

TGCAAGGTCTCCAACAAAGCCCTCCCAGCCCCCATCGAGAAAACCATCTCCAAAGCCAAAGGG

CAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGATGAGCTGACCAAGAACCAG

GTCAGCCTGACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGC

AATGGGCAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGCTGGACTCCGACGGCTCCTTC

TTCCTCTACAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGC

TCCGTGATGCATGAGGCTCTGCACAACCACTACACGCAGAAGAGCCTCTCCCTGTCTCCGGGT

AAATGA

SEQ ID No.14 light chain (variable+fixing) BIWA 4nt; Sequence is rule under the targeting sequencing in N5KG1Val

ATGGAAGCCCCAGCTCAGCTTCTCTTCCTCCTGCTGCTCTGGCTCCCAGATACCACCGGAGAA

ATTGTTCTCACCCAGTCTCCAGCAACCCTGTCTCTGTCTCCAGGGGAGAGGGCCACCCTGTCC

TGCAGTGCCAGCTCAAGTATAAATTACATATACTGGTACCAGCAGAAGCCAGGACAGGCTCCT

AGACTCTTGATTTATCTCACATCCAACCTGGCTTCTGGAGTCCCTGCGCGCTTCAGTGGCAGT

GGGTCTGGAACCGACTTCACTCTCACAATCAGCAGCCTGGAGCCTGAAGATTTTGCCGTTTAT

TACTGCCTGCAGTGGAGTAGTAACCCGCTCACATTCGGTGGTGGGACCAAGGTGGAGATTAAA

CGTACGGTGGCTGCACCATCTGTCTTCATCTTCCCGCCATCTGATGAGCAGTTGAAATCTGGA

ACTGCCTCTGTTGTGTGCCTGCTGAATAACTTCTATCCCAGAGAGGCCAAAGTACAGTGGAAG

GTGGATAACGCCCTCCAATCGGGTAACTCCCAGGAGAGTGTCACAGAGCAGGACAGCAAGGAC

AGCACCTACAGCCTCAGCAGCACCCTGACGCTGAGCAAAGCAGACTACGAGAAACACAAAGTC

TACGCCTGCGAAGTCACCCATCAGGGCCTGAGCTCGCCCGTCACAAAGAGCTTCAACAGGGGA

GAGTGTTGA

SEQ ID No.15 light chain (variable+fixing) BIWA 8nt; Sequence is rule under the targeting sequencing in N5KG1Val

ATGGAAGCCCCAGCTCAGCTTCTCTTCCTCCTGCTGCTCTGGCTCCCAGATACCACCGGAGAA

ATTGTTCTCACCCAGTCTCCAGCAACCCTGTCTCTGTCTCCAGGGGAGAGGGCCACCCTGTCC

TGCAGTGCCAGCTCAAGTATAAATTACATATACTGGCTCCAGCAGAAGCCAGGACAGGCTCCT

AGAATCTTGATTTATCTCACATCCAACCTGGCTTCTGGAGTCCCTGCGCGCTTCAGTGGCAGT

GGGTCTGGAACCGACTTCACTCTCACAATCAGCAGCCTGGAGCCTGAAGATTTTGCCGTTTAT

TACTGCCTGCAGTGGAGTAGTAACCCGCTCACATTCGGTGGTGGGACCAAGGTGGAGATTAAA

CGTACGGTGGCTGCACCATCTGTCTTCATCTTCCCGCCATCTGATGAGCAGTTGAAATCTGGA

ACTGCCTCTGTTGTGTGCCTGCTGAATAACTTCTATCCCAGAGAGGCCAAAGTACAGTGGAAG

GTGGATAACGCCCTCCAATCGGGTAACTCCCAGGAGAGTGTCACAGAGCAGGACAGCAAGGAC

AGCACCTACAGCCTCAGCAGCACCCTGACGCTGAGCAAAGCAGACTACGAGAAACACAAAGTC

TACGCCTGCGAAGTCACCCATCAGGGCCTGAGCTCGCCCGTCACAAAGAGCTTCAACAGGGGA

GAGTGTTGA

SEQ ID No.16 BIWA4 is in N5KG1Val

CTGACGCGCCCTGTAGCGGCGCATTAAGCGCGGCGGGTGTGGTGGTTACGCGCAGCGTGACCG

CTACACTTGCCAGCGCCCTAGCGCCCGCTCCTTTCGCTTTCTTCCCTTCCTTTCTCGCCACGT

TCGCCGGCTTTCCCCGTCAAGCTCTAAATCGGGGGCTCCCTTTAGGGTTCCGATTTAGTGCTT

TACGGCACCTCGACCCCAAAAAACTTGATTAGGGTGATGGTTCACGTAGGGTCGCGACGTACC

GGGCCCCCCCTCGATTAATTAATCGAGCTACTAGCTTTGCTTCTCAATTTCTTATTTGCATAA

TGAGAAAAAAAGGAAAATTAATTTTAACACCAATTCAGTAGTTGATTGAGCAAATGCGTTGCC

AAAAAGGATGCTTTAGAGACAGTGTTCTCTGCACAGATAAGGACAAACATTATTCAGAGGGAG

TACCCAGAGCTGAGACTCCTAAGCCAGTGAGTGGCACAGCATTCTAGGGAGAAATATGCTTGT

CATCACCGAAGCCTGATTCCGTAGAGCCACACCTTGGTAAGGGCCAATCTGCTCACACAGGAT

AGAGAGGGCAGGAGCCAGGGCAGAGCATATAAGGTGAGGTAGGATCAGTTGCTCCTCACATTT

GCTTCTGACATAGTTGTGCCAGCATGGAGGAATCGATCCTCCATGCTTGAACAAGATGGATTG

CACGCAGGTTCTCCGGCCGCTTGGGTGGAGAGGCTATTCGGCTATGACTGGGCACAACAGACA

ATCGGCTGCTCTGATGCCGCCGTGTTCCGGCTGTCAGCGCAGGGGCGCCCGGTTCTTTTTGTC

AAGACCGACCTGTCCGGTGCCCTGAATGAACTGCAGGTAAGTGCGGCCGCTCTAGGCCTCCAA

AAAAGCCTCCTCACTACTTCTGGAATAGCTCAGAGGCCGAGGCGGCCTCGGCCTCTGCATAAA

TAAAAAAAATTAGTCAGCCATGCATGGGGCGGAGAATGGGCGGAACTGGGCGGAGTTAGGGGC

GGGATGGGCGGAGTTAGGGGCGGGACTATGGTTGCTGACTAATTGAGATGCATGCTTTGCATA

CTTCTGCCTGCTGGGGAGCCTGGGGACTTTCCACACCTGGTTGCTGACTAATTGAGATGCATG

CTTTGCATACTTCTGCCTGCTGGGGAGCCTGGGGACTTTCCACACCCTAACTGACACACATTC

CACAGAATTAATTCCCCTAGTTATTAATAGTAATCAATTACGGGGTCATTAGTTCATAGCCCA

TATATGGAGTTCCGCGTTACATAACTTACGGTAAATGGCCCGCCTGGCTGACCGCCCAACGAC

CCCCGCCCATTGACGTCAATAATGACGTATGTTCCCATAGTAACGCCAATAGGGACTTTCCAT

TGACGTCAATGGGTGGACTATTTACGGTAAACTGCCCACTTGGCAGTACATCAAGTGTATCAT

ATGCCAAGTACGCCCCCTATTGACGTCAATGACGGTAAATGGCCCGCCTGGCATTATGCCCAG

TACATGACCTTATGGGACTTTCCTACTTGGCAGTACATCTACGTATTAGTCATCGCTATTACC

ATGGTGATGCGGTTTTGGCAGTACATCAATGGGCGTGGATAGCGGTTTGACTCACGGGGATTT

CCAAGTCTCCACCCCATTGACGTCAATGGGAGTTTGTTTTGGCACCAAAATCAACGGGACTTT

CCAAAATGTCGTAACAACTCCGCCCCATTGACGCAAATGGGCGGTAGGCGTGTACGGTGGGAG

GTCTATATAAGCAGAGCTGGGTACGTGAACCGTCAGATCGCCTGGAGACGCCATCACAGATCT

CTCACCATGGAAGCCCCAGCTCAGCTTCTCTTCCTCCTGCTGCTCTGGCTCCCAGATACCACC

GGAGAAATTGTTCTCACCCAGTCTCCAGCAACCCTGTCTCTGTCTCCAGGGGAGAGGGCCACC

CTGTCCTGCAGTGCCAGCTCAAGTATAAATTACATATACTGGTACCAGCAGAAGCCAGGACAG

GCTCCTAGACTCTTGATTTATCTCACATCCAACCTGGCTTCTGGAGTCCCTGCGCGCTTCAGT

GGCAGTGGGTCTGGAACCGACTTCACTCTCACAATCAGCAGCCTGGAGCCTGAAGATTTTGCC

GTTTATTACTGCCTGCAGTGGAGTAGTAACCCGCTCACATTCGGTGGTGGGACCAAGGTGGAG

ATTAAACGTACGGTGGCTGCACCATCTGTCTTCATCTTCCCGCCATCTGATGAGCAGTTGAAA

TCTGGAACTGCCTCTGTTGTGTGCCTGCTGAATAACTTCTATCCCAGAGAGGCCAAAGTACAG

TGGAAGGTGGATAACGCCCTCCAATCGGGTAACTCCCAGGAGAGTGTCACAGAGCAGGACAGC

AAGGACAGCACCTACAGCCTCAGCAGCACCCTGACGCTGAGCAAAGCAGACTACGAGAAACAC

AAAGTCTACGCCTGCGAAGTCAC

CCATCAGGGCCTGAGCTCGCCCGTCACAAAGAGCTTCAACAGGGGAGAGTGTTGAATTCAGAT

CCGTTAACGGTTACCAACTACCTAGACTGGATTCGTGACAACATGCGGCCGTGATATCTACGT

ATGATCAGCCTCGACTGTGCCTTCTAGTTGCCAGCCATCTGTTGTTTGCCCCTCCCCCGTGCC

TTCCTTGACCCTGGAAGGTGCCACTCCCACTGTCCTTTCCTAATAAAATGAGGAAATTGCATC

GCATTGTCTGAGTAGGTGTCATTCTATTCTGGGGGGTGGGGTGGGGCAGGACAGCAAGGGGGA

GGATTGGGAAGACAATAGCAGGCATGCTGGGGATGCGGTGGGCTCTATGGAACCAGCTGGGAC

TAGTAGCTTTGCTTCTCAATTTCTTATTTGCATAATGAGAAAAAAAGGAAAATTAATTTTAAC

ACCAATTCAGTAGTTGATTGAGCAAATGCGTTGCCAAAAAGGATGCTTTAGAGACAGTGTTCT

CTGCACAGATAAGGACAAACATTATTCAGAGGGAGTACCCAGAGCTGAGACTCCTAAGCCAGT

GAGTGGCACAGCATTCTAGGGAGAAATATGCTTGTCATCACCGAAGCCTGATTCCGTAGAGCC

ACACCTTGGTAAGGGCCAATCTGCTCACACAGGATAGAGAGGGCAGGAGCCAGGGCAGAGCAT

ATAAGGTGAGGTAGGATCAGTTGCTCCTCACATTTGCTTCTGACATAGTTGTGTTGGGAGCTT

GGATAGCTTGGACAGCTCAGGGCTGCGATTTCGCGCCAAACTTGACGGCAATCCTAGCGTGAA

GGCTGGTAGGATTTTATCCCCGCTGCCATCATGGTTCGACCATTGAACTGCATCGTCGCCGTG

TCCCAAAATATGGGGATTGGCAAGAACGGAGACCTACCCTGGCCTCCGCTCAGGAACGAGTTC

AAGTACTTCCAAAGAATGACCACAACCTCTTCAGTGGAAGGTAAACAGAATCTGGTGATTATG

GGTAGGAAAACCTGGTTCTCCATTCCTGAGAAGAATCGACCTTTAAAGGACAGAATTAATATA

GTTCTCAGTAGAGAACTCAAAGAACCACCACGAGGAGCTCATTTTCTTGCCAAAAGTTTGGAT

GATGCCTTAAGACTTATTGAACAACCGGAATTGGCAAGTAAAGTAGACATGGTTTGGATAGTC

GGAGGCAGTTCTGTTTACCAGGAAGCCATGAATCAACCAGGCCACCTTAGACTCTTTGTGACA

AGGATCATGCAGGAATTTGAAAGTGACACGTTTTTCCCAGAAATTGATTTGGGGAAATATAAA

CTTCTCCCAGAATACCCAGGCGTCCTCTCTGAGGTCCAGGAGGAAAAAGGCATCAAGTATAAG

TTTGAAGTCTACGAGAAGAAAGACTAACAGGAAGATGCTTTCAAGTTCTCTGCTCCCCTCCTA

AAGCTATGCATTTTTATAAGACCATGGGACTTTTGCTGGCTTTAGATCAGCCTCGACTGTGCC

TTCTAGTTGCCAGCCATCTGTTGTTTGCCCCTCCCCCGTGCCTTCCTTGACCCTGGAAGGTGC

CACTCCCACTGTCCTTTCCTAATAAAATGAGGAAATTGCATCGCATTGTCTGAGTAGGTGTCA

TTCTATTCTGGGGGGTGGGGTGGGGCAGGACAGCAAGGGGGAGGATTGGGAAGACAATAGCAG

GCATGCTGGGGATGCGGTGGGCTCTATGGAACCAGCTGGGGCTCGAAGCGGCCGCTCCGGATA

TGCCAAGTACGCCCCCTATTGACGTCAATGACGGTAAATGGCCCGCCTGGCATTATGCCCAGT

ACATGACCTTATGGGACTTTCCTACTTGGCAGTACATCTACGTATTAGTCATCGCTATTACCA

TGGTGATGCGGTTTTGGCAGTACATCAATGGGCGTGGATAGCGGTTTGACTCACGGGGATTTC

CAAGTCTCCACCCCATTGACGTCAATGGGAGTTTGTTTTGGCACCAAAATCAACGGGACTTTC

CAAAATGTCGTAACAACTCCGCCCCATTGACGCAAATGGGCGGTAGGCGTGTACGGTGGGAGG

TCTATATAAGCAGAGCTGGGTACGTCCTCACATTCAGTGATCAGCACTGAACACAGACCCGTC

GACATGGAGTTTGGGCTGAGCTGGCTTTTTCTTGTGGCTATTTTAAAAGGTGTCCAGTGTGAA

GTGCAGCTGGTGGAGTCTGGGGGAGGCTTAGTGAAGCCTGGAGGGTCCCTAAGACTCTCCTGT

GCAGCCTCTGGATTCACTTTCAGTAGCTATGACATGTCTTGGGTTCGCCAGGCTCCGGGGAAG

GGGCTGGAGTGGGTCTCAACCATTAGTAGTGGTGGTAGTTACACCTACTATCTAGACAGTATA

AAGGGCCGATTCACCATCTCCAGAGACAATGCCAAGAACTCCCTGTACCTGCAAATGAACAGT

CTGAGGGCTGAGGACACGGCCGT

GTATTACTGTGCAAGACAGGGGTTGGACTACTGGGGTCGAGGAACCTTAGTCACCGTCTCCTC

AGCTAGCACCAAGGGCCCATCGGTCTTCCCCCTGGCACCCTCCTCCAAGAGCACCTCTGGGGG

CACAGCGGCCCTGGGCTGCCTGGTCAAGGACTACTTCCCCGAACCGGTGACGGTGTCGTGGAA

CTCAGGCGCCCTGACCAGCGGCGTGCACACCTTCCCGGCTGTCCTACAGTCCTCAGGACTCTA

CTCCCTCAGCAGCGTGGTGACCGTGCCCTCCAGCAGCTTGGGCACCCAGACCTACATCTGCAA

CGTGAATCACAAGCCCAGCAACACCAAGGTGGACAAGAAAGTTGAGCCCAAATCTTGTGACAA

AACTCACACATGCCCACCGTGCCCAGCACCTGAACTCCTGGGGGGACCGTCAGTCTTCCTCTT

CCCCCCAAAACCCAAGGACACCCTCATGATCTCCCGGACCCCTGAGGTCACATGCGTGGTGGT

GGACGTGAGCCACGAAGACCCTGAGGTCAAGTTCAACTGGTACGTGGACGGCGTGGAGGTGCA

TAATGCCAAGACAAAGCCGCGGGAGGAGCAGTACAACAGCACGTACCGTGTGGTCAGCGTCCT

CACCGTCCTGCACCAGGACTGGCTGAATGGCAAGGAGTACAAGTGCAAGGTCTCCAACAAAGC

CCTCCCAGCCCCCATCGAGAAAACCATCTCCAAAGCCAAAGGGCAGCCCCGAGAACCACAGGT

GTACACCCTGCCCCCATCCCGGGATGAGCTGACCAAGAACCAGGTCAGCCTGACCTGCCTGGT

CAAAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAA

CTACAAGACCACGCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAAGCTCAC

CGTGGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGCTCT

GCACAACCACTACACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAATGAGGATCCGTTAACGG

TTACCAACTACCTAGACTGGATTCGTGACAACATGCGGCCGTGATATCTACGTATGATCAGCC

TCGACTGTGCCTTCTAGTTGCCAGCCATCTGTTGTTTGCCCCTCCCCCGTGCCTTCCTTGACC

CTGGAAGGTGCCACTCCCACTGTCCTTTCCTAATAAAATGAGGAAATTGCATCGCATTGTCTG

AGTAGGTGTCATTCTATTCTGGGGGGTGGGGTGGGGCAGGACAGCAAGGGGGAGGATTGGGAA

GACAATAGCAGGCATGCTGGGGATGCGGTGGGCTCTATGGAACCAGCTGGGGCTCGACAGCGC

TGCGATCGCCTCGAGGCCGCTACTAACTCTCTCCTCCCTCCTTTTTCCTGCAGGACGAGGCAG

CGCGGCTATCGTGGCTGGCCACGACGGGCGTTCCTTGCGCAGCTGTGCTCGACGTTGTCACTG

AAGCGGGAAGGGACTGGCTGCTATTGGGCGAAGTGCCGGGGCAGGATCTCCTGTCATCTCACC

TTGCTCCTGCCGAGAAAGTATCCATCATGGCTGATGCAATGCGGCGGCTGCATACGCTTGATC

CGGCTACCTGCCCATTCGACCACCAAGCGAAACATCGCATCGAGCGAGCACGTACTCGGATGG

AAGCCGGTCTTGTCGATCAGGATGATCTGGACGAAGAGCATCAGGGGCTCGCGCCAGCCGAAC

TGTTCGCCAGGCTCAAGGCGCGCATGCCCGACGGCGAGGATCTCGTCGTGACCCATGGCGATG

CCTGCTTGCCGAATATCATGGTGGAAAATGGCCGCTTTTCTGGATTCATCGACTGTGGCCGGC

TGGGTGTGGCGGACCGCTATCAGGACATAGCGTTGGCTACCCGTGATATTGCTGAAGAGCTTG

GCGGCGAATGGGCTGACCGCTTCCTCGTGCTTTACGGTATCGCCGCTCCCGATTCGCAGCGCA

TCGCCTTCTATCGCCTTCTTGACGAGTTCTTCTGAGCGGGACTCTGGGGTTCGAAATGACCGA

CCAAGCGACGCCCAACCTGCCATCACGAGATTTCGATTCCACCGCCGCCTTCTATGAAAGGTT

GGGCTTCGGAATCGTTTTCCGGGACGCCGGCTGGATGATCCTCCAGCGCGGGGATCTCATGCT

GGAGTTCTTCGCCCACCCCAACTTGTTTATTGCAGCTTATAATGGTTACAAATAAAGCAATAG

CATCACAAATTTCACAAATAAAGCATTTTTTTCACTGCATTCTAGTTGTGGTTTGTCCAAACT

CATCAATCTATCTTATCATGTCTGGATCGCGGCCGGCCGCACCGCGGTGGAGCTTTAATTAAG

GCGCGCCAGCTCCAGCTTTTGTTCCCTTTAGTGAGGGTTAATTTCGAGCTTGGCGTAATCATG

GTCATAGCTGTTTCCTGTGTGAA

ATTGTTATCCGCTCACAATTCCACACAACATACGAGCCGGAAGCATAAAGTGTAAAGCCTGGG

GTGCCTAATGAGTGAGCTAACTCACATTAATTGCGTTGCGCTCACTGCCCGCTTTCCAGTCGG

GAAACCTGTCGTGCCAGCTGCATTAATGAATCGGCCAACGCGCGGGGAGAGGCGGTTTGCGTA

TTGGGCGCTCTTCCGCTTCCTCGCTCACTGACTCGCTGCGCTCGGTCGTTCGGCTGCGGCGAG

CGGTATCAGCTCACTCAAAGGCGGTAATACGGTTATCCACAGAATCAGGGGATAACGCAGGAA

AGAACATGTGAGCAAAAGGCCAGCAAAAGGCCAGGAACCGTAAAAAGGCCGCGTTGCTGGCGT

TTTTCCATAGGCTCCGCCCCCCTGACGAGCATCACAAAAATCGACGCTCAAGTCAGAGGTGGC

GAAACCCGACAGGACTATAAAGATACCAGGCGTTTCCCCCTGGAAGCTCCCTCGTGCGCTCTC

CTGTTCCGACCCTGCCGCTTACCGGATACCTGTCCGCCTTTCTCCCTTCGGGAAGCGTGGCGC

TTTCTCATAGCTCACGCTGTAGGTATCTCAGTTCGGTGTAGGTCGTTCGCTCCAAGCTGGGCT

GTGTGCACGAACCCCCCGTTCAGCCCGACCGCTGCGCCTTATCCGGTAACTATCGTCTTGAGT

CCAACCCGGTAAGACACGACTTATCGCCACTGGCAGCAGCCACTGGTAACAGGATTAGCAGAG

CGAGGTATGTAGGCGGTGCTACAGAGTTCTTGAAGTGGTGGCCTAACTACGGCTACACTAGAA

GGACAGTATTTGGTATCTGCGCTCTGCTGAAGCCAGTTACCTTCGGAAAAAGAGTTGGTAGCT

CTTGATCCGGCAAACAAACCACCGCTGGTAGCGGTGGTTTTTTTGTTTGCAAGCAGCAGATTA

CGCGCAGAAAAAAAGGATCTCAAGAAGATCCTTTGATCTTTTCTACGGGGTCTGACGCTCAGT

GGAACGAAAACTCACGTTAAGGGATTTTGGTCATGAGATTATCAAAAAGGATCTTCACCTAGA

TCCTTTTAAATTAAAAATGAAGTTTTAAATCAATCTAAAGTATATATGAGTAAACTTGGTCTG

ACAGTTACCAATGCTTAATCAGTGAGGCACCTATCTCAGCGATCTGTCTATTTCGTTCATCCA

TAGTTGCCTGACTCCCCGTCGTGTAGATAACTACGATACGGGAGGGCTTACCATCTGGCCCCA

GTGCTGCAATGATACCGCGAGACCCACGCTCACCGGCTCCAGATTTATCAGCAATAAACCAGC

CAGCCGGAAGGGCCGAGCGCAGAAGTGGTCCTGCAACTTTATCCGCCTCCATCCAGTCTATTA

ATTGTTGCCGGGAAGCTAGAGTAAGTAGTTCGCCAGTTAATAGTTTGCGCAACGTTGTTGCCA

TTGCTACAGGCATCGTGGTGTCACGCTCGTCGTTTGGTATGGCTTCATTCAGCTCCGGTTCCC

AACGATCAAGGCGAGTTACATGATCCCCCATGTTGTGCAAAAAAGCGGTTAGCTCCTTCGGTC

CTCCGATCGTTGTCAGAAGTAAGTTGGCCGCAGTGTTATCACTCATGGTTATGGCAGCACTGC

ATAATTCTCTTACTGTCATGCCATCCGTAAGATGCTTTTCTGTGACTGGTGAGTACTCAACCA

AGTCATTCTGAGAATAGTGTATGCGGCGACCGAGTTGCTCTTGCCCGGCGTCAATACGGGATA

ATACCGCGCCACATAGCAGAACTTTAAAAGTGCTCATCATTGGAAAACGTTCTTCGGGGCGAA

AACTCTCAAGGATCTTACCGCTGTTGAGATCCAGTTCGATGTAACCCACTCGTGCACCCAACT

GATCTTCAGCATCTTTTACTTTCACCAGCGTTTCTGGGTGAGCAAAAACAGGAAGGCAAAATG

CCGCAAAAAAGGGAATAAGGGCGACACGGAAATGTTGAATACTCATACTCTTCCTTTTTCAAT

ATTATTGAAGCATTTATCAGGGTTATTGTCTCATGAGCGGATACATATTTGAATGTATTTAGA

AAAATAAACAAATAGGGGTTCCGCGCACATTTCCCCGAAAAGTGCCACA

SEQ ID No.17 pAD-CMV1, the cloning site overstriking

TCGACATTGATTATTGACTAGTTATTAATAGTAATCAATTACGGGGTCATTAGTTCATAGCCCATATATGGAGTT

CCGCGTTACATAACTTACGGTAAATGGCCCGCCTGGCTGACCGCCCAACGACCCCCGCCCATTGACGTCAATAAT

GACGTATGTTCCCATAGTAACGCCAATAGGGACTTTCCATTGACGTCAATGGGTGGAGTATTTACGGTAAACTGC

CCACTTGGCAGTACATCAAGTGTATCATATGCCAAGTACGCCCCCTATTGACGTCAATGACGGTAAATGGCCCGC

CTGGCATTATGCCCAGTACATGACCTTATGGGACTTTCCTACTTGGCAGTACATCTACGTATTAGTCATCGCTAT

TACCATGGTGATGCGGTTTTGGCAGTACATCAATGGGCGTGGATAGCGGTTTGACTCACGGGGATTTCCAAGTCT

CCACCCCATTGACGTCAATGGGAGTTTGTTTTGGCACCAAAATCAACGGGACTTTCCAAAATGTCGTAACAACTC

CGCCCCATTGACGCAAATGGGCGGTAGGCGTGTACGGTGGGAGGTCTATATAAGCAGAGCTCTCTGGCTAACTAG

AGAACCCACTGCTTAACTGGCTTATCGAAATTAATACGACTCACTATAGGGAGACCCAAGCTTCTGCAGGTCGAC

ATCGATGGATCCGGTACCTCGAGCGCGAATTCTCTAGAGGATCTTTGTGAAGGAACCTTACTTCTGTGGTGTGAC

ATAATTGGACAAACTACCTACAGAGATTTAAAGCTCTAAGGTAAATATAAAATTTTTAAGTGTATAATGTGTTAA

ACTACTGATTCTAATTGTTTGTGTATTTTAGATTCCAACCTATGGAACTGATGAATGGGAGCAGTGGTGGAATGC

CTTTAATGAGGAAAACCTGTTTTGCTCAGAAGAAATGCCATCTAGTGATGATGAGGCTACTGCTGACTCTCAACA

TTCTACTCCTCCAAAAAAGAAGAGAAAGGTAGAAGACCCCAAGGACTTTCCTTCAGAATTGCTAAGTTTTTTGAG

TCATGCTGTGTTTAGTAATAGAACTCTTGCTTGCTTTGCTATTTACACCACAAAGGAAAAAGCTGCACTGCTATA

CAAGAAAATTATGGAAAAATATTTGATGTATAGTGCCTTGACTAGAGATCATAATCAGCCATACCACATTTGTAG

AGGTTTTACTTGCTTTAAAAAACCTCCCACACCTCCCCCTGAACCTGAAACATAAAATGAATGCAATTGTTGTTG

TTAACTTGTTTATTGCAGCTTATAATGGTTACAAATAAAGCAATAGCATCACAAATTTCACAAATAAAGCATTTT

TTTCACTGCATTCTAGTTGTGGTTTGTCCAAACTCATCAATGTATCTTATCATGTCTGGATCAATTCTGAGAAAC

TAGCCTTAAAGACAGACAGCTTTGTTCTAGTCAGCCAGGCAAGCATATGTAAATAAAGTTCCTCAGGGAACTGAG

GTTAAAAGATGTATCCTGGACCTGCCAGACCTGGCCATTCACGTAAACAGAAGATTCCGCCTCAAGTTCCGGTTA

ACAACAGGAGGCAACGAGATCTCAAATCTATTACTTCTAATCGGGTAATTAAAACCTTTCAACTAAAACACGGAC

CCACGGATGTCACCCACTTTTCCTTCCCCGGCTCCGCCCTTCTCAGTACTCCCCACCATTAGGCTCGCTACTCCA

CCTCCACTTCCGGGCGCGACACCCACGTGCCCTCTCCCACCCGACGCTAACCCCGCCCCTGCCCGTCTGACCCCG

CCCACCACCTGGCCCCGCCCCGTTGAGGACAGAAGAAACCCCGGGCAGCCGCAGCCAAGGCGGACGGGTAGACGC

TGGGGGCGCTGAGGAGTCGTCCTCTACCTTCTCTGCTGGCTCGGTGGGGGACGCGGTGGATCTCAGGCTTCCGGA

AGACTGGAAGAACCGGCTCAGAACCGCTTGTCTCCGCGGGGCTTGGGCGGCGGAAGAATGGCCGCTAGACGCGGA

CTTGGTGCGAGGCATCGCAGGATGCAGAAGAGCAAGCCCGCCGGGAGCGCGCGGCTGTACTACCCCGCGCCTGGA

GCGGCCACGCCGGACTGGGCGGGGCCGGCCTGGTGGAGGCGGAGTCTGACCTCGTGGAGGCGGGGCCTCTGATGT

TCAAATAGGATGCTAGGCTTGTTGAGGCGTGGCCTCCGATTCACAAGTGGGAAGCAGCGCCGGGCGACTGCAATT

TCGCGCCAAACTTGGGGGAAGCACAGCGTACAGGCTGCCTAGGTGATCGCTGCTGCTGTCATGGTTCGACCGCTG

AACTGCATCGTCGCCGTGTCCCAGAATATGGGCATCGGCAAGAACGGAGACCTTCCCTGGCCAATGCTCAGGTAC

TGGCTGGATTGGGTTAGGGAAACCGAGGCGGTTCGCTGAATCGGGTCGAGCACTTGGCGGAGACGCGCGGGCCAA

CTACTTAGGGACAGTCATGAGGGGTAGGCCCGCCGGCTGCTGCCCTTGCCCATGCCCGCGGTGATCCCCATGCTG

TGCCAGCCTTTGCCCAGAGGCGCTCTAGCTGGGAGCAAAGTCCGGTCACTGGGCAGCACCACCCCCCGGACTTGC

ATGGGTAGCCGCTGAGATGGAGCCTGAGCACACGTGACAGGGTCCCTGTTAACGCAGTGTTTCTCTAACTTTCAG

GAACGAGTTCAAGTACTTCCAAAGAATGACCACCACCTCCTCAGTGGAAGGTAAACAGAACCTGGTGATTATGGG

CCGGAAAACCTGGTTCTCCATTCCTGAGAAGAATCGACCTTTAAAGGACAGAATTAATATAGTTCTCAGTAGAGA

GCTCAAGGAACCACCACAAGGAGCTCATTTTCTTGCCAAAAGTCTGGACCATGCCTTAAAACTTATTGAACAACC

AGAGTTAGCAGATAAAGTGGACATGGTTTGGATAGTTGGAGGCAGTTCCGTTTACAAGGAAGCCATGAATCAGCC

AGGCCATCTCAGACTCTTTGTGACAAGGATCATGCAGGAATTTGAAAGTGACACGTTCTTCCCAGAAATTGATTT

GGAGAAATATAAACTTCTCCCAGAGTACCCAGGGGTCCTTTCTGAAGTCCAGGAGGAAAAAGGVSTCAAGTATAA

ATTTGAAGTCTATGAGAAGAAAGGCTAACAGAAAGATACTTGCTGATTGACTTCAAGTTCTACTGCTTTCCTCCT

AAAATTATGCATTTTTACAAGACCATGGGACTTGTGTTGGCTTTAGATCCTGTGCATCCTGGGCAACTGTTGTAC

TCTAAGCCACTCCCCAAAGTCATGCCCCAGCCCCTGTATAATTCTAAACAATTAGAATTATTTTCATTTTCATTA

GTCTAACCAGGTTATATTAAATATACTTTAAGAAACACCATTTGCCATAAAGTTCTCAATGCCCCTCCCATGCAG

CCTCAAGTGGCTCCCCAGCAGATGCATAGGGTAGTGTGTGTACAAGAGACCCCAAAGACATAGAGCCCCTGAGAG

CATGAGCTGATATGGGGGCTCATAGAGATAGGAGCTAGATGAATAAGTACAAAGGGCAGAAATGGGTTTTAACCA

GCAGAGCTAGAACTCAGACTTTAAAGAAAATTAGATCAAAGTAGAGACTGAATTATTCTGCACATCAGACTCTGA

GCAGAGTTCTGTTCACTCAGACAGAAAATGGGTAAATTGAGAGCTGGCTCCATTGTGCTCCTTAGAGATGGGAGC

AGGTGGAGGATTATATAAGGTCTGGAACATTTAACTTCTCCGTTTCTCATCTTCAGTGAGATTCCAAGGGATACT

ACAATTCTGTGGAATGTGTGTCAGTTAGGGTGTGGAAAGTCCCCAGGCTCCCCAGCAGGCAGAAGTATGCAAAGC

ATGCATCTCAATTAGTCAGCAACCAGGTGTGGAAAGTCCCCAGGCTCCCCAGCAGGCAGAAGTATGCAAAGCATG

CATCTCAATTAGTCAGCAACCATAGTCCCGCCCCTAACTCCGCCCATCCCGCCCCTAACTCCGCCCAGTTCCGCC

CATTCTCCGCCCCATGGCTGACTAATTTTTTTTATTTATGCAGAGGCCGAGGCGCCTCTGAGCTATTCCAGAAGT

AGTGAGGAGGCTTTTTTGGAGGCCTAGGCTTTTGCAAAAAAGCTAATTCAGCCTGAATGGCGAATGGGACGCGCC

CTGTAGCGGCGCATTAAGCGCGGCGGGTGTGGTGGTTACGCGCAGCGTGACCGCTACACTTGCCAGCGCCCTAGC

GCCCGCTCCTTTCGCTTTCTTCCCTTCCTTTCTCGCCACGTTCGCCGGCTTTCCCCGTCAAGCTCTAAATCGGGG

GCTCCCTTTAGGGTTCCGATTTAGTGCTTTACGGCACCTCGACCCCAAAAACTTGATTAGGGTGATGGTTCACGT

AGTGGGCCATCGCCCTGATAGACGGTTTTTCGCCCTTTGACGTTGGAGTCCACGTTCTTTAATAGTGGACTCTTG

TTCCAAACTGGAACAACACTCAACCCTATCTCGGTCTATTCTTTTGATTTATAAGGGATTTTGCCGATTTCGGCC

TATTGGTTAAAAAATGAGCTGATTTAACAAAAATTTAACGCGAATTTTAACAAAATATTAACGTTTACAATTTCA

GGTGGCACTTTTCGGGGAAATGTGCGCGGAACCCCTATTTGTTTATTTTTCTAAATACATTCAAATATGTATCCG

CTCATGAGACAATAACCCTGATAAATGCTTCAATAATATTGAAAAAGGAAGAGTATGAGTATTCAACATTTCCGT

GTCGCCCTTATTCCCTTTTTTGCGGCATTTTGCCTTCCTGTTTTTGCTCACCCAGAAACGCTGGTGAAAGTAAAA

GATGCTGAAGATCAGTTGGGTGCACGAGTGGGTTACATCGAACTGGATCTCAACAGCGGTAAGATCCTTGAGAGT

TTTCGCCCCGAAGAACGTTTTCCAATGATGAGCACTTTTAAAGTTCTGCTATGTGGCGCGGTATTATCCCGTATT

GACGCCGGGCAAGAGCAACTCGGTCGCCGCATACACTATTCTCAGAATGACTTGGTTGAGTACTCACCAGTCACA

GAAAAGCATCTTACGGATGGCATGACAGTAAGAGAATTATGCAGTGCTGCCATAACCATGAGTGATAACACTGCG

GCCAACTTACTTCTGACAACGATCGGAGGACCGAAGGAGCTAACCGCTTTTTTGCACAACATGGGGGATCATGTA

ACTCGCCTTGATCGTTGGGAACCGGAGCTGAATGAAGCCATACCAAACGACGAGCGTGACACCACGATGCCTGTA

GCAATGGCAACAACGTTGCGCAAACTATTAACTGGCGAACTACTTACTCTAGCTTCCCGGCAACAATTAATAGAC

TGGATGGAGGCGGATAAAGTTGCAGGACCACTTCTGCGCTCGGCCCTTCCGGCTGGCTGGTTTATTGCTGATAAA

TCTGGAGCCGGTGAGCGTGGGTCTCGCGGTATCATTGCAGCACTGGGGCCAGATGGTAAGCCCTCCCGTATCGTA

GTTATCTACACGACGGGGAGTCAGGCAACTATGGATGAACGAAATAGACAGATCGCTGAGATAGGTGCCTCACTG

ATTAAGCATTGGTAACTGTCAGACCAAGTTTACTCATATATACTTTAGATTGATTTAAAACTTCATTTTTAATTT

AAAAGGATCTAGGTGAAGATCCTTTTTGATAATCTCATGACCAAAATCCCTTAACGTGAGTTTTCGTTCCACTGA

GCGTCAGACCCCGTAGAAAAGATCAAAGGATCTTCTTGAGATCCTTTTTTTCTGCGCGTAATCTGCTGCTTGCAA

ACAAAAAAACCACCGCTACCAGCGGTGGTTTGTTTGCCGGATCAAGAGCTACCAACTCTTTTTCCGAAGGTAACT

GGCTTCAGCAGAGCGCAGATACCAAATACTGTCCTTCTAGTGTAGCCGTAGTTAGGCCACCACTTCAAGAACTCT

GTAGCACCGCCTACATACCTCGCTCTGCTAATCCTGTTACCAGTGGCTGCTGCCAGTGGCGATAAGTCGTGTCTT

ACCGGGTTGGACTCAAGACGATAGTTACCGGATAAGGCGCAGCGGTCGGGCTGAACGGGGGGTTCGTGCACACAG

CCCAGCTTGGAGCGAACGACCTACACCGAACTGAGATACCTACAGCGTGAGCATTGAGAAAGCGCCACGCTTCCC

GAAGGGAGAAAGGCGGACAGGTATCCGGTAAGCGGCAGGGTCGGAACAGGAGAGCGCACGAGGGAGCTTCCAGGG

GGAAACGCCTGGTATCTTTATAGTCCTGTCGGGTTTCGCCACCTCTGACTTGAGCGTCGATTTTTGTGATGCTCG

TCAGGGGGGCGGAGCCTATGGAAAAACGCCAGCAACGCC

SEQ ID No.18 pAD-CMV19, the cloning site overstriking

TCGACATTGATTATTGACTAGTTATTAATAGTAATCAATTACGGGGTCATTAGTTCATAGCCCATATATGGAGTT

CCGCGTTACATAACTTACGGTAAATGGCCCGCCTGGCTGACCGCCCAACGACCCCCGCCCATTGACGTCAATAAT

GACGTATGTTCCCATAGTAACGCCAATAGGGACTTTCCATTGACGTCAATGGGTGGAGTATTTACGGTAAACTGC

CCACTTGGCAGTACATCAAGTGTATCATATGCCAAGTACGCCCCCTATTGACGTCAATGACGGTAAATGGCCCGC

CTGGCATTATGCCCAGTACATGACCTTATGGGACTTTCCTACTTGGCAGTACATCTACGTATTAGTCATCGCTAT

TACCATGGTGATGCGGTTTTGGCAGTACATCAATGGGCGTGGATAGCGGTTTGACTCACGGGGATTTCCAAGTCT

CCACCCCATTGACGTCAATGGGAGTTTGTTTTGGCACCAAAATCAACGGGACTTTCCAAAATGTCGTAACAACTC

CGCCCCATTGACGCAAATGGGCGGTAGGCGTGTACGGTGGGAGGTCTATATAAGCAGAGCTCGTTTAGTGAACCG

TCAGATCGCCTGGAGACGCCATCCACGCTGTTTTGACCTCCATAGAAGACACCGGGACCGATCCAGCCTCCGCGG

CCGGGAACGGTGCATTGGAACGCGGATTCCCCGTGCCAAGAGTCAGGTAAGTACCGCCTATAGAGAAGACTCTTG

GGTTTCTGATAGGCACTGACTCTCTCTGCCTATTGGTCTATTTTCCCACCCTTAGGCTGCTGGTGCTTAACTGGC

TTATCGAAATTAATACGACTCACTATAGGGAGACCCAAGCTTCTGCAGGTCGACATCGATGGATCCGGTACCTCG

AGCGCGAATTCTCTAGAGATATCTTGTTTATTGCAGCTTATAATGGTTACAAATAAAGCAATAGCATCACAAATT

TCACAAATAAAGCATTTTTTTCACTGCATTCTAGTTGTGGTTTGTCCAAACTCATCAATGTATCTTATCATGTCT

GGATCAATTCTGAAAAACTAGCCTTAAAGACAGACAGCTTTGTTCTAGTCAGCCAGGCAAGCATATGTAAATAAA

GTTCCTCAGGGAACTGAGGTTAAAAGATGTATCCTGGACCTGCCAGACCTGGCCATTCACGTAAACAGAAGATTC

CGCCTCAAGTTCCGGTTAACAACAGGAGGCAACGAGATCTCAAATCTATTACTTCTAATCGGGTAATTAAAACCT

TTCAACTAAAACACGGACCCACGGATGTCACCCACTTTTCCTTCCCCGGCTCCGCCCTTCTCAGTACTCCCCACC

ATTAGGCTCGCTACTCCACCTCCACTTCCGGGCGCGACACCCACGTGCCCTCTCCCACCCGACGCTAACCCCGCC

CCTGCCCGTCTGACCCCGCCCACCACCTGGCCCCGCCCCGTTGAGGACAGAAGAAACCCCGGGCAGCCGCAGCCA

AGGCGGACGGGTAGACGCTGGGGGCGCTGAGGAGTCGTCCTCTACCTTCTCTGCTGGCTCGGTGGGGGACGCGGT

GGATCTCAGGCTTCCGGAAGACTGGAAGAACCGGCTCAGAACCGCTTGTCTCCGCGGGGCTTGGGCGGCGGAAGA

ATGGCCGCTAGACGCGGACTTGGTGCGAGGCATCGCAGGATGCAGAAGAGCAAGCCCGCCGGGAGCGCGCGGCTG

TACTACCCCGCGCCTGGAGCGGCCACGCCGGACTGGGCGGGGCCGGCCTGGTGGAGGCGGAGTCTGACCTCGTGG

AGGCGGGGCCTCTGATGTTCAAATAGGATGCTAGGCTTGTTGAGGCGTGGCCTCCGATTCACAAGTGGGAAGCAG

CGCCGGGCGACTGCAATTTCGCGCCAAACTTGGGGGAAGCACAGCGTACAGGCTGCCTAGGTGATCGCTGCTGCT

GTCATGGTTCGACCGCTGAACTGCATCGTCGCCGTGTCCCAGAATATGGGCATCGGCAAGAACGGAGACCTTCCC

TGGCCAATGCTCAGGTACTGGCTGGATTGGGTTAGGGAAACCGAGGCGGTTCGCTGAATCGGGTCGAGCACTTGG

CGGAGACGCGCGGGCCAACTACTTAGGGACAGTCATGAGGGGTAGGCCCGCCGGCTGCTGCCCTTGCCCATGCCC

GCGGTGATCCCCATGCTGTGCCAGCCTTTGCCCAGAGGCGCTCTAGCTGGGAGCAAAGTCCGGTCACTGGGCAGC

ACCACCCCCCGGACTTGCATGGGTAGCCGCTGAGATGGAGCCTGAGCACACGTGACAGGGTCCCTGTTAACGCAG

TGTTTCTCTAACTTTCAGGAACGAGTTCAAGTACTTCCAAAGAATGACCACCACCTCCTCAGTGGAAGGTAAACA

GAACCTGGTGATTATGGGCCGGAAAACCTGGTTCTCCATTCCTGAGAAGAATCGACCTTTAAAGGACAGAATTAA

TATAGTTCTCAGTAGAGAGCTCAAGGAACCACCACAAGGAGCTCATTTTCTTGCCAAAAGTCTGGACCATGCCTT

AAAACTTATTGAACAACCAGAGTTAGCAGATAAAGTGGACATGGTTTGGATAGTTGGAGGCAGTTCCGTTTACAA

GGAAGCCATGAATCAGCCAGGCCATCTCAGACTCTTTGTGACAAGGATCATGCAGGAATTTGAAAGTGACACGTT

CTTCCCAGAAATTGATTTGGAGAAATATAAACTTCTCCCAGAGTACCCAGGGGTCCTTTCTGAAGTCCAGGAGGA

AAAAGGCATCAAGTATAAATTTGAAGTCTATGAGAAGAAAGGCTAACAGAAAGATACTTGCTGATTGACTTCAAG

TTCTACTGCTTTCCTCCTAAAATTATGCATTTTTACAAGACCATGGGACTTGTGTTGGCTTTAGATCCTGTGCAT

CCTGGGCAACTGTTGTACTCTAAGCCACTCCCCAAAGTCATGCCCCAGCCCCTGTATAATTCTAAACAATTAGAA

TTATTTTCATTTTCATTAGTCTAACCAGGTTATATTAAATATACTTTAAGAAACACCATTTGCCATAAAGTTCTC

AATGCCCCTCCCATGCAGCCTCAAGTGGCTCCCCAGCAGATGCATAGGGTAGTGTGTGTACAAGAGACCCCAAAG

ACATAGAGCCCCTGAGAGCATGAGCTGATATGGGGGCTCATAGAGATAGGAGCTAGATGAATAAGTACAAAGGGC

AGAAATGGGTTTTAACCAGCAGAGCTAGAACTCAGACTTTAAAGAAAATTAGATCAAAGTAGAGACTGAATTATT

CTGCACATCAGACTCTGAGCAGAGTTCTGTTCACTCAGACAGAAAATGGGTAAATTGAGAGCTGGCTCCATTGTG

CTCCTTAGAGATGGGAGCAGGTGGAGGATTATATAAGGTCTGGAACATTTAACTTCTCCGTTTCTCATCTTCAGT

GAGATTCCAAGGGATACTACAATTCTGTGGAATGTGTGTCAGTTAGGGTGTGGAAAGTCCCCAGGCTCCCCAGCA

GGCAGAAGTATGCAAAGCATGCATCTCAATTAGTCAGCAACCAGGTGTGGAAAGTCCCCAGGCTCCCCAGCAGGC

AGAAGTATGCAAAGCATGCATCTCAATTAGTCAGCAACCATAGTCCCGCCCCTAACTCCGCCCATCCCGCCCCTA

ACTCCGCCCAGTTCCGCCCATTCTCCGCCCCATGGCTGACTAATTTTTTTTATTTATGCAGAGGCCGAGGCGCCT

CTGAGCTATTCCAGAAGTAGTGAGGAGGCTTTTTTGGAGGCCTAGGCTTTTGCAAAAAAGCTAATTCAGCCTGAA

TGGCGAATGGGAAATTGTAAACGTTAATATTTTGTTAAAATTCGCGTTAAATTTTTGTTAAATCAGCTCATTTTT

TAACCAATAGGCCGAAATCGGCAAAATCCCTTATAAATCAAAAGAATAGACCGAGATAGGGTTGAGTGTTGTTCC

AGTTTGGAACAAGAGTCCACTATTAAAGAACGTGGACTCCAACGTCAAAGGGCGAAAAACCGTCTATCAGGGCGA

TGGCCCACTACGTGAACCATCACCCTAATCAAGTTTTTGGGGTCGAGGTGCCGTAAAGCACTAAATCGGAACCCT

AAAGGGAGCCCCCGATTTAGAGCTTGACGGGGAAAGCCGGCGAACGTGGCGAGAAAGGAAGGGAAGAAAGCGAAA

GGAGCGGGCGCTAGGGCGCTGGCAAGTGTAGCGGTCACGCTGCGCGTAACCACCACACCCGCCGCGCTTAATGCG

CCGCTACAGGGCGCGTCAGGTGGCACTTTTCGGGGAAATGTGCGCGGAACCCCTATTTGTTTATTTTTCTAAATA

CATTCAAATATGTATCCGCTCATGAGACAATAACCCTGATAAATGCTTCAATAATATTGAAAAAGGAAGAGTATG

AGTATTCAACATTTCCGTGTCGCCCTTATTCCCTTTTTTGCGGCATTTTGCCTTCCTGTTTTTGCTCACCCAGAA

ACGCTGGTGAAAGTAAAAGATGCTGAAGATCAGTTGGGTGCACGAGTGGGTTACATCGAACTGGATCTCAACAGC

GGTAAGATCCTTGAGAGTTTTCGCCCCGAAGAACGTTTTCCAATGATGAGCACTTTTAAAGTTCTGCTATGTGGC

GCGGTATTATCCCGTATTGACGCCGGGCAAGAGCAACTCGGTCGCCGCATACACTATTCTCAGAATGACTTGGTT

GAGTACTCACCAGTCACAGAAAAGCATCTTACGGATGGCATGACAGTAAGAGAATTATGCAGTGCTGCCATAACC

ATGAGTGATAACACTGCGGCCAACTTACTTCTGACAACGATCGGAGGACCGAAGGAGCTAACCGCTTTTTTGCAC

AACATGGGGGATCATGTAACTCGCCTTGATCGTTGGGAACCGGAGCTGAATGAAGCCATACCAAACGACGAGCGT

GACACCACGATGCCTGTAGCAATGGCAACAACGTTGCGCAAACTATTAACTGGCGAACTACTTACTCTAGCTTCC

CGGCAACAATTAATAGACTGGATGGAGGCGGATAAAGTTGCAGGACCACTTCTGCGCTCGGCCCTTCCGGCTGGC

TGGTTTATTGCTGATAAATCTGGAGCCGGTGAGCGTGGGTCTCGCGGTATCATTGCAGCACTGGGGCCAGATGGT

AAGCCCTCCCGTATCGTAGTTATCTACACGACGGGGAGTCAGGCAACTATGGATGAACGAAATAGACAGATCGCT

GAGATAGGTGCCTCACTGATTAAGCATTGGTAACTGTCAGACCAAGTTTACTCATATATACTTTAGATTGATTTA

AAACTTCATTTTTAATTTAAAAGGATCTAGGTGAAGATCCTTTTTGATAATCTCATGACCAAAATCCCTTAACGT

GAGTTTTCGTTCCACTGAGCGTCAGACCCCGTAGAAAAGATCAAAGGATCTTCTTGAGATCCTTTTTTTCTGCGC

GTAATCTGCTGCTTGCAAACAAAAAAACCACCGCTACCAGCGGTGGTTTGTTTGCCGGATCAAGAGCTACCAACT

CTTTTTCCGAAGGTAACTGGCTTCAGCAGAGCGCAGATACCAAATACTGTCCTTCTAGTGTAGCCGTAGTTAGGC

CACCACTTCAAGAACTCTGTAGCACCGCCTACATACCTCGCTCTGCTAATCCTGTTACCAGTGGCTGCTGCCAGT

GGCGATAAGTCGTGTCTTACCGGGTTGGACTCAAGACGATAGTTACCGGATAAGGCGCAGCGGTCGGGCTGAACG

GGGGGTTCGTGCACACAGCCCAGCTTGGAGCGAACGACCTACACCGAACTGAGATACCTACAGCGTGAGCATTGA

GAAAGCGCCACGCTTCCCGAAGGGAGAAAGGCGGACAGGTATCCGGTAAGCGGCAGGGTCGGAACAGGAGAGCGC

ACGAGGGAGCTTCCAGGGGGAAACGCCTGGTATCTTTATAGTCCTGTCGGGTTTCGCCACCTCTGACTTGAGCGT

CGATTTTTGTGATGCTCGTCAGGGGGGCGGAGCCTATGGAAAAACGCCAGCAACGCAGCTGC

Example 3 clinical researches 1170.1

1. term abbreviation and definition tabulation

The cell-mediated cytotoxicity that ADCC antibody relies on

The AE ill-effect

The ALT ALT

A.p. front rear

The AP alkaline phosphatase

The AST aspartate aminotransferase

The area of AUC under concentration time curve

Bq crith that (Becquerel), radioactivity crith that

SI unit's (decay per second of 1Bq=)

The BSA bovine serum albumin(BSA)

CD44v6 CD44 variant homotype (isoform) v6

The common drug safety of CDS (Corporate Drug Safty)

CGy detects the centigray (Centi Gray) of radioactive activity

The CHO Chinese hamster ovary cell

Ci Curie; Radioactivity unit; 1 Curie=37 * 10⁹Decay per second

＝37GBq

The body clearance rate that CL is total

The cMAb resistant chimeric monoclonal antibody

Cm centimetre

C _maxViewed maximum drug concentration

The counting of cpm per minute

CRF case report/record sheet

CT (scan) computer laminagraphy

CTC general toxicity standard

The CV coefficient of variation

DLT toxicity restriction (Dose Limiting Toxicity) dosage

The ECG electrocardiogram

The ELISA EUSA

ENT ear nose larynx

F is female

FDA food and drug abuse test office

The g gram

The GBq radioactivity picks up the SI unit of hundred million criths you (Giga Becquerel)

(1GBq＝10 ⁹Decay per second)

The good clinical practice of GCP

GGT γ glutamyl transpeptidase

The good sharp manufacturing practice of GMP

Gy gray(Gy) (Gray)

The human Anti-Human's antibody-like of HAHA

The Hb hemoglobin

HER2 human epithelial growth factor acceptor 2

The humanized monoclonal antibody of hMAb

HNSCC head and neck squamous cell cancer

HPLC high-performance LC

Hr/h hour

Hrs hour

The Ht hematocrit

¹³¹I iodine-131 (8.05 days half-life)

ICH coordinates international commission (International Committee on

harmonisation)

The ID ID

IEC independence ethics committee

The IgG immunoglobulin G

International non-title (the international Non proprietary that specially reads of INN

Name)

IRB research institute overview version

ITT intention treatment (Intent-To-Treat)

I.v. intravenous

Thousand electron-volt of KeV

The l/L liter

M is male

m ²Square metre

The MAb monoclonal antibody

MAG2GABA-TFP sulfydryl acetyl group glycyl glycyl-GABA-four

Fluorine phenolic ester (MAG2GABA-TFP), chelating agent are used for will¹⁸⁶Re

Be coupled to monoclonal antibody (further method)

MAG3 sulfydryl acetyl group triglycine, chelating agent are used for will^99mTc reaches¹⁸⁶Re

Be coupled to monoclonal antibody

The SI unit of MBq radioactivity; 1,000,000 (Mega) crith that (1MBq=10⁶

Decay per second)

The mCi millicurie; Radioactivity unit; 1 millicurie=3,700 ten thousand decays/

Second=37MBq

The MCV mean corpuscular volume

The mGy milligray

μ g microgram

The mg milligram

Min minute

The ml/mL milliliter

The mMAb mouse monoclonal antibody

The mmHg millimetres of mercury

μ mol micromole

Mmol mM

The MRI magnetic resonance is developed

The MRT mean residence time

MSv mSv (Sievert)

The MTD maximum tolerated dose

NA/n.a. do not use

NCI US National Cancer Institute

ND does not do

The ng nanogram

The No/N numbering

Nos not spy shows

The NSCLC non-small cell lung cancer

N.y.r. also do not reclaim

P.a. rear front

The salting liquid of PBS phosphate buffered

P.i. behind the infusion

P.o. per os

Each strategy of PP

Patient Pt./Pat

Pts. patient

¹⁸⁶Re rhenium-186, the radiation nuclear species; Half-life is 3.7 days (groups of beta particle

Knit and penetrate about 1.2 millimeters)

Recov. reclaim

The RES reticuloendothelial system

RIS radio-immunity scintigraphy

The RIT radioimmunotherapy

ROI purpose zone

The ill-effect that SAE is serious

The SCC squamous cell carcinoma

SCD44v6 solubility CD44v6

The disease that SD is stable

The sGOT serum glutamic oxalacetic transaminase

The sGPT serum glutamic pyruvic transaminase

SOC system organ classification

The SOP standard operating procedure

SPECT single-photon emission compute tomography method

t _1/2Eliminate the half-life

^99mTc Tc 99m (6 hours half-life)

The TLC thin-layer chromatography

T _maxCan be observed the time point of maximum drug concentration

TNM carries down tumour tumor lympha stage by stage and moves system

The TSH thyroid-stimulating hormone (TSH)

The League of Nations that UICC is anticancer

Unk is unknown

V _ssThe apparent volume that under limit, distributes

V _zThe expression volume that distributes in latter stage

The WBC white blood cell count(WBC)

The WHO World Health Organization

2. research purpose

2.1 general objectives/clinical purpose

The general objectives of this research is the assessment intravenous administration^99mTc reaches¹⁸⁶Security and the tolerance of the hMAb BIWA 4 of Re-mark are to confirm^99mThe preferential accumulation of the hMAb BIWA 4 of Tc-mark in tumour is to determine¹⁸⁶The maximum of the hMAb BIWA 4 of Re-mark tolerates radiological dose, and the development of II phase is proposed safe dose. In order to arrive this target, research is divided into two parts:

The A part:

Purpose:

For determining^99mThe single infusion of hMAb BIWA 4 intravenous administrations of Tc-mark, security and tolerance in the squamous cell carcinoma patient that head and neck progress is arranged.

For determining^99mThe bio distribution of 4 four kinds of single infusions of BIWA 4 dosage levels of the hMAb BIWA of Tc-mark in the squamous cell carcinoma patient that head and neck progress is arranged.

Be research^99mThe pharmacokinetics of the single infusion of hMAb BIWA4 of Tc-mark.

The B part:

Purpose:

For determining¹⁸⁶Qualitative and the quantitative toxic action of the hMAb BIWA 4 of Re-mark, and study the predictable of toxic side effects, the effect beginning, action period, intensity, invertibity reaches the correlation with dosage.

For determining¹⁸⁶The hMAb BIWA 4 of Re-mark is at head and neck carninomatosis people's maximum tolerance radiological dose.

In order to study intravenous administration¹⁸⁶The hMAb BIWA 4 of Re-mark is in head and neck squamous cell carcinoma patient's pharmacokinetics.

The second purpose is definite¹⁸⁶The preliminary therapeutic action of the hMAb BIWA4 of Re-mark.

Listed following purpose in this strategy can't reach in test is carried out. Connexon chelate sulfydryl acetyl group triglycine (MAG3) be used for^99mTc reaches¹⁸⁶Re is coupled to monoclonal antibody, and the development of this program is interrupted, so off-test. Can continue with further developing of BIWA 4, utilize connexon sulfydryl acetyl group glycyl glycyl-GABA tetrafluoro phenolic ester (MAG2GABA-TFP).

At first identify the MTD of single dose treatment, add again more patients to define MTD, supply¹⁸⁶Re-

Treat reference the second time of the hMAb BIWA4 of mark.

For¹⁸⁶The first time of the hMAb BIWA 4 of Re-mark and continuation infusion propose safe dose, think further research.

For the dosage reservation chart is drawn early results for repeat administration.

2.2 preliminary parameter

Security: clinical laboratory tests, the mankind-anti-human class-antibody (HAHA) assessment, vital sign detects and ill-effect.

Render a service: biopsy obtains bio distribution data (only A part) and radio-immunity scintitomography method (A and B partly comprise the dosimetry of test B part).

Pharmacokinetics result.

2.3 quadratic parameter

Quadratic parameter in the research is tumor response (only B part).

3. project

3.1 holistic approach design and plan-explanation

These test minute two parts are carried out. A partly assesses cold BIWA 4 optimal doses, and quantifies the absorption of tumour, and the B part Study¹⁸⁶The maximum tolerated dose of Re-BIWA 4.

3.1.1A part:

This clinical testing partly is not controlled, improves the continuous group research of dosage. Its through the design can^99mProvide original date on the security of Tc-hMAb BIWA 4 single infusions and the tolerance, studying chorologic pattern and level, and the pharmacokinetic profile of definite hMAb BIWA4 in head and neck cancer patient are arranged. Adopt three kinds of hMAb BIWA protein dosage in the A of this research part, every dosage level has three patient's plans through being subject to processing.

Patient is by the ear-nose-throat department routine inspection, to determine the tumour degree. This comprises physical examination, the MRI scanning of computer tomography method (CT) or head and neck, and panendoscope inspection (depending on required ground). In these steps, tissue sample, the whether appearance of squamous cell carcinoma is taken out and checked to doubtful tumour. According to these check results, patient determines whether perform the operation, comprise neck dissection.

Injection is observed patient bad reaction is whether occured through radiolabeled antibody. Before the operation, and (p.i.) carried out radio-immunity scitiphotograph scanning in 21 hours behind the infusion. Perform the operation after 48 hours being infused into the radiolabeled hMAb BIWA4 of tool. Pathology Doctors ' checks that the neck dissection sample is to determine certain tumor load. Moreover, also detect in operation product to be checked, in the living tissue of knub position and normal structure product to be checked^99mThe amount of Tc. With immunohistochemical examination's knub position and tumor-infiltrated tubercle whether there be existing of CD44v6 antigen. 2 milligrams of hMAb BIWA 4 of front three patient's administration, it is marked with 20 millicuries^99mTc, and mix with 23 milligrams of unlabelled hMAb BIWA 4. 2 milligrams of hMAb BIWA 4 of second group three appreciable patient's administrations, mark is with 20 millicuries^99mTc also mixes with 48 milligrams of unlabelled hMAb BIWA 4, and the antibody of 2 milligrams of marks of the 3rd group of administration mixes with 98 milligrams of unlabelled antibody.

The time point that shows the spy carries out the pharmacokinetics assessment.

3.1.2.B part:

This clinical testing partly is that an open not controlled dosage staged enlarges research. It can be assessed through design¹⁸⁶Security and the tolerance of the hMAb BIWA 4 of Re-mark are to determine intravenous administration¹⁸⁶The maximum tolerated dose (MTD) of the hMAb BIWA 4 of Re-mark, and can determine¹⁸⁶The preliminary therapeutic action of the hMAb BIWA4 of Re-mark in head and neck carninomatosis people, and this patient selects and can adopt without curing. In addition, also assessment¹⁸⁶The pharmacokinetic profile of the hMAb BIWA 4 of Re-mark.

All patients that enter this test portion all accept hMAb BIWA 4, its dosage select result take A part as foundation. HMAb BIWA 4 marks enlarge dosage with staged¹⁸⁶Re. Entering overtreatment group (per dose group) than (viewed toxicity is no more than the 1st grade) under the low dosage level two patients, and (〉=2 grades of toxicity) minimum three patients enter the overtreatment group when higher level. All patients all assess to determine the security of the hMAb BIWA 4 of institute's administration.

Patient is often checked by ENT doctor's example, to determine the tumour degree. This comprises CT or the MRI scanning at physical examination and knub position place.

¹⁸⁶The antibody of Re-mark injects with the radiological dose that ladder enlarges mode: the patient in the first dosage group accepts 20 millicurie/rice²Exposure dose, then ensuing dosage group patient, with 10 millicurie/rice²Magnification ratio enlarge, until reach MTD. Observe patient whether ill-effect occurs. Carry out radio-immunity scitiphotograph scanning.

3.1.3 the research step when each time made a house call

3.1.3.1. the program of making a house call

A) screening type is made a house call

Before entering research, each patient screens according to eligibility. The relevant medical history of record demography and medical science also records the treatment of following, and carries out general phisical examination, also measures body weight. Determine Karnofsky performance mark. Must obtain the written notice letter of consent. To might the pregnant woman doing conceived test. Carry out 12-lead electrocardiogram (ECG), also carry out the assessment of blood and urine safety experiment chamber. Also take the blood sample of HAHA-test. Carry out the chest x-ray irradiation, and complete disease assessment (CT/MRI, ear nose larynx [ENT] checks).

When this makes a house call end, assess the result of required inspection, include in and the confirmation of exclusion standard and the arrangement (only A part) of operation.

B) make a house call 2: research fate 1-7

A part and B part

When first day was studied, this was no more than screening and makes a house call rear 3 weeks, and patient will be in hospital. The Basic Laboratory that the is necessary assessment of not doing when screening is made a house call all will be done, and is assessed before infusion, and will meet the eligibility condition. Measure body weight. The essential record of all treatments of following. Behind written notice letter of consent signature, each ill-effect must be recorded in patient files and the case case history account (CRF).

Treating the same day, first blood-sample withdrawal is with record pharmacokinetics (comprising the assessment of solubility CD44v6) and vital sign before the administration antibody. Between first 24 hours, collected 0-4 hour, 4-8 hour, the urine of 8-12 hour and 12-24 hour, again take 24 hours as the interval until collected urine in 48 and 96 hours behind the infusion, be respectively applied to A and B part.

Antibody administration in the appointment ward of nucleon medical board or hospital. The administration of antibody is as far as possible near peripheral upper limbs end vein slightly. In all examples, infusion is gone through 5 minutes, after the flushing of 10 mL of saline, via the pipeline of free flow. In order to obtain reproducible pharmacokinetics result, the essential syringe pump that uses. Therefore milliliter be necessary with 0.9%NaCl dilution volume to 20. The follow-up flushing with 10 mL of saline of this antibody infusion. Any doubtful overflowing all is recorded among the CRT, and patient will take a picture.

Got resuscitation equipment ready, antihistaminicum, corticosteroid and adrenergic emergency aid articles are to resist possible allergic reaction. To record ill-effect every day and follow the variation for the treatment of.

The A part:

At p.i.10, record vital sign in the time of 60 and 120 minutes. Behind the infusion 21,48 and 144 hours, collect blood sample to analyze security and solubility CD44v6.

When infusion finishes and at infusion, finish rear 5,10,30 minutes, and 1,2,4,16,21,48,72 hours, and blood sampling the 7th day (144 hours p.i. comprise that blood serum sample is used for the assessment of HAHA and solubility CD44v6) is to go the pharmacokinetics assessment.

The urine of row pharmacokinetic study, in first 24 hours 0-4 hour, 4-8 hour, 8-12 hour and 12-24 hour, and 24 hours until collect during 48 hours p.i..

Behind the infusion directly and after 21 hours, carry out whole body scitiphotograph development. Behind the infusion 21 hours, except whole body develops, also do the single-photon emission compute tomography (SPECT) of head and neck area and develop comprehensively.

Patient performed the operation in the time of p.i.48 hour, and stayed institute to do post-operative care.

Collect the security urine sample at the 7th day (144 hours p.i.).

Record bad reaction every day and follow the change for the treatment of.

The B part:

10,60,120 and 240 minutes record vital signs behind infusion. Behind infusion, collected blood sample to go security and solubility CD44v6 analysis in 21,48 and 144 hours. 144 hours blood sample carries out the HAHA assessment behind the collection infusion. Also collect urine to be used for safety analysis at 144 hours p.i..

Finish rear 5 and 30 minutes and 1,2 in infusion end and infusion, 4,16,21,48 and 72 hours, and the 7th day (144 hours p.i.) blood sampling is to go pharmacokinetic analysis. The sample of original plan in the time of 10 minutes is economized slightly amendment 1.

At first 0-4 of 24 hours hour, 4-8 hour, reached at 24 hours in 8-12 hour and 12-24 hour until 96 hours p.i. collect urine row pharmacokinetic analysis.

Directly carry out the whole body scitiphotograph at 21,48,72 and 144 hours p.i. and develop, can choose wantonly behind infusion and carry out in two weeks, if when this considers the statistics license.

At 21,48 (depending on required ground), 72 and 144 hours p.i., and look required the plane development that two all p.i. carry out head and neck area, if when this considers statistics license.

Only carrying out SPECT in 72 hours behind infusion develops.

Record bad reaction every day and follow the change for the treatment of.

Allow disposition after three days.

C) make a house call 3: follow the trail of and make a house call

The A part:

In six weeks behind the infusion, patient sees outpatient service. Carry out physical examination, collect security blood and urine sample, measure body weight and vital sign, and the record ill-effect. Also must carry out pharmacokinetics, the blood sample that HAHA assessment and solubility CD44v6 analyze. To may the pregnant woman doing conceived test. The record ill-effect with anti-result. Also any variation for the treatment of followed in record.

The B part:

Patient is to weekly at least six weeks of outpatient service, with the record ill-effect and collect the security blood sample. 240 hours and 336 hours blood sampling analysis pharmacokinetics behind infusion. Originally planned to economize slightly amendment 1 at the blood sample in six weeks of p.i.. Also be recorded in any variation of following in the treatment. The disease assessment on basis will repeat for six weeks behind the infusion, if there is afterwards indication just to carry out. (be evaluated at carry out after six weeks but not once mentioned in the strategy around). Security is analyzed in the blood sampling of six weeks behind the infusion, HAHA assessment and solubility CD44v6, and the record vital sign is also measured body weight. In making a house call, this carries out physical examination. Collect the security urine. To there being conceived possibility women test pregnant.

D) make a house call 4 and 5: process for the second time (B part)

Do not carry out such as the processing second time listed in the previous strategy, because test finishes event in advance, because contact changes event. Otherwise, to first dose¹⁸⁶The patient that Re-BIWA 4 responds is fit to for the second time administration. It carries out the identical program of making a house call as the administration first time.

3.2 the discussion of research and design comprises selecting of control group

The purpose of this research is assessment^99mTc-is through mark BIWA 4 difference accumulation (A part) in tumour, and assessment¹⁸⁶The maximum tolerated dose of Re-BIWA4 (B part), and in the head that gets along with and neck cancer patient the pharmacokinetic study (A and B part) of BIWA 4.

As test in the I phase of these types of oncology in the pattern as the practice, use open by design. Tiring at low radiological dose has two patients at least, and includes the B part of test in higher radiological dose three patients that tire. And occur in 4 grades of hematologies of general toxicity standard (CTC) relevant with medicine and the 3 grades of non-haematics toxicity examples, these three patients are further with the processing (seeing 3.4.4. and 3.4.5. paragraph as for further administration details) of tiring of indivedual dosage.

BIWA 4 dosage of institute's administration are certificate according to the previous result of mMAb BIWA 1, the dosage that demonstrates 50 milligrams is woven with height and tool optionally absorbs in tumor group, and nonneoplastic tissue is low picked-up, and from test A result's (also seeing the 3.4.4.1. paragraph) partly.

Selected radioactivity starting dose level is as the criterion with past data, can know 20 millicurie/rice by inference²Dosage be safe dose (also seeing 3.4.4.2.).

The standard of the effect standard that reacts and assessment tolerance is fully set up for this patient population, and also can be assessed in open design.

3.3 the selection of Research Group

3.3.1 include criterion in

-histologic study proved has the patient of head and neck squamous cell cancer.

-plan with patient's (A part) of neck dissection method operation or:

-patient of part and/or zone recurrence disease is arranged, and select without exercisable treatment, or the transfer of far-end. The tumour deposit must detect in clinical mode, or utilizes one or more dept. of radiology's technology (CT, MRI, bone scintigraphy). In less tumour deposition, predicted that RIT is more effective, with the patient of the injury that in full-size, records＜3 centimeters for better (B part).

-patient was above 18 years old.

-patient was less than 80 years old.

-patient has the written notice letter of consent.

At least 3 months-patient life-spans.

-patient of good condition: Karnofsky＞60 are arranged.

3.3.2 eliminating criterion

-mortality infects, allergic constitution, organ failure (bilirubin＞30 micromoles per liter and/or kreatinin＞150 micromoles per liter) or evidence or the UA of recent miocardial infarction are arranged according to ECG.

Women before the-menelipsis (last menstruation≤1 year is before referring to begin one's study):

Reach without operation sterilization (uterectomy, tubal ligation)

Without carrying out birth control acceptable method (or not planning to want under study for action the continuator). The acceptable method of birth control comprises oral, implants or contraceptive injection.

-at baseline the conceived women who detects the positive of serum is arranged.

-carry out chemotherapy or radiotherapy in front 4 weeks including research in.

-leucocyte number＜3000/ millimeter³, granulocyte number＜1500/ millimeter³Or number of platelets＜100,000/ millimeter³。

-hematologic disorders disease, congestive heart failure, bronchial astehma, food or Contact hyper sensitization, serious idiocrasy or allergy.

3.3.3 experimenter's eliminating from treatment or assessment

3.3.3.1 stop the criterion that the experimenter processes

If heart-hurry (the pulsation per minute is greater than 120 times) occurs in patient, low blood pressure (systolic pressure of blood pressure is lower than 100 millimetress of mercury), respiratory distress, pectoralgia, or the intolerable any symptom of patient all will stop infusion immediately.

3.3.3.2 drop by the wayside and cancel

The experimenter all can freely end its participation when any time of this research.

If patient gets because of automatically disappearing and certainly leaves ahead of time in the research, then the assessment of radiolabeled hMAb BIWA4 is not considered to be feasible. If can't obtain suitable tracking data, this case is regarded as non-appreciable. Anyly can't obtain suitable tracking data, this case is regarded as non-appreciable. Any patient that can't assess all plans and will be substituted.

If patient namely ends in early days from research, then reason should be recorded among the CRF. If blood sampling was to determine HAHA or pharmacokinetics after patient can't return to carry out infusion, reason also will record. If serious bad reaction occurs patient, then decide according to serious ill-effect (SAE), as far as possible closely the follow program.

3.4 process

3.4.1 administration is processed

Be 20 millicuries at patient's administration radioactivity dosage of A part^99mTc-BIWA 4. To three patients, BIWA 4 dosage of each self administration of medication are 25 milligrams, 50 milligrams or 100 milligrams. Medicine is with the single dose intravenous administration.

Patient in the B part accepts 50 milligrams of marks with the BIWA 4 of rhenium 186. Minimum radioactivity dosage is 20 millicurie/rice², with 10 millicurie/rice²The dosage increase of tiring. Trial drug with single dose in intravenous administration.

3.4.2 the essence of research product

The A part:

Material (INN): BIWA 4 (bivatuzumab)

Pharmacy pattern: injection solution

Chiffre number: BIWA4 LOI 99 1D 1A

Lot number: B981101

Source: Boehringer Ingelheim Pharma KG

Unit strength: 5 mg/ml

Every day dosage: 25 milligrams

Operating period: single dose

Administration path: intravenous

Dosimeter: infusion is gone through 5 minutes

Material (INN): BIWA 4 (bivatuzumab)

Pharmacy pattern: injection solution agent

Chiffre number: BIWA4 LOI 99 1D 1A

Lot number: B981101

Source: Boehringer Ingelheim Pharma KG

Unit strength: 5 mg/ml

Every day dosage: 50 milligrams

Operating period: single dose

Administration path: intravenous

Dosimeter: infusion is gone through 5 minutes

Material (INN): BIWA 4 (bivatuzumab)

Pharmacy pattern: injection solution agent

Chiffre number: BIWA4 LOI 99 1D 1A

Lot number: B981101

Source: Boehringer Ingelheim Pharma KG

Unit strength: 5 mg/ml

Every day dosage: 100 milligrams

Operating period: single dose

Administration path: intravenous

Dosimeter: infusion is gone through 5 minutes

BIWA 4 with^99mThe radioactivity conjugate pattern administration that Tc connects. Connecting molecule is MAG3. MAG3 is available from Mallinckrodt, Petten, The Netherlands.

^99mTc orders goods via the laboratory region, in this preparation radio-immunity conjugate (laboratory of Prof.Dr.van Dongen, Section Tumor Biology, Department of Otorhinolaryngology/Head and Neck Surgery, Vrije Universiteit University Medical Center, De Boelelaan 1117,1081 HV Amsterdam, The Netherlands).

The B part:

Material (INN): BIWA 4 (bivatuzumab)

Pharmacy pattern: injection solution agent

Chiffre number: BIWA4 LOI 99 1D 1A

Lot number: B981101

Source: Boehringer Ingelheim Pharma KG

Unit strength: 5 mg/ml

Every day dosage: 50 milligrams

Operating period: single dose

Administration path: intravenous

Dosimeter: infusion is gone through 5 minutes

BIWA 4 with¹⁸⁶The radioactivity conjugate pattern administration that Re connects. Connecting molecule is MAG3. MAG3 is available from Mallinckrodt, Petten, The Netherlands.

¹⁸⁶Re orders goods via the laboratory region, in this preparation radio-immunity conjugate (laboratory of Prof.Dr.van Dongen, Section Tumor Biology, Department of Otorhinolaryngology/Head and Neck Surgery, Vrije Universiteit University Medical Center, De Boelelaan 1117,1081 HV Amsterdam, The Netherlands).

3.4.2.1 the characteristic of trial drug and quality

The antibody characteristic

The antibody of being confirmed by hMAb BIWA 4 is a kind of membrane glycoprotein of wearing that is positioned at cell outer surface, and only small part is internalization (＜20%). Further analyze and show that hMAb BIWA 4 can identify the coded epi-position by CD44 variant extron v6. Shown this antigen for all primary heads and tumor colli (n=54) and for the most cells in these tumours expressed. Can be observed comparable expression (R97-2054) in 68 tumor-infiltrated lymph nodes by neck dissection product to be checked. The reactive type of hMAb BIWA 4 in human normal structure is shown among the appendix III of strategy. The reactivity of finding hMAb BIWA 4 is limited to scaly epithelium basically. As before being proved in the RIS of mouse monoclonal antibody (mMAb) BIWA 1 research, with the reactivity of normal scaly epithelium be not a limiting factor on cancer target utilizes, this is with regard to the absorption of tumour.

Warp ^99m Tc or ¹⁸⁶ The quality control of the hMAb BIWA 4 of Re-mark

Antibody according to the described method of Fritzberg et al. (R96-2106: see tactful appendix IV) mark with^99mTc or¹⁸⁶Re, itself and according to Visser et al. (R96-2094) and Van Gog et al. (R96-2111) and modify it.

With^99mTc reaches¹⁸⁶The step of Re radio-labeled hMAb BIWA 4 is with regard to the final mass of made conjugate and guarantee. Carry out according to the described step of tactful appendix IV independently in the labelling experiment at five, find that the percentage of the label of being combined with antibody is 96-99%.

In this clinical research, with thin-layer chromatography (TLC) or each prepared warp of high-performance LC (HPLC) assessment^99mTc or¹⁸⁶The radiochemical purity of the antibody of Re-mark batch, and by PD-10 gel tubing string, and must just can be administered to patient more than 90%.

After administration, utilize each warp of method inspection that public letter is arranged^99mTc/ ¹⁸⁶The immunoreactivity part of the antibody of Re mark batch, and must be more than 60%. In brief, analysis is carried out according to the described step of Lindmo et al. (R96-2104) basically. The UM-SCC 11B cell (human laryngocarcinoma) that contains CD44v6 antigen is fixed on 0.1% glutaraldehyde. Six dilution factors are by every pipe 5 * 10⁶Cell is to every pipe 3.1 * 10⁵Cell is made in phosphate buffered saline (PBS) with 1% bovine serum albumin(BSA) (BSA).

In pipe, add 80,000cpm's^99mTc-or 10,000¹⁸⁶The hMAb BIWA 4 of Re-mark, and one night of incubation at room temperature.

In last sample, add excessive unlabelled hMAb BIWA4 to measure non-specific combination. Cell centrifugation utilizes gamma counter to be determined at agglomerate and the radioactivity in supernatant, and calculates percentage (LKB-Wallac 1218 CompuGamma) combination and free state radio-labeled MAb.

Data are analyzed in modified Lineweaver Burk picture in picture solution, again with linear extrapolation to the condition that represents unlimited antigen excess and determine the immunoreactivity part.

If in this binding analysis, do not reach 60% eliminating level, then should again row assessment in the second binding analysis for the preparation of infusion. For this purpose, antibody preparation is marked with¹³¹I. At least one immunoreactivity part must greater than 60%, make and can and can proceed for research and with the next bit patient for assessment in second analyzes.

The antibody security

In this research, with^99mTc reaches¹⁸⁶The monoclonal antibody product that the radiolabeled BIWA 4 of Re is a kind of very definite characteristics, it is produced by Chinese hamster ovary (CHO)-cell cultivation and fermentation. And under Good Manufacturing Practice (GMP) condition, establish chief cell figure, and fully check for microbial status (bacterium, fungi, mycoplasm hyopneumoniae) and virus status (adenovirus, retroviruse). Except the endogenous retroviruse is exception (known its is present in most of Chinese hamster ovary celIs), do not survey and pollutant.

According to FDA " Points to Consider " file in 1994, about the MAb that uses in the clinical I of cancer patient phase research institute, a kind of standardized downstream purification process is recognized and can effectively removes virus, can be applied on the purifying of BIWA 4. In generally acknowledging, this includes four kinds of typical case's viruses (REO-3, SV 40 for MuLV, PsRV). Retroviruse in the agglomerate regenerant that inspection concentrates is tired, and can moderately remove retroviruse to guarantee ensuing downstream purification process. Remove endotoxic data and be and to accept in the limit (≤0.01 EU/ milligram) and can apply to the agglomerate product. Moreover, successfully carry out according to the pyrogen test of European Pharmacopoeia criterion.

More at large analyze for further radiolabeled final hMAb BIWA 4, and prove that high-purity (SDS Page waits electric focal length method) is arranged, be the sterile solution (≤0.01 EU/ milligram) that contains minimum level of endotoxin. Result of the test for pyrogen should be complied with the European Pharmacopoeia standard. Be used for clinical before and the BIWA4 product quality of being come by manufacturer of supply clinically, proved by analysis result.

With^99mTc or¹⁸⁶Re radio-labeled hMAb BIWA 4 is by carrying out with lower gate: Otolaryngology and Head Neck Surgery of the Vrije Universiteit University Medical Center, establishing criteria operating procedure (SOPs) is carried out. Can guarantee the aseptic of final products. Test is endotoxic in guaranteeing flow process does not exist. At University Hospital Nijmegen, during to patient's administration medicine through radiolabeled hMAb BIWA 4 with in right amount in the research center that directly in special container, is transported to after the preparation at Nijmegen. At the compound mark and be administered between the patient, permitted in 24 hours.

See that also appendix 16.1.6 is about assigning each batch to patient.

3.4.2.2 packing, mark and supply

BIWA 4 is supplied by Boehringer Ingelheim The Netherlands. It is by Boehringer Ingelheim, and Germany utilizes the preparation of GMP autofrettage, purge process, and with aseptic, apyrogeneity solution (wherein containing the PBS that 25 milligrams of hMAb BIWA 4 open in 5 milliliters of grades, among the pH 7.2) pattern is filled in the bottle. The example of natural bottle label and include in the clinical testing handbook through the antibody of mark.

Prepare one batch of totally 27 gram hMAb BIWA 4, and be fills up in the bottle. Vrije Universiteit University Medical Center in B level proof carries out in the nucleon laboratory of Amsterdam^99mTc or¹⁸⁶The hMAb BIWA4 mark of Re.

3.4.2.3 storage requirement

Unlabelled hMAb BIWA 4 must store in the limited zone of approach of hospital pharmacy for deliberation, and monitor temperature+2 ℃ and+8 ℃ between.

3.4.3 distribute the experimenter to the processed group method for distinguishing

Use non-any-mode. Patient is according to including sequence allocation in to different dosage groups.

3.4.4 the selection of dosage in the research

3.4.4.1 the selection of BIWA 4 dosage

The A part:

Owing to be not administered to patient before the hMAb BIWA4, therefore before beginning RIT test, basically will have informed relevant its security and bio distribution. Its bio distribution may be very relevant with the dosage of the MAb that is used for target tumor, therefore needs to consider carefully. The MAb protein dosage staged of carrying out at-CD44v6 mMAb U36 anti-with low-affinity and the anti-CD44v6 mMAb of high-affinity BIWA 1 enlarges on the Research foundation, being contemplated to optimum dosage is in the 25-100 nanogram range, is optimum with 50 milligrams for mMAb U36.

In order to confirm that this dosage also is suitable for the medium affinity of hMAb BIWA 4, and the initial information of otherness acquisition in order to take in tumour, assessment bio distribution when 25,50 and 100 milligrams of total hMAb BIWA 4, but and process separately three evaluating patient at these dosage levels.

But all evaluating patient are accepted 2 milligrams of hMAb BIWA 4 and are marked with 20 millicuries^99mInfusion in the azygos vein of Tc detects with the radiation corrective system before administration. Plan is accepted 25 milligrams, and the patient of 50 milligrams or 100 milligrams accepts respectively 23 milligrams, and 48 milligrams or 98 milligrams of unlabelled hMAb BIWA 4 add this 2 milligrams of hMAb BIWA4, and it is marked with 20 millicuries^99mTc。

The selection of BIWA4 dosage in the B part

50 milligrams hMAb BIWA 4 is suitable for developing through estimation most on theoretical basis. Carry out the A part of this research, to confirm in the distinctiveness absorption of flat lower (25 milligrams, 50 milligrams and the 100 milligrams) tumour of three tested examination water gagings to hMAb BIWA 4. Can expect, the absorption of tumour (percentage with the per kilogram implantation dosage represents, the %ID/ kilogram), and for these three dosage, tumour does not have large difference to the absorption ratio of non-tumour. If so, being used for research B hMAb BIWA 4 dosage partly is 50 milligrams. Yet if clinically relevant difference is arranged between these dosage levels, namely it is had a preference for this level and is far more than other level, should select this dosage level of best bio distribution pattern.

In this example, the difference of being correlated with clinically may be defined as tumour (mean value that tumour is taken in) marrow is taken in the difference of ratio (marrow is taken in mean value=cell part and supernatant) above 50%.

According to the result of A part, selected dosage is 50 milligrams of hMAb BIWA4 at last.

3.4.4.2 the selection of irradiation initial dose

The B part:

HMAb BIWA 4 dosage of the selection in research A part, mark enlarges with staged¹⁸⁶Re dosage.

There is report to point out¹⁸⁶Re-is 90 millicurie/rice through the maximum tolerated dose of the mouse class MAb of mark NR-LU-10², this is for preliminary treatment patient damnably, and the marrow breakaway action of dosage-restriction can be at 120 millicurie/rice²Observe. For mosaic type MAb NR-LU-13, be NR-LU-10 and identify identical antigen, reversible marrow breakaway action occurs in 60 millicurie/rice² In the research of carrying out with cMAb U36, in Vrije Universiteit University Medical Center, carry out, the marrow breakaway action of dosage-restriction can be at 41 millicurie/rice²In time, observed.

Based on the above results, with¹⁸⁶The hMAb BIWA 4 pattern administrations 20 millicurie/rice of Re-mark²Radiological dose, can be considered is safe initial dose.

Dosage is with 10 millicurie/rice²The increasing degree staged enlarge. But than low dosage level the time, include two evaluating patient in. When can be observed medicine more than 2 grades according to CTC when xicity related, each dosage level is processed minimum three patients.

What must will determine before making patient enter next higher dose levels is not to be exposed to dose limiting toxicity (DLT) when the dosage level that carries out, be defined as: medicine-relevant 3 grades of non-haematics toxicities of CTC, or medicine-relevant 4 grades of haematics toxicities of CTC, get rid of feeling sick and vomiting without appropriate antemetic treatment. With regard to this purpose, when the dosage level that this carries out, to all patients for a long time observation should be arranged enough, be reversible to define the toxicity that may induce.

When having a patient to be exposed to DLT at the dosage level that carries out, patient's number of then treating when this dosage level will increase at most totally 6 patients of sum. When having 1 people to be exposed to DLT among 6 people, then the dosage staged is extended to next level. When two or two above patients are exposed to DLT, then next lower dosage level enlarge (if before not doing) to all 6 patients establishing MTD, and be used for the safety recommendation dosage of II phase.

Originally planned, namely at this dosage level (DLT being arranged less than two patients) can accept toxicity the time arranged, can add extra patient and not only accept this dosage, also have stepped the second lower dosage. Because the change of connexon, this plan is not proceeded. MAG3 will be substituted by MAG2GABA-TFP, and this is can comparable connexon, but more easily Connection Step is arranged. Finish with this development plan that MAG3 carries out.

Right in addition¹⁸⁶The patient that for the first time administration of Re-BIWA4 responds and can tolerate is to be fit to 50 millicurie/rice² ¹⁸⁶Second dose of administration of Re-BIWA4.

3.4.5 the selection of each experimenter's dosage and opportunity

3.4.5.1 dosage and handling procedure

The licensed at any time medicine-feeding test of researcher medicine. Yet the elapsed time between radio-labeled and administration should be no more than 24 hours.

3.4.6 blind test (blinding)

This is a kind of open not controlled test. Do not carry out blind test.

3.4.7 previous and follow treatment or step

3.4.7.1 rescue medicine and extra processing

Allergic reaction is considered to be the most serious potential side effect, and can require the antibody infusion to stop immediately, and the rescue that begins to be fit to detects. It should be noted: at the place of touching rescue aid should be arranged; Antihistaminicum, corticosteroid and adrenaline. Any patient who is exposed to this kind of bad reaction is unacceptable extra monoclonal antibody all.

The license patient accepts other processing, or for the research indication or be incoherent disease, includes in and gets rid of criterion as long as meet. All treatments of following all must be recorded among the CRF.

In serious haematics toxicity situation (4 grades of CTC), for intervention or the additive method of alleviating the bone marrow toxicity cell factor are permitted.

3.4.7.2 restriction

Extra chemotherapy or radiotherapy are objectionable, and are including in more than front 4 weeks of research, and last chemotherapy or radiotherapy should stop. The chemotherapy that all are previous and radiotherapy will be recorded on the CRF.

3.4.8 treatment compliance

Drugs gives with infusion pattern in the azygos vein. Confirm compliance with pharmacokinetics assessment and radio-immunity scitiphotograph development.

3.5 effectiveness/clinical pharmacology and security parameters

3.5.1 effectiveness/pharmacodynamics and security detect assessment and flow chart

Flow chart:

The A part

This research is carried out when the A part, and individual other time is specified in down in the flow process of showing. The research explanation is shown in lower paragraph:

Table 3.5.1:1 flow chart: A part: with^99mThe hMAb BIWA4 of Tc-mark

Carry out biodistribution research

	Make a house call 1	Make a house call 2						Make a house call 3
	Make a house call 1	Make a house call 2						Make a house call 3		Screening is made a house call^*	The 1st day^*	The 2nd day	The 3rd day	The 4th day	The 7th day	Followed the trail of for 6 weeks
		Before the injection	After the injection							Screening is made a house call^*	The 1st day^*	The 2nd day	The 3rd day	The 4th day	The 7th day	Followed the trail of for 6 weeks
		Before the injection	After the injection						Signature notice letter of consent	x
Demography concentration, the physical examination for the treatment of medical history	x x x x	x	x	x	x	x	x	x x	Signature notice letter of consent	x
	x x x x	x	x	x	x	x	x	x x	ECG chest x-ray blood safety analysis urine safety analysis pregnancy tests	x x x ¹ x x	x ¹	x ¹	x ¹		x ¹ x	x ¹ x x

The HAHA assessment	x ²				x ²	x ²
The HAHA assessment	x ²				x ²	x ²	ENT checks CT or MRI	x x
Include/get rid of criterion in	x						ENT checks CT or MRI	x x
Include/get rid of criterion in	x						Ill-effect vital sign body weight	x ³ x	x x ³ x	x x ³	x	x	x	x	X x ³ x
Immunity scintigraphy :-body scan-flat scanning-SPECT scanning		x ⁴	x ⁴ x ⁵ x ⁵				Ill-effect vital sign body weight	x ³ x	x x ³ x	x x ³	x	x	x	x	X x ³ x
		x ⁴	x ⁴ x ⁵ x ⁵				Pharmacokinetics: blood sample urine collecting serum soluble CD44v6		x ⁶ x ⁶ x ⁷	x ⁶ x ⁶	x ⁶ x ⁶ x ⁷	x ⁶ x ⁶ x ⁷	x ⁶	x ⁶ x ⁷	6 6
Operation				x					x ⁶ x ⁶ x ⁷	x ⁶ x ⁶	x ⁶ x ⁶ x ⁷	x ⁶ x ⁶ x ⁷	x ⁶	x ⁶ x ⁷	6 6

^*: the assessment of pre-infusion should be no more than before certain infusion to be carried out in 3 weeks.

x ¹: blood sample is that test is following: glucose, sodium, potassium; calcium, chloride, kreatinin; gross protein, albumin, serum glutamic oxalacetic transaminase (sGOT); serum glutamic pyruvic transminase (sGPT), alkaline phosphatase, γ paddy amine acyl group transpeptidase (GGT); bilirubin, urea, uric acid; thyroid-stimulating hormone (TSH) (TSH), ferroheme (Hb), hematocrit (Ht); mean corpuscular volume (MCV) (MCV); reticulated red blood cells, leucocyte, neutrophil cell; bands of a spectrum (bands); lymphocyte, basophilic granulocyte, eosinophil; monocyte and blood platelet; make a house call or at infusion front 1 day in screening, in 21,48 and 144hrs p.i. and infusion after six weeks.

x ²: HAHA assesses in blood serum sample, and described blood serum sample gets self-sizing and makes a house call, behind 1 week (144hrs) and six all p.i..

x ³: the assessment of vital sign, make a house call in screening, before the infusion, behind the infusion after 10,60 and 120 minutes and 6 weeks.

x ⁴: body scan reaches 21hrs p.i. and carries out immediately behind infusion.

x ⁵: SPECT scanner uni flat scanning is carried out once when 21hrs p.i..

x ⁶: before the blood sample that carries out pharmacokinetics derives from infusion, when infusion finishes, 5,10,30 minutes 1,2,4,16,21,48,72 and the 144hrs infusion finish after and six all p.i., extract blood sample out and carry out Enzyme Linked Immunoadsorbent Assay (ELISA) and detect radioactivity (details are seen 9.5.4.1). In first 24 hours 0-4 hour of urine collecting, 4-8 hour, 8-12 hour and 12-24 hour, and the blood sample in 24 hours, and the remaining time should arrive 48 hours p.i..

x ⁷: solubility CD44v6 surveys from blood serum sample, before it derives from infusion, and 21,48 and 144hrs p.i., and six all p.i..

6: six weeks.

The B part

Study and indivedual time is shown in the lower flow chart. Individual other checks at following paragraph more detailed description.

Table 3.5.1:2 flow chart B part: with¹⁸⁶The hMAb BIWA4 of Re-mark

Carry out the dosage staged and enlarge research

	Make a house call 1	Make a house call 2						Make a house call 3
	Make a house call 1	Make a house call 2						Make a house call 3		Screening is made a house call^*	The 1st day^*	The 2nd day	The 3rd day	The 4th day	The 7th day	All numbers of following the trail of
		Before the injection	After the injection							Screening is made a house call^*	The 1st day^*	The 2nd day	The 3rd day	The 4th day	The 7th day	All numbers of following the trail of
		Before the injection	After the injection						Signature notice letter of consent	x
Demography concentration, the physical examination for the treatment of medical history	x x x x	x	x	x	x	x	x		Signature notice letter of consent	x							2，3，4，5，6 6
	x x x x	x	x	x	x	x	x		The pregnant HAHA that tests of ECG chest x-ray blood safety analysis urine safety analysis assesses	x x x ¹ x x x ²	x ¹	x ¹	x ¹		x ¹ x x ²	2，3，4，5，6 6 6 6	2，3，4，5，6 6
ENT checks CT or MRI chest CT	x x x ⁸							6x ⁸ 6x ⁸		x x x ¹ x x x ²	x ¹	x ¹	x ¹		x ¹ x x ²	2，3，4，5，6 6 6 6
ENT checks CT or MRI chest CT	x x x ⁸							6x ⁸ 6x ⁸	Include in/exclusion standard	x

Ill-effect vital sign body weight	x ³ x	x x ³ x	x x ³	x	x	x	x		2，3，4，5，6 6 6
Ill-effect vital sign body weight	x ³ x	x x ³ x	x x ³	x	x	x	x		2，3，4，5，6 6 6	Immunity scintigraphy :-body scan-flat scanning-SPECT scanning	x ⁴	x ⁴ x ⁵	x ⁴ (x ⁵)	x ⁴ x ⁵ x ⁵	x ⁴ x ⁵
Pharmacokinetics: blood sample urine collecting serum soluble CD44v6		x ⁶ x ⁶ x ⁷	x ⁶ x ⁶	x ⁶ x ⁶ x ⁷	x ⁶ x ⁶ x ⁷	x ⁶ x ⁶	x ⁶ x ⁷	6 6			x ⁴	x ⁴ x ⁵	x ⁴ (x ⁵)	x ⁴ x ⁵ x ⁵	x ⁴ x ⁵

^*: be evaluated at before the infusion to be no more than before certain infusion and carried out in 3 weeks.

x ¹: blood sample is used for test: glucose, sodium, potassium, calcium, chloride, kreatinin, gross protein, albumin, sGOT, sGPT, alkaline phosphatase, GGT, bilirubin, urea, uric acid, TSH, Hb, Ht, MCV, granulophilocyte, leucocyte, neutrophil cell, bands of a spectrum (bands), lymphocyte, basophilic granulocyte, eosinophil, monocyte and blood platelet, when screening is made a house call or at infusion front 1 day, in 21hrs p.i, 48hrs p.i., and 144hrs p.i., in 2-6 week p.i., obtain at least weekly the security blood samples.

x ³: the HAHA of assessment in the blood serum sample, described blood sample gets self-sizing when making a house call, 144 hrs and six weeks behind infusion.

x ³: vital sign be evaluated at screening when making a house call once, before the infusion, behind infusion after 10,60,120 and 240 minutes and 6 weeks.

x ⁴: body scan is carried out immediately at p.i., in 21,48,72,144hrs p.i., and looks requiredly and carries out at two all p.i..

x ⁵: flat scanning 21,48 (depending on required), 72,144hrs p.i. carries out and look requiredly and carry out at two all p.i.. SPECT scanning is carried out at 72 hours p.i..

x ⁶: before the blood sample of row pharmacokinetics derives from infusion, when infusion finishes, finish rear 5,30 minutes at infusion; 1,2,4,16,21,48,72,144,240 and 336hrs. Extract blood sample out going ELISA, and can detect radioactivity. Urine collecting from 0-4 hour, 4-8 hour, collected in 8-12 hour and 12-24 hour, and all the other times was until 96hrs p.i. collected 24 hours sample during front 24 hours.

x ⁷: detect the solubility CD44v6 from blood serum sample, before described blood serum sample derives from infusion, 21,48 and 144hrs p.i. and six all p.i..

x ⁸: per 6 weeks of disease assessment repeat until PD (progression) maybe can't be followed the trail of. Be the chest CT of baseline values, and if when following the trail of, have and to repeat it when unusual.

3.5.1.1 radio-immunity scintigraphy and dosimeter

Derive from the data of radio-immunity scitiphotograph (RIS), in A and the B part is qualitative presents (namely in tumour, marrow, liver, lung, intestines, the absorption in kidney and the other organ, with low, in or high expression) and in B part quantificational expression.

When qualitative evaluation, the grade of evaluation changes into numeral (0 is the nothing absorption, and 1 is low the absorption, and 2 is that moderate and 3 is highly absorption). Mean values is calculated and is illustrated.

In the B part, RIS result's quantificational expression is to adopt the dosimeter estimation, as listed in the tactful 5.1.4 paragraph, and includes following parameter:

Certain organ when particular point in time is active, represents with MBq.

The holdup time of radioactivity in organ is with a hour expression.

(radiation) dosage that absorbs represents with mGy/MBq.

Effectively (radiation) dosage represents with mSv.

Detailed description about Dosimetric analysis is found in dosimeter report (November 21 calendar year 2001).

E) radio-immunity scitiphotograph step

Be used for the method explanation of A and B part, and time point is shown in the hypomere:

The A part

Utilize the large visual field, the double end gammacamera, it is equipped with low-yield collimating instrument, can be behind infusion at once, and obtain the whole body image (front and back (s.p.) and rear before (p.a.)) of datumization at 21hrs p.i.. Obtain head and neck in plane and the SPECT image of 21hrs p.i.. Also obtain calibration source. Store above data for quantitative analysis.

The B part

With the large visual field, the double end gammacamera of low-yield collimating instrument is equipped with, after delivering medicine to the radioimmunoassay conjugate, at once, and 21,48, obtain datumization whole body image (a.p. and p.a.) after 72 and 144 hours. Head and the flat image of neck can be 21,48 (depending on required) in addition, 72 and 144hrs p.i. obtain. Can carry out after two weeks at p.i. depending on required other image (whole body and plane). Calibration source (namely portion has the solution of ID known portions, and places in 10 milliliters of bottles) embeds in the Adams mirage, between it need place below the two lower limb of patient when body scan. The initial activity of calibration source must be 100-200Mbq¹⁸⁶Re, and this source all will be adopted in all total body opacification researchs. Also to report the setting of energy-window and peak, sweep speed, sweep length, the scanning date is during the time of scanning beginning reaches. Also will measure the A-P thickness of neck and abdomen, and patient is supine position at scan table.

During each video picture, must obtain the place ahead and plane static image, and just before or after this image, must the calibration source in the Adams-mirage get and select a static image.

Must carry out the SPECT research of neck at 72hrs p.i.. Also must report be used for the method for reconstruct, and the filter function that cuts off frequency is arranged.

Single-photon is launched computerized faults method (SPECT)

Utilization is equipped with the Double-head rotary-type gammacamera of low-yield collimating instrument, can obtain the SPCET image. Surveying needs at least 30 minutes. 20% symmetry-windows concentrates on place, 137keV photon peak.

Plane and SPECT data snooping parameter

Planar imaging comprises following minimum requirements: matrix 128 * 128 (detailed) or 256 * 256 (whole bodies) and minimum 400000 countings, maximum detection time be 10 minutes in the hope of in detail, and be applied to whole body in 60 minutes.

The SPECT video picture comprises following minimum requirements: 64 images, and matrix size 64 * 64,360 degree surround orbits, each angle was surveyed in 60 seconds.

The analysis of data

At 21hr p.i. the place ahead whole body image, zone, the right angle of emphasis (ROI ' s) must retouch out round whole body, and round calibration source. Same irregular ROI ' s is round accumulating¹⁸⁶The organ of Re (such as liver, spleen and left kidney), and also must retouch out round tumour. Must retouch out one or more representative background areas. These zones will reflect the rear image. The former ROI that will retouch out before this in the image in the wings round rumpbone. But do not carry out in this test this plan. All Ranges must be kept in the computer, with on the other times point on image projection go out these ROI ' s. Also to report number of pixels, and in each zone the counting of each pixel, during all image time points, the count number in each district must be reported in the trial balance (spreadsheet) in the datumization mode.

The calculating of absorbed dose of radiation in the organ

In the counting of the geometric average among image ROI ' s before and after, estimate organ, tumour and whole live vol. When indication is arranged, application background and correction for attenuation. Plan as original, the activity in urine is not used for estimating the absorbed dose of radiation in bladder. Otherwise, use dynamic bladder model. In organ and in vivo the holdup time at other positions all will be estimated, and input is in the MIRDOSE3 program.

Necessary quality control test

Planar imaging

Carry out the normal quality control of example in the nucleon medical sector weekly:

1) 100M cold light table (flood table).

2) external⁵⁷Co fills low-yield collimating instrument, will carry out weekly.

The SPECT video picture

The quality control of SPECT video picture system need comprise rotation decision center.

Tomography is processed

For tomography reconstruct, use the oblique wave filter in the back projection calculation that filters.

Data are stored

All flat images and tomography data must be permanently stored in magnetic sheet or the laser disc. In tomography research, the image of original projection and the research of reconstruct all will be remembered in a reinforcement video tape. The copy of image and report

To all patients, all need all coherent videos, the backup of pathology and operation report. Also need the copy backup of MRI and CT report.

3.5.1.2 ^99mThe biopsy bio distribution of the hMAb BIWA4 of Tc-mark (A part)

Enter the patient of research A part, perform the operation being infused into behind radiolabeled hMAb BIWA 4 48 hours. Take out in the operation product to be checked from knub position and from the biopsy samples of normal structure. Anaesthetize sb. generally afterwards and take out bone living tissue product to be checked and marrow aspirate. Centrifugal marrow aspirate is to be evaluated at the radioactivity of supernatant (blood plasma) and deposit (cell part). All living tissues product to be checked are all weighed, and measure again^99mThe amount of Tc. %ID/ kilogram tumour and %ID/ kilogram normal structure are compared, to assess out radioactivity to the special absorption of tumour.

The CD44v6 antigen presentation utilizes the section of cryostat with immunohistochemical evaluation, and it is total to incubation with mMAb BIWA1 first, again with anti--mouse immuning ball protein G (IgG) the second reagent incubation. Perform the operation product to be checked and biopsy's product check in histology/cell pathology mode again.

Perform the operation product to be checked and chorologic assessment

After receiving operation product to be checked, process with following order:

1. product to be checked are taken a picture. Polaroid by the place ahead lantern slide by before and after.

2. assess the size of operation product to be checked.

3. taking-up primary tumor, doubtful lymph node carry out biopsy, and if might take out normal structure in the operation product to be checked, such as normal mucosa, Normal Lymph Nodes, lipid and muscle. All living tissues are all weighed, and measure^99mThe amount of Tc. All data change into ID percentage/kilogram tissue. %ID/ kilogram tumour and %ID/ kilogram normal structure are compared, with the special absorption of assessment radioactivity to tumour.

4. next product to be checked move on the plate, and fix at least 36 hours with formaldehyde 4%.

5. after downcutting nutator (structure that high radiodensity is arranged), make actual size and the place of product radiogram to be checked so that related lymph node to be shown. This radiogram immerses product to be checked in 96% ethanol making simultaneously, and it has the identical X-optical absorption as lipid.

6. the institute's nodosity that arrives with the X-axial observation all is illustrated in Polaroid and upward reaches on the product radiogram to be checked.

By the operation product to be checked inspection and all in product to be checked, downcut by the being seen institute of X-light nodosity.

8. all tubercles that are negative under naked eyes process to carry out microscope inspection fully, and assess single section. And the tubercle that is positive under all naked eyes is then made the thin slice more than two. Evidence under the existence of record neoplasm necrosis or the non-existent naked eyes.

Moreover, the tubercle number that surrounds of record, and contain the number of tumor nodule, position and lymph node level (according to the classification of Memorial Sloan Dettering Cancer center).

3.5.1.3 tumor response (B part)

Efficacy parameter for RIT is tumor response. Tumor response is assessed with lesion detection, such as clinically assessment and/or can utilize CT, MRI or bone scitiphotograph check. Assessment is gone according to the reaction normal of WHO. See appendix VI (R96-0941) in the strategy.

3.5.1.4 physical examination

Before studying, each patient's morbid state utilizes CT or MRI to check with ENT inspection and evaluation (comprising palpation) and knub position.

Each neck side is all described the damage of all and neck.

Palpation

All patients are checked by ENT doctor/head and neck surgeon when the basis. This clinical examination can be evaluated at the head and neck area all touch the number of lymph node, size, position and mobility. The characteristic description of lymph node is as follows: unsuspected, under a cloud or have tumor-infiltrated. The state of cervical lymph node was classified to the tumor nodule transfer system of tumour (TNM) stage by stage according to Union Intemationale Contre le Cancer (UICC) in when diagnosis.

Radiological examination

According to all of knub position, need following more than one inspection: CT, MRI, bone scintigraphy. MRI was normally preferred when tumour was invaded head and neck area. In the example of bone injury is arranged, with CT for better. In the B part, all radiology disease assessment parameters of gained when the basis, six weeks repeated behind infusion, and repeated in per six weeks until progress or lose tracking. Patient for entering research B part obtains chest CT at baseline, and if then repeat when following the trail of when chest has the tumour damage. Ultrasonic wave also can be used as another technology of tumor imaging. The criterion that inspection is established is as follows:

Primary tumo(u)r/part-regional recurrence

For the patient who adds research A part, and patient's (B part) that part-regional recurrence is arranged, must carry out CT scan and/or the MRI of head and neck area.

Computer tomography method

The computer tomography method of head and neck area: dynamic type CT is better than vortex-like CT. Yet for the patient that can't cooperate, vortex-like CT may help.

Patient must be with the supine position inspection, and neck slightly excessively stretches, and the fixing and shoulder of head loosens and pushes away downwards. Patient will undisturbedly breathe, and uses belly but not chest muscle. The initial general survey that the zone of wish scanning is made by side projection determines. The plane of scanning motion need to be parallel with vocal cords. Example is normal uses three continuous millimeters to cut into slices. Development must be by the supreme mediastinum of skull base portion (skull base).

Nuclear magnetic resonance image

Sufferer to be detected is lain on the back, and head is crossed slightly extended and fixing head, need breathe softly and use abdominal muscle but not chest muscle between detection period. Must be to suitably manifesting the neck section and assessing the image of the lymph node of the main extent of damage and expansion. Need obtain the image from the supreme mediastinum of skull base portion.

DISTANT METASTASES IN

For all patients that participate in research B part, carry out the CT scan of baseline chest. Carry out extra inspection to observe transfer, such as bone scintigraphy or abdominal CT depending on required.

Chest CT

Can get vortex-like CT-scanning. Patient is with the supine position inspection, and arm is raised excessive. To undisturbedly breathe, use belly but not chest muscle. Patient scanning by directly over the lung to the adrenal gland plane. Must photographic process in mediastinum and lung location.

Abdominal CT

Can get vortex-like scanning. Patient is with the supine position inspection, and arm is raised excessive. Patient must undisturbedly breathe. All patients use oral contrast material. Want scanning area by the diaphragm top to pubic symphysis. Image must be taken a picture in belly and liver location.

The bone scintigraphy

The maximum 600MBq's of intravenous infusion^99mBehind the HDP/MDP of Tc mark, require patient to consume enough fluids and frequently drainage. Can get static overview in 3 hours behind the infusion: the overview of a whole body, and if the detailed overview more than 3 in case of necessity. Suspicious injury region needs to carry out nearer analysis with CT and/or MRI.

Plan is carried out the report of bone transfer reaction according to minute other reaction criterion. Data are not provided.

3.5.1.5 solubility CD44v6

Must in serum, detect solubility CD44v6 (sCD44v6). The immuning adsorpting analysis method (ELISA) of utilizing believable enzyme to connect is measured concentration, it is take commercialization test cover group as the basis, and according to Boehringer Ingelheim Department of Pharmacokinetics and Drug Metabolism, Biberach, the present internationalization criterion of Germany is carried out. Before infusion, respectively get 5 milliliters of blood samples (must be processed into serum) six weeks behind 21,48 and 144 hours p.i. and the infusion. Make blood sample coagulation, and centrifugal preparation serum. Store and shipping conditions: be used for the sample that ELISA detects and place in the cryotronl, carefully mark allow to identified uniquely, be stored in-20 ℃ of lower until radioactivities lower (¹⁸⁶Re:4 week,^99mTc:3 days) and deliver to BI Department of Pharmacokinetics and Drug Metabolism, Biberach, Germany whenever transports in a batch mode all around. Blood serum sample transports in dry ice.

3.5.1.6 security

Experimenter's protection

After during the radiolabeled monoclonal antibody of administration, reaching, monitor carefully all patients. Based on this purpose, at least one examiner is on the scene.

Laboratory Evaluation

Collect blood sample to analyze at following time point: glucose, sodium, potassium; calcium, chloride, kreatinin; gross protein, albumin, serum glutamic oxalacetic transaminase (sGOT); serum glutamic pyruvic transminase (sGPT), alkaline phosphatase (AP), γ glutamyl transpeptidase (GGT); bilirubin, urea, uric acid; thyroid-stimulating hormone (TSH) (TSH), red sanguinin (Hb), hematocrit (Ht); mean corpuscular volume (MCV), granulophilocyte, leucocyte; neutrophil cell; bands of a spectrum, lymphocyte, basophilic granulocyte; eosinophil, monocyte and blood platelet. Described time point is:

Make a house call or at infusion front 1 day in screening, and

Behind infusion 21,48 and 144 hours,

In the A part, 6 weeks behind infusion, in the B part: in 2,3,4,5 and 6 weeks of research, at least weekly (if next more frequent in the toxicity situation).

Screening make a house call or the 1st day of studying obtain infusion before the baseline Laboratory Evaluation, restrictive condition is that the sample of obtaining is to obtain less than 21 days before radiolabeled hMAb BIWA 4 infusions, and carries out the assessment that is necessary. Whether the laboratory results that is necessary again overview and checks eligibility by responsible doctor once before the antibody infusion. This way can be applied to hMAb BIWA 4 administrations second time of B part Study equally.

When following time point, collect urine sample, to carry out hospital's screening (protein, blood and glucose) of standard:

Screening is made a house call

A week behind the infusion (144hrs p.i.)

Six weeks behind the infusion

Make a house call and when research finishes, test pregnant to conceived possible women is arranged in screening.

The mankind-Anti-Human's class-antibody assessment

Existence and/or the progress of assessment HAHA in blood serum sample. Therefore when screening is made a house call, a week behind the antibody infusion (144hrs p.i.) and six weeks, take 5 milliliters of blood samples (will be processed into blood sample). Patient for partly accept quadratic B IWA 4 administrations at B will collect extra HAHA product to be checked before the administration second time. Serum levels is assessed with reliable ELISA method.

Make sample solidify and then centrifugal preparation serum.

Store and shipping conditions: be used for the sample that ELISA detects and put in the cold temperature pipe, mark allows to unique evaluation carefully, store in-20 ℃ until survey and radioactivity reduce (¹⁸⁶Re:4 week,^99mTc:3 days) and whenever deliver to BI Department ofPharmacokinetics and Drug Metabolism, Biberach, Germany in a batch mode all around. Blood serum sample must transport in the dry ice mode.

Any raising of human anti-human antibody-like level all compares with the possible side effect of patient carefully by case history. Collect this data, and in research process, carry out the retrospective analysis.

Ill-effect

All ill-effects all are reported among the CRF. Described effect according to US National Cancer Institute CTC (NCI-CTC) 2.0 version classifications (this file version product are downloaded from following network address:http：//ctep.info.nih.gov/CTC3/ctc.htm.) all SAEs all need report.

Immunogenicity and toxicity

Before carrying out this test, there is no the data information of human body aspect about hMAb BIMA4 security and immunogenicity aspect. In the research of formerly carrying out with parental generation mouse antibodies BIWA1, do not run into clinically significant toxicity. And naked hMAb BIWA 4 antibody individually and inexpectancy toxic (in external cell-mediated cellular toxicity (ADCC) effector function that relies on without antibody; Disturb the antigen of expection-expression proliferation). There is proof to point out that hMAb BIWA 4 can be administered to mouse (heterograft research) and monkey (toxicity research) safely. Provable good local tolerance in three local toxicity researchs.

Mouse and mosaic MAb U36 (anti--the CD44v6-epi-position, that clear and definite overlapping epitope specificity is arranged) are fool proof at present in patient HNSCC; Enlarge in the RIT research as seen except bone marrow toxicity at the I phase dosage that carries out with cMAb U36-staged (by¹⁸⁶The Re-mark is caused) and avirulence. Allergic reaction to radiolabeled hMAb BIWA 4 may occur, and this is possible in theory. Monoclonal antibody has been administered among hundreds of the patients for diagnostic application.

Although as if impossible, can comprise may reacting of intravenous administration BIWA 4: low blood pressure, temporary transient heating and feeling cold, fash, expiratory dyspnea is scratched where it itches, and feels sick and allergic reaction.

Therefore vital sign (blood pressure, body temperature, pulsation and respiratory rate) is made a house call and following time point record in screening: reach behind the infusion 10,60,120 minutes infusion before and after 6 weeks. Patient for only participating in the B part will record extra vital sign in 240 minutes behind infusion.

In this research, use radionuclide. With the gamma-rays active nucleus^99mIt is similar that the relevant radiation function of Tc burden (being 20 millicuries in present research) and the normal nucleon medical science step of many examples run into, and known be little. Reduce to minimum in order to expose to the open air the radiation of bladder and kidney, patient in front 48 hours, to fully drink water and be required often to drain (with¹⁸⁶Behind the antibody infusion of Re-mark 96 hours).

About β-and gamma-radiation active nucleus¹⁸⁶Re, Breitz et al. (R98-2459) finds¹⁸⁶The maximum tolerated dose of MAb IgG in height preliminary treatment patient of Re-mark is 90 millicurie/rice² One of target of this research is among the research patient¹⁸⁶Re-is through the toxicity of mark hMAb BIWA 4, and described patient has part and/or regionality to recur disease again, and to this without applicable treatment processing selecting, described patient or at a distance transfer is arranged. Because marrow, thyroid gland, kidney and hepatotoxicity wind agitation may occur, so will be according to the described blood sampling of 3.5.1.6 paragraph to carry out the organ dysfunction test.

In order to monitor the generation of losing weight or increasing, the 1st day and 6 all rear record body weight when screening is made a house call that reach before infusion.

Monitor the generation of patient's local toxicity. Any local toxicity sign all is recorded as ill-effect.

3.5.2 the suitability that detects

Employed mensuration is tested and can fully be accepted this type.

3.5.3 main effectiveness/pharmacodynamic parameter

3.5.3.1 the A part of test

The main efficacy parameter of measuring in test A part is that living tissue distributes and the radio-immunity scintigraphy. How to obtain the method for data and describe, be shown among 3.5.1.1 and the 3.5.1.2.

Absorption in normal structure and tumour detects in the living tissue of operation product to be checked, and takes in percentage (%ID/ kilogram) expression with the per kilogram ID. Be evaluated at the time-histories of taking in tumour and the hetero-organization thereof, and with the BIWA 4 of various dose relatively.

3.5.3.2 the B part of test

The major parameter of rendeing a service is radio-immunity scintigraphy and posologic analysis.

3.5.4 detection of drug concentration/pharmacokinetics

In the A of test part and B part, all to measure the haemoconcentration through radiolabeled BIWA 4.

3.5.4.1 the method for sample collection and opportunity

Collect patient's blood sample and following processing: under the time point of appointment, in the opposite arm peripheral veins of infusion site, extract 7 milliliters of blood (3.5 milliliters in the pipe that contains EDTA sylvite, in addition 3.5 milliliters in coagulation vessel; Desired ml vol is shown in amendment 1) (namely before administration antibody, reach in the infusion end, and 5,10,30 minutes; 1,2,4,16,21,48,72 hours p.i. and 7 days p.i. (144 hours) and 6 all p.i.). Infusion finishes to be considered as t=0.

Blood sample when test B partly saves at 10 minutes and 6 all p.i.. Otherwise collect at 240 and 366 hours p.i., shown in amendment 1.

Urine be collected in 48 hours during be^99mBehind hMAb BIWA 4 infusions of Tc-mark, and during 96 hours be¹⁸⁶Behind hMAb BIWA 4 infusions of Re-mark. Urine collecting was by 0-4 hour during front 24 hours, 4-8 hour, and 8-12 hour and 12-24 hour, and all the other times are samples of 24 hours. Radioactivity in the counting urine sample is to measure the drainage of radioactivity.

Blood sample is centrifugal with serum. Before processing, measure the radioactivity in the whole blood. Also measure the radioactivity in the serum. It is necessary that the refrigeration of blood sample is stored, yet sample need be freezing. Utilization is by the equal portions that keep in the coupling preparation, makes standard items with what inject patient dose through the dilution of weighing. Carry out the counting of patient samples and standard items according to local SOPs. Outcome record is in the suitable paragraph of CRF. Active nucleus content is with the percentage report (%ID with blood per jin or serum represents) of implantation dosage. Except the counting radioactivity, all samples all utilizes HPLC to analyze the existence of immune complex.

The equal mark following information of all samples test tube: test number, patient number, sample essence (being serum, blood plasma or blood), with respect to the time of infusion, the real time, actual date and isotope are (namely^99mTc or¹⁸⁶Re). Detect the amount of each urine sample, and record and all urine sample mark following informations: test number, patient number, the gross sample volume, collection interval, the actual time, date and isotope are (namely^99mTc or¹⁸⁶Re)

On the date of all pharmacokinetics samples, number of times and radioactivity detect and all are recorded among the CRF.

The plasma sample that detects for ELISA is transferred in the cryotronl, and mark be in order to can identify uniquely carefully, store in-20 ℃ of lower until radioactivities lower (¹⁸⁶Re:4 week,^99mTc:3 days), and deliver to Boehringer Ingelheim Department of Pharmacolinetics and Drug Metabolism, Biberach, a collection of around Germany is every. Plasma sample transports at dry ice.

3.5.4.2 analytical mensuration

Plasma sample is with reliable ELISA method, at Boehringer Ingelheim Department of Pharmacokinetics and Drug Metabolism, and Biberach, Germany detects. The radioactivity counting of sample is undertaken by the researcher in serum and the urine at whole blood.

3.5.4.3 parameter and assessment

Following pharmacokinetic parameter utilizes WinNonlin 3.1 Professional (Pharsight Corporation, Mountain View, CA) to measure from whole blood, blood plasma, and serum levels, image data such as following:

Main pharmacokinetic parameter is the time point (T that can be observed maximum drug concentration_max), viewed maximum drug concentration (C_max), the area under concentration time curve (AUC)_0→∞, finally eliminate the half-life (t_1/2), volume of distribution (stable state of latter stage and prediction), CLTB (CL), and mean residence time (MRT)_0→∞。

The main purpose of pharmacokinetics analysis is:

Single dose of administration^99m(the A part) of Tc-mark reaches¹⁸⁶Behind the hMAb of Re-mark (B part) BIWA 4, relatively reach the speciality of measuring total radioactivity and immunoreactive hMAb BIWA4.

Dispose (disposition) data from video picture data and blood, can estimate the ratio of the radioactivity of injecting that arrives under study for action liver and spleen. For reaching this purpose, use WinNonlin^Package software behind intravenous administration, carries out the pharmacokinetics analysis that non--space is distinguished to the PC vs. time diagram of immunoreactivity hMAb BIWA 4 and total blood radioactivity level, and it is time function relation.

The result reports it with the summing-up statistic.

3.5.5 pharmacokinetics/pharmacodynamics correlation

Be intended at first with the pharmacokinetics pattern that the space is distinguished in person of good sense's body¹⁸⁶Re-is through distribution and the metabolism of mark BIWA 4. Be intended to make up the data information from following: BIWA 4 blood plasma levels, whole blood and serum radioactivity detect, from the radioactivity of whole body image and emphasis special area, institute's administration¹⁸⁶Re-is through mark BIWA 4 dosage, the dosage of the BIWA 4 of un-marked, solubility CD44v6 level, and before infusion through the assessment of radio-labeled antibody.

The result reports it with the summing-up statistic. Yet, too high so that can't become rational pattern because of variability.

3.5.6 main security parameters

Decision and the safety evaluation of maximum tolerable dose are the main terminal points of B part of test. The mensuration of doing is set forth in 3.5.1.6.

3.5.6.1 toxicity dose limitation and maximum tolerated dose

DLT is defined as 3 grades of non-haematics toxicities of the CTC relevant with medicine, or 4 grades of haematics toxicities of the CCT relevant with medicine, feeling sick and vomiting under processing without appropriate antemetic got rid of.

MTD is defined as the dosage level that develops into medicine-relevant DLT among six patients less than two people.

3.6 data quality guarantees

This test is carried out according to good clinical practice principle substantially, such as the regulation and control that are fit to and in the company standard operating procedure (reflecting these regulation and control) the spy show.

In whole research process, study the place with the progress of follow from representative contact and/or the access of Boehringer Ingelheim The Netherlands. With regard to the data auditing purpose, the researcher has frequently with the person of making a house call and contacts, and comprises coming the comparison of source file and case report, and medication dosing is checked. Researcher or its designer must be to touch for Boehringer Ingelheim The Netherlands representative during these are made a house call.

The CRFs that fully fills in collects regularly. Data are inner with the input of repetition-data mode. Carry out the overview of data, and can holding the researcher of being difficult to adopt is doubtful.

Serious ill-effect, foundation reach the criterion among the CRF in strategy, and report according to Boehringer Ingelheim SOPs.

3.7 determining of the statistical method of in strategy, planning and sample size

3.7.1 Classified statistics plan

3.7.1.1 statistics design/pattern

The design that is used for this test is usually used in the test of I phase oncology.

The A part

The A that this I phase tests partly is a group study not controlled, that sequentially raising is measured, and can measure single infusion in the squamous cell carcinoma patient that head and neck progress is arranged^99mSecurity, tolerance, bio distribution and pharmacokinetics behind the hMAb BIWA4 of Tc-mark.

At this study portion, use three hMAb BIWA 4 dosage levels, and plan to adopt three patients at each dosage level. All patients have certified head and tumor colli, and predetermined will the operation.

The B part

The B that this I phase tests partly is that an open not controlled dosage staged is amplified research, to measure in the squamous cell carcinoma patient that head and neck progress is arranged¹⁸⁶Security behind the hMab BIWA 4 single infusions of Re-mark, tolerance, MTD, pharmacokinetics and preliminary therapeutic action, and this disease is without adoptable recoverable processing selecting.

At this study portion, radiological dose is that staged enlarges. Two patients process with dosage level, wherein being seen toxicity＜2 grade CTC toxicity. If visible 〉=2 grades of toxicity, then the patient of each dosage group processing has three at least.

Security and tolerance assessment (A+B part)

With regard to laboratory parameters, vital sign, the development of HAHA and the incidence of bad experience are assessed security and the tolerance of this research. The result is other each dosage level just, and with regard to the ensemble average value reporting it.

Life distributes and assesses (A part)

In solid tissue^99mThe hMAb BIWA 4 of Tc-mark distributes, and reaches with radio-immunity scintigraphy (seeing 3.5.1.1) and can assess via the detection (seeing 3.5.1.1 and 3.5.1.2) of living tissue product radioactivity to be checked. Because each dosage level at most only 3 patients adds, and therefore the formula statistics only may be arranged.

The immunity scitiphotograph is developed and is assessed (A+B part)

Behind radiolabeled antibody, when particular point in time, can obtain immune scitiphotograph development (seeing 9.5.1.1) in administration. The same formula statistics that only has can be employed.

Pharmacokinetics assessment (A+B part)

Following pharmacokinetic parameter from blood plasma or serum, determines in urine level and the image data, and is as mentioned below:

Main parameter (non--space is distinguished)

T _max，C _max, AUC (0-infinitely great time), final half-life of eliminating, volume of distribution (latter stage V_zAnd the stable state V of prediction_ss), CL and MRT (infinitely great time of 0-). Radioactivity accumulation urine excretion rate in time can be determined by total urine discharge rate.

Less important parameter (space is distinguished)

The pharmacokinetics pattern that the planned development space is distinguished is to define the human body people¹⁸⁶Distribution and the metabolism of the hMAb BIWA 4 of Re-mark. This pattern can relatively detect and next data from serum and urine radioactivity, from the radioactivity in whole body image and the special zone of emphasis, institute's administration¹⁸⁶The dosage of the hMAb BIWA 4 of Re-mark, hMAb BIWA 4 stablizes load (cold-loading) dosage, solubility CD44v6 level, and before the infusion through the assessment of radiolabeled antibody.

The result reports respectively under each dosage level through plans, and utilizes summing-up statistics.

Assessment (B part) is renderd a service in treatment

Tumor response is the parameter that treatment is renderd a service. Tumor response is assessed according to the WHO criterion. The summation of the product of all surveys and tumour damage maximum perpendicular diameter is the major parameter of tumor response. Assessment for the skeletal injury reaction has different criterions in this.

3.7.1.2 chainless power and different hypothesis

All analyses all are description and inquiry in essence in this test. Any statistical test, it only carries out as a statistical framework is provided, thus observable result and offer help to planning further research. Do not predict any formal statistical inference, and therefore do not carry out statistical test.

3.7.1.3 calculated analysis

Distinguish two colonies:

The subgroup that is intended to treat (subset) comprises all patients, and these patients have accepted the infusion through radiolabeled hMAb BIWA 4, and the data behind baseline are available.

The subgroup of strategy (per-protocol) comprises appreciable patient fully. When if following criterion meets, then this patient is appreciable:

The A part:

1. meet the criterion that is intended to treat subgroup.

2. with regard to ill-effect, vital sign and security blood and urine sample, its tracking is suitable.

3. in two kinds of analyses of carrying out, at least one immunoreactivity part is arranged greater than 60%.

4. suitable living tissue detection and scitiphotograph image can use to assess bio distribution.

The B part:

1. meet the criterion that is intended to treat subgroup.

4. reaction: if on baseline, can get suitable tumour measured value, and if patient is tracked reached at least six weeks,

Appreciable for the reaction patient then. If can be observed the carrying out of disease in during this six week, then patient also is appreciable for reaction.

Main analysis

Carry out main analysis with regard to complete tactful subgroup.

But none evaluating patient is replaced. For the A part, therefore planning appreciable subgroup contains 9 patients, and the subgroup of intention treatment is comprised of at least 9 patients. For the B part, patient's number is complied with the toxicity that runs into and is decided. Can be evaluated for toxicity but reaction then can not evaluated patient be replaced.

Pharmacokinetic data:

The analysis of pharmacokinetic data is by Dr.Thomas R MacGregor, Boehringer Ingelheim Pharmaceuticals Inc.Ridgefield CT, and USA carries out.

The main purpose of pharmacokinetics analysis has:

1. in order to measure and to compare single dose of administration^99mThe hMAb BIWA 4 of Tc-mark reaches¹⁸⁶Behind the hMAb BIWA 4 of Re-mark, the characteristic of total radioactivity and immunoreactivity hMAb BIWA 4.

2. in order to identify hMAb BIWA 4 suitable stablizing-load (cold-loading) dosage.

3. in order to assess¹⁸⁶The character that the hMAb BIWA4 of Re-mark is second dose.

4. in self imaging data and the blood gained data, arrive the ratio of the injection radioactivity of liver and spleen between can estimating under study for action. For reaching this purpose, use WinNonLin^Package software behind intravenous administration, in the time overview (functional relation that be time) of PC to immunoreactivity hMAb BIWA 4 and total blood radioactivity level, carries out the pharmacokinetics analysis that non-space is distinguished. All mensuration that relate to radioactivity are all proofreaied and correct to the radio-labeled part, its before infusion be with protein bound and the tool immunoreactivity. The special pharmacokinetic parameter that produces comprises: T_max，C _max, AUC (infinitely great time of 0-) finally eliminates the half-life, volume of distribution (the most final and predetermined stable state), CLTB, and mean residence time (infinitely great time of 0-). Also in total urine output quantity, determine the homaluria rate of radioactivity accumulation in time.

Second purpose of pharmacokinetics analysis is to develop to describe in the human body¹⁸⁶The distribution of the hMAb BIWA 4 of Re-mark and the pharmacokinetics pattern of metabolism, but its why not reach be that the high variability of factor data is (so especially radiating the scitiphotograph data).

The analysis of next

The analysis of next only is intended to treat subgroup to the patient who participates in research B part and carries out.

Less important analysis is limited to key terminal point: such as reaction rate, and reagentia phase, progress time.

The temporary transient analysis

Do not carry out temporary analysis.

3.7.1.4 the processing of the data of omission

Being contemplated to most data in studying in this I phase all can be used for analyzing. If missing data is arranged, most possibly be that the omission reason is not relevant with the result. There is no omission data imputability.

3.7.2 determining of sample size

In A part, three patients of each dosage level are for providing some information on the security of hMAb BIWA4 and the correct dose to 50 milligrams of unmarked hMAb BIWA4 expections.

In the B part, six patients are regarded as being enough to determine DLT. Table 3.7.2:1, in all patient populations, for the basic speed of some supposition of DLT, this table presents the possibility that has PLT to be examined more than 2 or 2 to know among 6 patients.

Colony's ratio that table 3.7.2:1DLT infers

	0.40	0.42	0.45
	0.40	0.42	0.45	In 6 patients, can be observed the possibility of DLT more than 2 or 2	0.77	0.80	0.84

The source: the possibility estimation is from the cumulative distribution function of bi-distribution, n=6 and vicissitudinous p ' s.

Enlarge plan by staged in this test, the possibility that two or two above patients present DLT is at least 80%, if these potential indivedual possibilities that patient is reached DLT are 42% or 42% when above.

3.8 research carry out in or the variation in the planning analysis

Variation in the following strategy is implemented via amendment.

Via the enforcement of the No1 amendment on September 1st, 1999, the time point of capable of regulating blood sample collection. B part in test, the sample in 10 minutes and 6 weeks is missed behind the infusion, but regathers extra sample after infusion finishes in 240 and 336 hours. The result is that original blood sampling formula can't fully suitably be encompassed in the viewed 50 hours supposition half-life in the test A part. Totally 3.5 milliliters blood is collected in the EDTA sylvite pipe, in addition 3.5 milliliters in solidifying pipe.

Mention patient in the strategy after measuring MTD, again second dose of administration¹⁸⁶Re-BIWA 4. This step is modified by amendment 2. As patient couple¹⁸⁶The first time administration of Re-BIWA 4 produces reaction, this itself and have no side effect or recovered from side effect and without HAHA antibody, then patient visual is for being suitable for the second cycle for the treatment of. Reaction is defined as stable disease (namely unchanged), partial rcsponse or fully alleviation. Second dose of institute's administration is 50 millicurie/rice all the time² Because the change of connexon, test can reached a conclusion first before inspecting in carrying out second dose under the course for the treatment of with the dosage described in the strategy. For in any case the patient who responds all can be treated, so announce amendment 2.

After reaching MTD, because the change of connexon, test is finished and is stopped. In the further developing of BIWA 4 plan, MAG3 can replace by MAG2GABA-TFP.

For the non-more time point of originally planning, sample can be used for the mensuration of sCD44v6.

At assessed information and after having discussed with test team, can carry out following change.

Because result's variability is only carried out %ID/ kilogram tumour to the proportion grading of %ID/ kilogram nonneoplastic tissue to marrow.

Assessment to tumor size is as the same. Mensuration is incomplete, therefore jeopardizes rational assessment.

Therefore formally analyze.

4 research themes

4.1 experimenter's characteristic (disposition)

Screened among the patient at 33, three patients end test (table 6.1:1) because of the ill-effect before the medicine-feeding test medicine. These three patients also are not included in the analysis. Having 30 patients enters and receives treatment in this test.

The A part

There are 10 to be included in the A part among 30 patients, accept respectively 25 milligrams and 100 milligrams^99mTc-BIWA4 respectively has 3 people, and 4 people accept 50 milligrams^99mTc-BIWA4. All patients in the A part have all finished test.

The B part

There are 2 to end (two patient deaths) because of ill-effect among 20 patients that in B part, receive treatment. 50 millicurie/rice that three patient's administrations are second dose²。

Table patient's 6.1:1 characteristic

A part B part summation

^99mTc-BIWA4 ^99mTc-BIWA4[millicurie/rice²]

2.5 50 milligram of 100 gram 20 30 40 50 60 of milligram

BIWA4 BIWA4 BIWA4

Screened 33

Enter 34324365 30

34324365 30 for the treatment of

Finish 34323265 28

000011002 of interruption

Because AE 000011002

Because invalid 000000000

Because other reasons 000000000

Source appendix 16.1.9.2 table 1.1

4.2 method error

Most policy violation situation is to depart from the blood that proposes in the strategy and/or the time window (＞± 10%) of urine sampling. Affected patient also is not precluded within outside the analysis, but when measuring the clear and urine concentration of blood, blood plasma, serum and urine, still adopt collect blood or urine really in real time between.

5. effectiveness/clinical pharmacology assessment

By the as a result susceptible of proof of A part, the dosage of 50 milligrams of BIWA4 is the most suitable dosage that is used for the treatment of. Data by B part show, using than the dosage that can be observed DLT also during low radiological dose, patient clinically can by¹⁸⁶Be benefited in the Re-BIWA4 treatment.

Survey and BIWA4 concentration be proportional with dosage, and the moderate amount of institute's dosage is by RE.

5.1 data component is analysed

At least accept all patients of potion trial drug, include in being intended to the treatment analysis. 7 patients from the A part are included in the complete analysis of strategies. And do not carry out complete analysis of strategies in the B part.

5.2 demography and other basic characteristics

All patients that include in are 56 years old (by 37 to 78) average age. 19 male sex and 11 women (table 5.2:1) are arranged.

Subject three never smokings of patient in the A part, and 7 be existing smoker (19-47). In 8 patients, have report to point out to like to drink, and 2 do not drunk. (table 5.2:1).

All patients or be with Ex smoker or average 35 (by 10 to 86) of existing smoker (showing 5.2:1) in the B part. Do not drink for six, and all the other patients like to drink (table 5.2:1).

All patients that comprise in the A part, but its disease stage is local operation, and recurrence disease (15 patients) is arranged and/or shifted (3 patients) from the patient of B part. 1 disease that patient has the part to perform the operation. There is 1 patient's data to be lost.

The disease followed or relevant medical history report are arranged in 28 patients. (table 5.2:1). All patients all need the treatment followed. The most frequently used medicine has: analgestic, sedative, lactulose, H₂-blocking agent, antemetic and antimicrobial.

Table 5.2:1 demography and basic characteristic. What illustrate is age mean value.

Other numerals all represent patient's number

A part B part summation

^99mTc-BIWA4 ¹⁸⁶Re-BIWA4[millicurie/rice²]

2.5 50 milligrams 100 milligrams 20 30 40 50 60 of milligrams

BIWA4 BIWA4 BIWA4

n 3 4 3 2 4 3 6 5 30

Age [on average] 45.7 58.5 58.7 57.0 61.0 53.0 57.0 60.4 56.4

Male/female 2/1 2/2 1/2 1/1 3/1 2/1 5/1 3/2 19/11

Accompanying diseases 33224365 28

Follow treatment 34324365 30

The smoker 24101031 12

In the past-smoker 00023334 15

The alcohol user 33203362 22

The patient who includes the A part in is including the initial diagnosis that precontract 1 month was known disease in, and it is namely sick (by 0.1 to 17.5 year before average 2 years to be included in B patient partly; Table 5.2:2). A part patient's Karnofsky mark is by 70 to 100. And the patient of B part has the Karnofsky mark (table 5.2:2) of 70-90.

There is 1 patient it was reported in the test B part and diagnoses out transfer.

All patients all carry out previous radiation-and/or chemotherapy in the B part, and both it was reported without previous chemistry-also without radiotherapy (showing 5.2:2) the patient of A part. Cis-platinum, methotrexate and fluorouracil are the most frequently used general anticarcinogen).

In 13 B part patients of previous operation. It is radical-abilities that 11 previous operations are arranged. And in the A part only a patient lived through previous operation (table 5.2:2).

The lesion size of tumour (comprising transfer) is 14 millimeters²To 10304 millimeters² Former knub position can moderately be distinguished in most patient. In 13 patients, its lymph node infected (table 5.2:2).

Table 5.2:2 demography and basic characteristic. Known disease is shown

Average life and Karnofsky mark. Every other numeral

Expression patient's number

A part B part

^99mTc-BIWA4 ¹⁸⁶Re-BIWA4[millicurie/rice²]

2.5 50 milligrams 100 milligrams 20 30 40 50 60 of milligrams

BIWA4 BIWA4 BIWA4

n 3 4 3 2 4 3 6 5

The known disease time limit 0.11 0.08 0.07 9.30 2.13 1.17 0.80 1.16

Kamofsky mark 90 90 100 80 75 76.7 85 80

The operation 00022124 of radical-ability

Infected lymph node 22023211

Previous chemotherapy 00013141

Previous radiotherapy 00024365

5.3 the mensuration for the treatment of compliance

Giving all under the supervision of researcher or representative of all medicines. Collect blood to measure the pharmacokinetics of BIWA4. All patients all have can survey and BIWA4 blood in level.

5.4 effectiveness/clinical pharmacology result

There are three among six patients at 50 millicurie/rice²Maximum tolerated dose under stable disease. Having confirmed 50 milligrams of BIWA4 dosage in test A part, is optimum dosage with regard to haemoconcentration and the absorption of selective tumour. The PC of BIWA4 is proportional with dosage in 25 milligrams to 100 milligrams BIWA4 scopes in A part, and the peak is at 0.9 hour, finally eliminates the half-life and be 54-74 hour in the A part, and 94 hours in the B part.

5.4.1 analysis/pharmacodynamics of rendeing a service

5.4.1.1 main terminal point (endpoint)

The main terminal point of rendeing a service is^99mTc-BIWA4 is in the bio distribution of A part. Further main terminal point is respectively radio-immunity scitiphotograph development and pharmacokinetics (being set forth in 5.4.2) in the A of test part and B part. Dosimeter is only partly carried out at B.

In the A part^99mThe bio distribution of Tc-BIWA4

In operation, can obtain tissue sample,^99mThe absorption of Tc-BIWA 4 is with % ID (ID)/kilogram tissue expression.

Be intended to treatment (ITT) subgroup: in all three dosage groups, in knurl^99mThe relative bioanalysis of Tc-BIWA4 is the highest, except patient 1 (25 milligrams of BIWA4), and patient 5 (50 milligrams of BIWA4, negative for tumor cells) and patient 9 (100 milligrams of BIWA4). Absorption in the tumour, in 25 milligrams, in 50 milligrams and the 100 milligrams of dosage groups respectively scope by 6 to 17%ID/ kilograms, 5 to 28%ID/ kilograms and 13 to 17%ID/ kilograms. Tumour take in through the estimation average ratio to the absorption in the marrow, in 25 milligrams, 50 milligrams and 100 milligrams of dosage groups are respectively 1.7,2.6 and 2. (table 7.2:1 and 7.2:2).

A complete strategy (per-protocol) is subgroup (PP): in all three dosage groups,^99mThe relative bio distribution of Tc-BIWA 4 is the highest in tumour, except patient 1 (25 milligrams of BIWA4). Absorption in the tumour, in 25 milligrams, 50 milligrams and 100 milligrams of dosage groups are respectively 6 to 17%ID/ kilograms, 23 to 28%ID/ kilograms and 16%ID/ kilogram. Tumour take in through estimating average ratio to the absorption in marrow, in 25 milligrams, be respectively 1.7,3.2 and 2.5 (table 7.2:1 and 7.2:3) in 50 milligrams and 100 milligrams of dosage groups.

As if less tumor size has larger absorption tendency, be present in 25 milligrams of BIWA4 dosage groups. And 50 milligrams and 100 milligrams of BIWA4 dosage groups because limited patient's number therefore as if similarly assessment can not (table 7.2:4).

Can be observed high %ID/ kilogram in bone marrow supernatants liquid (up to the 17%ID/ kilogram) and blood plasma or blood (up to the 13%ID/ kilogram) takes in, it is lower than the absorption of tumour in the complete tactful colony all the time, except patient 1 (25 milligrams of BIWA4). Absorption in skin and mucous membrane is lower than the absorption in primary tumor all the time in complete tactful subgroup.

In the A part^99mThe radio-immunity scitiphotograph video picture of Tc-BIWA4

Although infusion be in tumour directly and have no the absorption of radioactivity, after 21 hours, can record 1.9 moderate and take in. The absorption of radio-immunity conjugate, in reaching immediately behind the infusion after 21 hours, as if all low in marrow and kidney. Absorption in lung is low to moderate, and liver then has higher absorption.

In complete tactful colony, can be observed similar pattern. Unique difference seemingly has higher absorption in kidney, and in lung for lower, this is and is intended to treat colony comparatively speaking.

In the B part¹⁸⁶The radio-immunity scitiphotograph of Re-BIWA4 is developed

Behind infusion, immediately, reach and carry out radio-immunity scitiphotograph inspection after 21,48,72,144 and 336 hours. Behind infusion, almost do not observe immediately any absorption is arranged in the tumour. Relative absorption in tumour is seemingly relevant with dosage, and arrives moderate and highly absorption after being added in time 72 to 144 hours, but descends after 336 hours.

In the bio distribution of radioactivity, be similarly in marrow, lung, liver, kidney and intestines, and do not demonstrate identical dosage dependence effect (except intestines). Moreover, the relative absorption of radioactivity seemingly constant or in time appropriateness descend, and under all radioactivity dosage, be similar. For most for the treatment of groups, the absorption in the marrow is minimum.

5.4.1.2 terminal point for the second time

The terminal point second time of rendeing a service is respectively the tumor response that B is partly treated, and the expression of CD44v6 in tumour in the A part. All measure the expression of solubility CD44v6 in the A of test and the B part.

The CD44v6 of tumour expresses in the A part

The determination data of CD44v6 antigen presentation can be applicable to seven patients. The CD44v6 antigen presentation can be observed in surpassing 90% and 80% tumour cell respectively in 5 and 2 patients, and the CD44v6 antigen presentation can be surveyed in surpassing the cell of 90% lymphatic metastasis in 4 patients and, wherein lymph node can be for assessment. In all patients' mucous membrane, can be observed the CD44v6 antigen presentation of homogeneous. Tumor response in the B part

With up to 40 millicurie/rice² ¹⁸⁶The patient of Re-BIWA4 dosage treatment is not exposed to clinical tumor response. All patients are exposed to progressive (progressive) disease. A patient is arranged because concurrent death causes and can't assess.

Six with 50 millicurie/rice² ¹⁸⁶There are three to develop into stable disease among the patient of Re-BIWA4 treatment, or unchanged after for the first time circulation. Two people are arranged with 50 millicurie/rice among these three patients² ¹⁸⁶Another circulation treatment of Re-BIWA4, and after the second circulation, progressive disease is arranged. After for the first time administration of trial drug, respectively 148 days (patient 109) and can be observed progressive disease after (patient 116) in 127 days.

There is one with 60 millicurie/rice² ¹⁸⁶The patient of Re-BIWA4 treatment is being circulated for the first time by having gone through stable disease. This patient is at 50 millicurie/rice² ¹⁸⁶Enter PD (after the administration first time of tested medicine 173 days) after the second circulation of Re-BIWA4.

For to treating unresponsive patient, its whole time range of carrying out is by 0 to 55 day, about 5 to 6 weeks of average out to, and treatment group is irrelevant.

Solubility CD44v6 in A and B part

In this test, measure the solubility CD44v6 with all patients of BIWA4 treatment.

For with¹⁸⁶The patient of Re-BIWA4 treatment, solubility CD44v6 detection limit trend increases (table 7.2:6) in the test of B part, and for the A part with^99mThe patient of Tc treatment does not then observe this kind tendency.

5.4.2 drug dose, drug concentration reaches the correlation with reaction

The pharmacokinetics of BIWA4 will present in A and B part respectively, because the radio-labeled difference is (the A part:^99mTc; The B part;¹⁸⁶Re)。

5.4.2.1 about BIWA4, the analytical performance of HAHAs and CD44v6

Utilize reliable analytic approach analysed for plasma sample. The analysis of quality control sample can produce the sample of height correctness and accuracy.

Analytical performance about sample γ counting

The signal linearity of scintillation crystal in gamma counter do not tested. It can infer according to the instrument type, at least used energy range at present research. Correcting sample demonstrates the typical 40000-200000 counting of per minute, is less than the counting of 50-100 with respect to per minute in the Background Samples. The accuracy that each calibration standard product is measured for seven times is fully in 2%. Under this accuracy, measure blood, serum and urine, each parallel three parts of detection. Blood and blood serum sample can show the typical activity between per minute 2000 and 100000 countings.

For the radioactivity counting, there is no the quality control sample at this. The calibration standard product reach by the sample of deriving in this research, and the accuracy that its accuracy through replication demonstrates three mensuration is better than 2 % at least.

5.4.2.1 pharmacokinetics

The A part

A partly includes 10 patients, and it accepts single dose of BIWA4 by 25 to 100 milligrams, and 20 millicuries are arranged^99mThe fixedly radio-labeled dosage of Tc. Through behind the short-term intravenous infusion, the drug metabolism kinetic parameter is shown in table 5.4.2.2:1 in the blood plasma of the BIWA4 that detects with ELISA.

In the table 5.4.2.2:1 research A part, BIWA4

Pharmacokinetic parameter in the blood plasma

Patient BIWA4 tmax Cmax half-life AUC_inf Vz CL MRT

Agent (dividing) (ng (hour) (microgram little (liter) (ml/min) (hour)

When (milligram)/ml)/milliliter)

1 25 0 6634 44.1 387.4 4.1 1.076 58.0

2 25 30 6640 67.0 534.7 4.5 0.779 94.8

3 25 10 9590 53.3 542.9 3.5 0.768 71.0

4 50 29 14900 64.9 1112.3 4.2 0.749 84.8

5 50 121 15500 102.8 1580.2 4.7 0.527 135.2

8 50 5 13900 53.0 831.0 4.6 1.003 71.7

10 50 41 16700 83.8 1461.6 4.1 0.570 110.0

6 100 4 30500 85.0 2548.9 4.8 0.654 112.0

7 100 17 30600 76.0 2709.6 4.0 0.615 110.4

9 100 30 24500 44.6 1708.1 3.8 0.976 61.1

Geometrical mean

25 milligram 7,503 54.0 482.7 4.0 0.863 73.1

50 milligram 29 15,216 73.8 1208.8 4.4 0.689 97.5

100 milligram 13 28,383 66.0 2276.4 4.2 0.732 91.1

Can be observed C_maxThe increase of BIWA4 PC, and the dosage of area under a curve and administration proportional (Fig. 4 and 5).

Also measure the radio-labeled thing (^99mTc) serum-concentration, and pharmacokinetic parameter is shown in table 5.4.2.2.:2.

Serum in the table 5.4.2.2:2 research A part^99mThe pharmacokinetic parameter of Tc-BIWA4

Patient^99mTc-Tmax Cmax half-life AUC_inf Vz CL MRT

BIWA4 (dividing) (%ID/ (hour) (%ID little (kilogram) (kilogram/minute) (hour)

The dosage kilogram) time/kilogram)

(millicurie)

1 19.0 millicuries 117 52.66 44.6 3376.9 1.9 0.030 63.8

2 20.0 millicuries 10 28.08 55.6 2151.7 3.7 0.048 79.1

3 21.4 millicuries 10 39.11 27.5 1445.3 2.7 0.072 41.5

4 19.5 millicuries 29 31.84 31.3 1432.8 3.2 0.072 43.8

5 19.1 millicuries 121 32.29 39.6 1934.8 3.0 0.054 56.3

8 18.8 millicuries 114 28.41 42.8 1620.1 3.8 0.060 60.8

10 19.3 millicuries 41 40.31 43.1 2247.1 2.8 0.042 62.3

6 19.3 millicuries 120 30.45 45.3 1946.5 3.4 0.054 65.2

7 19.8 millicuries 77 35.79 36.0 1628.6 3.2 0.060 51.1

9 18.3 millicuries 238 31.94 35.5 1805.6 2.8 0.054 50.6

Harmonic-mean 38.7

Geometrical mean 57.9 34.5 39.4 1898.0 3.0 0.053 56.5

In three treatment groups of A part Study, behind intravenous infusion, survey the geometric average half-life of BIWA4 in the blood plasma with ELIS, scope was by 54 to 73.8 hours. Same sample,^99mThe radiolabeled BIWA4 geometric average half-life of Tc-, be short 39.4 hours in serum, and be 46.4 hours in blood. Difference between two mean estimates was attributable to because of the possible longer sample time of BIWA4 due to the radioactivate analysis restriction.

Radioactivity is drained to urine, and its collected amount is shown in table 5.4.2.2:3. Because incomplete collection during 48 hours (namely because of the different collection periods, the data of accumulating can't be comparable all the time) is so there is no further assessment to these urine excretion data. For six patients that had collect in 48 hours completely, collected radioactivity average magnitude is 10% of initial dosage.

5.4.2.2:3 drain in the A part to urine (with the percentage of initial dosage

Radioactivity amount expression) (^99mTc)

Collection interval (hour)

Patient 0-4 4-8 8-12 12-24 24-48 cumulant

(％ID)

1 2.80 10.13 5.08 n.a. n.a. 18.01

2 1.94 0.97 0.52 3.09 3.23 9.75

3 0.29 1.44 1.19 n.a. n.a. 2.92

4 1.68 1.42 1.95 1.14 2.21 8.40

5 2.20 1.60 1.02 3.96 3.98 12.76

8 1.29 2.45 0.88 3.67 3.00 11.29

10 n.a. n.a. n.a. n.a. n.a.

6 2.55 1.59 1.80 1.89 2.00 9.83

7 n.a. 3.14 n.a. 1.79 3.13 8.06

9 1.54 3.34 0.00 1.05 2.31 8.24

N.a.=is without applicable, and countless certificates can adopt

The B part

B partly includes 20 patients, accepts 50 milligrams of BIWA4, has different¹⁸⁶Re-BIWA 4 radio-labeled dosage are by 20-60 millicurie/rice² Three patients accept the secondary intravenous infusion, and in addition 17 patients only accept single therapy course for the treatment of.

Use caption, every patient reaches and accepts at secondary¹⁸⁶Among three patients of Re-BIWA4, be consistent between blood plasma BIWA4 concentration and serum radioactivity concentration. The uniformity that this is observed by diagram, when data are mapped (non-space distinguish ground assessment) and radioactivity than the long half-lift understanding opposite.¹⁸⁶122 hours the geometric average half-life of Re-BIWA4 radioactivity part, BIWA plasma half-life-94 of being measured by ELISA are hour also long.

By the radioactivity total of institute's administration and the classification (table 5.4.2.2:6 and 5.4.2.2:7) that pharmacokinetic parameter is carried out are shown, some tendency that when the administration radioactivity increases, has exposure time to prolong, but because experimenter's number of each dosage group is too little so that any consistent conclusion can't be arranged.

Table 5.4.2.2:6 adds up to the radioactivity of giving and classifies, and asks blood plasma

The geometrical mean of BIWA4 pharmacokinetic parameter

¹⁸⁶Re dosage n Cmax half-life AUC_inf Vz CL MRT

(millicurie/rice²) (ng (hour) (microgram hour (liter) (milliliter (hour)

/ ml)/milliliter)/hour)

20 2 12160 106.5 1217 6.3 41.1 130.3

30 4 15239 86.2 1399 4.4 35.7 116.2

40 3 11121 90.6 1201 5.4 41.7 125.1

50 9 ^* 12982 92.4 1055 6.3 47.4 117.4

60 5 11927 99.8 939 7.7 53.2 115.9

^*Comprise and accept two dose of 50 millicurie/rice²Patient

Table 5.4.2.2:7 adds up to the radioactivity of giving and classifies, and asks serum

¹⁸⁶The geometrical mean of Re-BIWA4 pharmacokinetic parameter

¹⁸⁶Re dosage n Cmax half-life AUC_inf Vz CL MRT

(millicurie/rice²) (%ID/ (hour) (%ID little (kilogram) (kilogram/(hour)

Kilogram) time/kilogram) hour)

20 2 30.88 114.4 3296 5.01 0.030 154.6

30 4 40.09 98.8 4365 3.27 0.023 134.5

40 3 28.82 126.4 3856 4.73 0.026 172.4

50 9 ^* 40.22 123.3 4182 4.25 0.024 162.5

60 4 32.10 145.2 3493 6.00 0.029 185.5

^*Comprise and accept two dose of 50 millicurie/rice²Patient

5.4.2.2 pharmacokinetics/pharmacodynamic analysis

Do not carry out pharmacokinetics/pharmacodynamic analysis.

5.4.3 statistics/analyze

Such as original analyzing of planning. Details are set forth in 3.7.1.3.

5.4.3.1 first terminal point (primary endpoint) is without applicable.

5.4.3.2 secondary terminal point (secondary endpoint) is without applicable.

5.4.4 the interaction between drug-drug and the medicine-disease is not carried out about drug-drug or the interactive test of medicine-disease.

5.4.5 presenting of subtopic

See 6.4.2.2 and 6.4.2.3 paragraph for details.

5.5 effectiveness/clinical pharmacology conclusion

A: part

By the result of A part, enter level as the basis take haemoconcentration and tissue forceps, the dosage of 50 milligrams of BIWA4 of susceptible of proof is treatment optimum dosage. Detect the distribution of assessing by radiation scintigraphy and living tissue, as can be known in nearly all example, and its hetero-organization relatively to descend in the tumour be best result cloth. The absorption of radioactivity increases in time in tumour. CD44v6 is respectively at 80% and 90% the cellular expression of surpassing of primary tumor and lymphatic metastasis tumour, and expresses in the mucous membrane of all acquisitions product to be checked.

{。##.##1},^99mAfter reaching before the Tc-BIWA4 administration, the amount of solubility CD44v6 is seemingly constant.

Measured BIWA4 concentration is proportional with dosage in 25 milligrams to 100 milligrams BIWA4 scopes. The moderate of institute's dosage is via RE. For all administration groups, the %ID that drains in urine is similar.

The B part:

The data that partly got by B show, when MTD patient can by¹⁸⁶Be benefited in the treatment of Re-BIWA4. Five with 60 millicurie/rice²There is one stable disease is arranged among the patient for the treatment of. Among six patients three at 50 millicurie/rice²Maximum tolerated dose the time stable disease. And accept second dose of 50 millicurie/rice²These patients in until just get along with between 127 to 173 days (progression). The radio-immunity scitiphotograph can demonstrate the absorption of radioactivity in the tumor tissues. In the situation of not considering dosage, bio distribution is suitable in its hetero-organization. In the tissue beyond the tumour, Dosimetric analysis does not demonstrate unexpected high absorbed dose of radiation, but except the testis. Yet viewed testis dosage is unknown for the correlation of destroying fertility at present.

For with¹⁸⁶The patient of Re-BIWA4 treatment, the tendency that the solubility CD44v6 content that reaches has increase of surveying.

The PC of BIWA4 was the peak in the time of 0.92 hour, and was measured by ELIS and to learn, for BIWA 4, antibody was with 94 hours geometric average half-life cancellation. For 50 milligrams of BIWA4 dosage groups, Cmax and AUC numerical value (ELISA mensuration) and gained similar in test A part.

6 safety evaluations

Dose limiting toxicity occurs in 60 millicurie/rice²Dosage the time, and 50 millicurie/rice² ¹⁸⁶The dosage of Re-BIWA4 changes the tolerance dose of the maximum in the cost test. Dose limiting toxicity is the ill-effect from marrow, i.e. thrombopenia and leukopenia.

6.1 expose degree to the open air

Ten patients that A partly treats, all administration is single dose^99mTc-BIWA4. The dosage of BIWA4 is 25 milligrams, 50 milligrams or 100 milligrams, and^99mTc is 20 millicuries.

In the B part, patient's single dose of totally 20 administrations¹⁸⁶Re-BIWA4. Three 50 millicurie/rice of accepting second dose², because of the event of stable disease (unchanged). The dosage of BIWA4 keeps being stabilized in 50 milligrams, and¹⁸⁶The radioactivity of Re is with 10 millicurie/rice²The ratio of body surface area increases. Estimate dosage (table 6.1:1) according to body surface area

The radioactivity mean dose of table 6.1:1 institute administration

The A part^99mTc-BIWA4				The B part¹⁸⁶Re-BIWA4[millicurie/rice²]
The A part^99mTc-BIWA4				The B part¹⁸⁶Re-BIWA4[millicurie/rice²]					25 milligrams of BIWA	50 milligrams of BIWA4	100 milligrams of BIWA4	20	30	40	50	60
N mCi ^99mTc mCi ¹⁸⁶Re	3 20.1±1.2 n.a.	4 19.2±0.3 n.a.	3 19.1±0.8 n.a.	2 n.a. 33.1±1.7	4 n.a. 52.4±5.6	3 n.a. 70.6±5.2	6 n.a. 87.2±8.5	5 n.a. 97.2±8.3	25 milligrams of BIWA	50 milligrams of BIWA4	100 milligrams of BIWA4	20	30	40	50	60

N.a.=is without applicable. Show mean value and standard deviation in the table

The radiochemical purity of medicine surpasses 95%, and immunoreactivity partly is higher than 80%.

Observation period is at least 6 weeks behind the medicine-feeding test medicine.

6.2 ill-effect (AEs)

In the patient that all are received treatment, all to report ill-effect. Two patients end the observation period because of AE in the B part. Do not take action because of trial drug, because treatment is finished.

6.2.1 the concise and to the point main points of ill-effect

The A part:

Most patient experience in the A part arrives ill-effect, is an integral body (50%) by health, and it also may be because the pain of performing the operation and be correlated with in the basis is. There is no special ill-effect pattern and reported, and develop into CTC criterion 3 or 4 grades without one among the patient, this is judged as being (table 6.2.2:1 and 2) relevant with medicine.

Three patients experience serious side effect, and it is described at the 6.3.1. chapters and sections.

The B part:

The ill-effect of whole body organ type (SOC), health is an integral body, in patient, have 65% report is arranged, continue for from the ill-effect of whole body organ type, blood platelet is bled and the blood coagulation imbalance (accounting for 60% among the patient), and leucocyte and reticuloendothelial system deficiency disorder, (accounting for 50% among the patient). Medicine-relevant thrombopenia and leukopenia occurs in 11 (55%) and 10 (50%) patients, occurs average 21 days the time behind the beginning RIT, and is reversible after 6 weeks usually.

In these events, all can be observed dose-response (table 6.2.2:3).

The toxicity of hematology dosage-restriction is defined as the 4th grade of the CTC relevant with medicine, in three patients, report is arranged.

The toxicity of non-hematology dosage-restriction is defined as the CTC relevant with medicine the 3rd or 4 grades of non-haematics toxicities, occurs in 4 patients (at 30 millicurie/rice²Patient Shi Youyi experiences fash and Quincke ' s oedema, and two patients are at 60 millicurie/rice²The Shi Jingli heating, and a patient is with 60 millicurie/rice²Feel tired during treatment.

Among the patient of the serious ill-effect of nine experience six death are arranged. Dead and serious ill-effect is set forth in the 12.3.1 chapters and sections.

6.2.2 presenting of ill-effect

The A part:

Following ill-effect is by SOC, and preferred term is classified, and the report (table 6.2.2:1) of three kinds of BIWA4 dosage groups is arranged above a patient in the A part. Details and preferred term are found among the 7.3.1.

Table 6.2.2:1 has the patient of ill-effect (with single dose 20 in the A part

Millicurie^99mTc-BIWA4 is in pre-operative treatment)

^99mTc-BIWA4

25 milligrams of 50 milligrams of 100 milligrams of summations

BIWA4 BIWA4 BIWA4

Patient's number (being treated patient %) 3 (100) 4 (100) 3 (100) 10 (100)

Patient's number 3 (100) 4 (100) 3 (100) 10 (100) that any ill-effect is arranged

The deficiency disorder 2 (66.7) 0 (0) 0 (0) 2 (20.0) of application site

Whole body is an integral body 2 (66.7) 2 (50.0) 1 (33.3) 5 (50.0)

Pain 1 (33.3) 1 (25.0) 1 (33.3) 3 (30.0)

Maincenter and peripheral nervous disorder disease 1 (33.3) 1 (25.0) 0 (0) 2 (20.0)

Metabolism and trophic disturbance disease 1 (33.3) 2 (50.0) 1 (33.3) 4 (40.0)

Lose weight 1 (33.3) 1 (25.0) 0 (0) 2 (20.0)

Low anti-(resistance) machine-processed deficiency disorder 0 (0) 4 (100) 0 (0) 4 (40.0)

Infect 0 (0) 3 (75.0) 0 (0) 3 (30.0)

Blood vessel deficiency disorder 1 (33.3) 1 (25.0) 1 (33.3) 3 (30.0)

Not hemorrhage (the spy does not show) 1 (33.3) 1 (25.0) 0 (0) 2 (20.0)

If it, then represents with SOCs and preferred term with upper report a patient; Receive treatment patient's percentage of numeral in the bracket.

Be considered as the effect relevant with medicine by the researcher according to the classification of CTC criterion, list among the table 6.2.2:2. According to CTC, these effects are decided to be 1 grade.

Table 6.2.2:2 in A part, report according to the CTC criterion, with medicine-relevant

The order of severity of the ill-effect of (being judged by the researcher) (before operation with

Single dose 20 millicuries^99mThe Tc-BIWA4 treatment)

^99mTc-BIWA4

25 milligrams of 50 milligrams of 100 milligrams of summations

BIWA4 BIWA4 BIWA4

Patient's number 343 10

Be regarded as relevant with medicine 0202

The ill-effect number of times

The deficiency disorder 0202 of liver and gall

SGOT increases by 0101

SGPT increases by 0101

The sGOT=serum glutamic oxalacetic transaminase; The sGPT=serum glutamic pyruvic transminase

The B part:

Table 6.2.2:3 illustrates by SOC, the ill-effect patient number that preferred term is classified, and¹⁸⁶The radiological dose group of Re-BIWA4.

Table 6.2.2:3 occur in the ill-effect of B part patient (first with

¹⁸⁶Re-BIWA4 processes, and considers second dose again)

¹⁸⁶Re-BIWA4[millicurie/rice²]

20 30 40 50 60 summations

Patient's number 2 (100) 4 (100) 3 (100) 6 (100) 5 (100) 20 (100) of receiving treatment

Patient's number 2 (100) 4 (100) 3 (100) 6 (100) 5 (100) 20 (100) that ill-effect is arranged

Whole body is an integral body 2 (100) 3 (75.0) 2 (66.7) 2 (33.3) 4 (80.0) 13 (65.0)

Allergic reaction 0 (0) 1 (25.0) 0 (0) 0 (0) 1 (20.0) 2 (10.0)

Tired 0 (0) 0 (0) 0 (0) 1 (16.7) 1 (20.0) 2 (10.0)

Fever 0 (0) 0 (0) 2 (66.7) 0 (0) 2 (40.0) 4 (20.0)

Mouth oedema 1 (50.0) 0 (0) 0 (0) 1 (16.7) 0 (0) 2 (10.0)

Pain 0 (0) 2 (50.0) 0 (0) 1 (16.7) 1 (20.0) 4 (20.0)

Maincenter and peripheral neurology deficiency disorder 0 (0) 1 (25.0) 2 (66.7) 1 (16.7) 0 (0) 4 (20.0)

Gastrointestinal system deficiency disorder 0 (0) 1 (25.0) 1 (33.3) 2 (33.3) 3 (60.0) 7 (35.0)

Catarrh 0 (0) 0 (0) 0 (0) 1 (16.7) 3 (60.0) 4 (20.0)

Gastritis 0 (0) 0 (0) 0 (0) 1 (16.7) 1 (20.0) 2 (10.0)

Liver and gall deficiency disorder 1 (50.0) 0 (0) 0 (0) 0 (0) 1 (20.0) 2 (10.0)

SGPT increases by 1 (50.0) 0 (0) 0 (0) 0 (0) 1 (20.0) 2 (10.0)

Metabolism and trophic disturbance disease 1 (50.0) 0 (0) 1 (33.3) 1 (16.7) 1 (20.0) 4 (20.0)

Tumour 0 (0) 0 (0) 2 (66.7) 0 (0) 2 (40.0) 4 (20.0)

Malignant tumour increases the weight of 0 (0) 0 (0) 1 (33.3) 0 (0) 2 (40.0) 3 (15.0)

Blood platelet, hemorrhage and blood coagulation deficiency disorder 0 (0) 1 (25.0) 1 (33.3) 5 (83.3) 5 (100) 12 (60.0)

Thrombopenia 0 (0) 1 (25.0) 1 (33.3) 4 (66.7) 5 (100) 11 (55.0)

Red blood cell deficiency disorder 0 (0) 0 (0) 0 (0) 2 (33.3) 3 (60.0) 5 (25.0)

Anaemia 0 (0) 0 (0) 0 (0) 2 (33.3) 3 (60.0) 5 (25.0)

Respiratory system deficiency disorder 0 (0) 1 (25.0) 1 (33.3) 0 (0) 2 (40.0) 4 (20.0)

Bronchitis 0 (0) 1 (25.0) 0 (0) 0 (0) 1 (20.0) 2 (10.0)

Expiratory dyspnea 0 (0) 0 (0) 0 (0) 0 (0) 2 (40.0) 2 (10.0)

Rhinitis 0 (0) 0 (0) 1 (33.3) 0 (0) 1 (20.0) 2 (10.0)

Skin and appendicle deficiency disorder 1 (50.0) 1 (25.0) 1 (33.3) 0 (0) 1 (20.0) 4 (20.0)

Fash 0 (0) 1 (25.0) 0 (0) 0 (0) 1 (20.0) 2 (10.0)

Leucocyte and RES deficiency disorder 0 (0) 0 (0) 1 (33.3) 4 (66.7) 5 (100) 10 (50.0)

Agranulocytosis 0 (0) 0 (0) 0 (0) 1 (16.7) 2 (40.0) 3 (15.0)

Leukopenia 0 (0) 0 (0) 1 (33.3) 4 (66.7) 5 (100) 10 (50.0)

If it is reported with upper a patient, illustrate with SOCs and preferred term; The sGPT=serum glutamic pyruvic transminase; Receive treatment patient's percentage of RES=reticuloendothelial system, the numeral in bracket.

Medicine-relevant ill-effect defendant is arranged in 75% patient. Leukopenia and thrombopenia that medicine is relevant have respectively 50% and 55%. in patient

Be considered as the ill-effect relevant with medicine and be shown among the table 6.2.2:4 classification according to CTC.

Table 6.2.2:4 B part report according to the CTC criterion with medicine-relevant

The ill-effect (considering first and second agent) of (being judged by the researcher)

Ill-effect¹⁸⁶Re-BIWA4[millicurie/rice²]

20 30 40 50 60 summations

The 1st grade 10265 14 of CTC

Face's oedema 1 n.a 0001

Leukopenia 0 n.a. 1203

Oidiomycosis 0 n.a 0011

Catarrh 0 n.a. 0011

Blood platelet disorders 0 n.a 0101

Purpura 0 n.a. 0011

Gastritis 0 n.a. 0101

Thrombopenia 0 n.a. 1225

The 2nd grade 01077 15 of CTC

Anaemia n.a. 0 n.a. 112

Gout n.a. 0 n.a. 101

Leukopenia n.a. 0 n.a. 123

Catarrh n.a. 0 n.a. 235

Gastritis n.a. 0 n.a. 011

Ageusia n.a. 0 n.a. 101

Thrombopenia n.a. 1 n.a. 102

CTC 3rd level 02028 12

Allergic reaction n.a. 1 n.a. 001

Tired n.a. 0 n.a. 011

Fever n.a. 0 n.a. 022

Leukopenia n a. 0 n.a. 112

Fash n.a. 1 n.a. 001

Thrombopenia n.a. 0 n.a. 145

The 4th grade 000358 of CTC

Poor n.a. n.a. n.a. 011

Agranulocytosis n.a. n.a. n.a. 123

Leukopenia n.a. n.a. n.a. 123

Thrombopenia n.a. n.a. n.a. 101

What illustrate is the number of times of ill-effect; N.a.=is without applicable.

6.2.3 the analysis of ill-effect

The A part:

The ill-effect that occurs in test A part is considered to be relevant with medicine without one, experience slight and reversible CTC1 level AST and the rising of ALT except a patient is arranged.

When from different BIWA4 dose comparison, on aspect the AE, do not observed what difference.

The B part:

Thrombopenia and leukopenia relevant with dosage (table 6.2.2:3 and 6.2.2:4) and be dosage-restriction. Time-histories is shown among the 6.4.2.1.

Claim catarrh up to the CTC2 level along with the increase of radiological dose often has report, but do not cause dosage-limiting toxicity (table 6.2.2:3 and 6.2.2:4).

In two patients, anaphylactoid report is arranged, Quincke ' s oedema and fash (30 millicurie/rice that people experience is relevant with medicine²), and a people (60 millicurie/rice are arranged²) after the PC blood transfusion, allergic reaction being arranged, it does not also think relevant with medicine. One patient (20 millicurie/rice are arranged²) rubella arranged, it also is considered to non-medicine-relevant, and a patient (20 millicurie/rice²) face's oedema of experience and medicine-relevant.

Can in two patients, survey and HAHAs (seeing 12.4.3).

Two patients are interrupted because ill-effect causes research. Two patients are all dead.

The treatment that in 17 patients, need begin to follow because of ill-effect. These patients soon are described among the 6.3.1.

6.3 dead, the ill-effect that other are serious, and other great ill-effects

Can in 12 patients, see the report of serious ill-effect. Wherein six people are dead in test or tracing process. All dead patients are the once treatment of reception test B part all. Dead patient no one that A partly treats. All are dead all because of the progress of disease.

Having two patients to end ahead of time test in the B part is because of the event of ill-effect (patient 112 and 105 is all dead).

The ill-effect that need to treat is modal to be thrombopenia, leukopenia and heating.

This paper with reference to but table not to be covered, the numeral and figure

7.1 demography data

Do not comprise that demography describes in detail.

7.2 effectiveness/pharmacokinetic data

Table 7.2:1 tumour is to the A part of the absorption ratio of marrow-test

Table 7.2:2 tumour is to the A part of the absorption ratio (ITT subgroup) of marrow-test

Table 7.2:3 tumour is to the A part of the absorption ratio (PP subgroup) of marrow-test

The A part (complete tactful colony) of the absorption %-test of table 7.2:4 tumor size and antibody

The A part of the expression of table 7.2:5 CD44v6 antigen in tumour and hetero-organization thereof-test

Solubility CD44v6 in the table 7.2:6 serum. Mean value represents with ng/ml.

Table 7.2:1 tumour is to the A part of the absorption ratio of marrow-test

The A part

^99mTc-BIWA4

Patient's tumour is taken in marrow and is taken in tumour/marrow ratio

Number (%ID/ kilogram; Estimated value) (%ID/ kilogram; Estimated value) value (estimated value)

25 milligrams of BIWA4 1^* 6.14 5.58 1.10

2 ^* 15.78 7.49 2.11

3 ^* 16.78 8.63 1.95

50 milligrams of BIWA4 4^* 28.10 6.98 4.03

8 ^* 27.76 7.57 3.67

10 ^* 22.63 11.54 1.96

100 milligrams of BIWA4 6^* 15.89 6.47 2.46

7 16.99 7.70 2.21

9 13.31 10.11 1.32

The No=number,^*=be included in the complete analysis of strategies; %ID=implantation dosage %; The computing of estimated value is that the weight that sample is different is taken into account.

Table 7.2:2 tumour is taken in the A part of ratio (ITT subgroup)-test to marrow

The A part

^99mTc-BIWA4

Tumour/marrow ratio

(estimated value)

25 milligrams of BIWA4 1.72

50 milligrams of BIWA4 2.57

100 milligrams of BIWA4 1.99

Data represent with mean value in the table; ITT=is intended to treatment; The computing of estimated value is that the sample Different Weight is taken into account.

Table 7.2:3 tumour is taken in ratio (PP subgroup)-test A part to marrow

The A part

^99mTc-BIWA4

Tumour/marrow ratio

(estimated value)

25 milligrams of BIWA4 1.72

50 milligrams of BIWA4 3.22

100 milligrams of BIWA4 2.46

Data represent with mean value in the table; PP=is strategy fully; The computing of estimated value is that the sample Different Weight is taken into account.

The A part

^99mTc-BIWA4

Patient's number tumor size [millimeter²] the tumour absorption

(%ID/ kilogram; Estimated value)

25 milligrams of BIWA4 1 1,350 6.14

2 900 15.78

3 225 16.78

50 milligrams of BIWA4 4 n.a. 28.10

8 1504 27.76

10 1400 22.63

100 milligrams of BIWA4 6 800 15.89

Patient's No=number, n.a.=be without applicable, only provides longly or wide, is not long and widely all to provide, and the computing of estimated value is that different example weights are taken into account.

The A part

^99mTc-BIWA4

Patient's number CD44v6 Antigens CD44 v6 expresses CD44v6 and expresses

Expression in tumour in the mucous membrane lymphatic metastasis

25 milligrams of BIWA4 1^* n.a. n.a. n.a.

2 ^* ++/+++；＞80％ +++ ++/+++；＞90％

3 ^* +++；＞90％ +++ +++；＞90％

50 milligrams of BIWA4 4^* +++；＞90％ +++ +++；＞90％

8 ^* n.a. n.a. n.a.

10 ^* ++；＞90％ +++ +++；＞90％

100 milligrams of BIWA4 6^* +++；＞80％ +++ n.a.

7 +++；＞90％ +++ n.a.

9 +++；＞90％ +++ n.a.

The No=number,^*=be included in the complete analysis of strategies; N.a.=is without applicable

The solubility CD44v6 of table 7.2:6 in serum. Represent (ng/ml) with mean value

A part B part

^99mTc-BIWA4 ¹⁸⁶Re-BIWA4[millicurie/rice²]

25 milligrams 50 milligrams 100 milligrams

20 30 40 50 60

BIWA4 BIWA4 BIWA4

N 3 4 3 2 4 3 6 5

In advance administration 203 337 174 408 262 346 171 160

21 hours 223 301 179 396 177 403 199 170

48 hours 200 275 157 384 198 423 199 174

72 hours 140 386 n.a. n.a. n.a. n.a. n.a. n.a.

144 hours 188 282 182 444 284 516 233 195

240/336 hour n.a. n.a. n.a. 445 337 n.a. n.a. n.a.

The 6th week 203 310 210 289 220 487 226 162

N.a.=is without applicable, and data comprise for the second time administration

Main points-conclusion: efficacy results:The A part:Result by the A part confirms, enters level according to haemoconcentration and tissue forceps, and 50 milligrams of BIWA4 of susceptible of proof are the optimum dosage for the treatment of. With radiation scintigraphy and living tissue detection distribution is assessed, found almost in all cases, compare with other tissue, the distribution in the tumour is the highest. Radioactivity is taken in tumour increases in time. In primary tumo(u)r and lymphatic metastasis tumour, the cellular expression CD44v6 that surpasses 80 % and 90% is arranged respectively, and also in the mucous membrane of all acquisitions product to be checked, express. In 50 milligrams of BIWA4 dosage groups, do not observe correlation between the absorption of tumor size and radioactivity. In administration^99mAfter reaching before the Tc-BIWA4, the amount of solubility CD44v6 is seemingly constant. Measured BIWA4 concentration is proportional with dosage in 25 milligrams to 100 milligrams BIWA4 scopes. The vacuum metrics of institute's dosage is via RE. The implantation dosage percentage (%ID) of discharging in urine is similar in all dosage groups.The B part:Data by B part show, patient under maximum tolerated dose (MTD) but clinical benefit from¹⁸⁶The Re-BIWA4 treatment. With 60 millicurie/rice²Among 5 patients for the treatment of 1 stable disease is arranged. There are three in six at 50 millicurie/rice²Maximum tolerated dose under stable disease. Accepting second dose of 50 millicurie/rice²These patients in, until just get along with between 127 and 173 days. The radio-immunity scintigraphy shows has radioactivity to take in the tumor tissues. Do not consider dosage, the bio distribution in its hetero-organization is suitable. Dosimetric analysis is not presented in the tissue beyond the tumour unexpected high absorbed dose of radiation, except the testis. Survey and solubility CD44v6 content pair¹⁸⁶Re-BIWA4 treatment patient tendency increases. The peak of the PC of BIWA4 is at 0.92 hour, and for BIWA4, measures antibody as can be known with 94 hours geometric average half-life cancellation by ELISA. For 50 milligrams of BIWA4 dosage groups, C_maxAnd similar with at A part gained of AUC numerical value (ELISA).

Safety results:The A part:The tolerance of single dose of BIWA4 coupling being hanged down the technetium-99 of radiological dose is can

Accept. Two complication that are attributable to perform the operation and cause in three serious ill-effects.The B part:Maximum tolerated dose (MTD) is 50 millicurie/rice² ¹⁸⁶Re-BIWA4. The ill-effect of dosage-restriction is relevant with dosage, and blood platelet and leucocyte reversibly reduced before this, next is the fever of individual patients. The clinical symptoms of thrombopenia are slight ecchymosis. In the patient who processes with higher radiological dose, can be observed catarrh, but dose-restriction. In process of the test, do not observe at thyroid-stimulating hormone (TSH) (TSH) numerical value what relevant variation is arranged. There are 12 patients to experience serious ill-effect. Wherein, six patients are dead in the process of test B part, mainly are because the progress of underlying diseases. Allergic reaction is rare, and it is that the Quincke ' s of serious medicine-relevant is swollen that a people is arranged. During infused drug or afterwards the short time, there is no allergic reaction and occur. There are two patients that HAHAs occurs. The administration that repeats can't be lured the generation of HAHA into. Conclusion: the result shows in the tumor tissues to be had¹⁸⁶The absorption of Re-BIWA4, and for having head and neck squamous cell carcinoma in late period patient that clinical benefit is arranged. The security overview is seemingly acceptable. BIWA4 demonstrates and the proportional pharmacokinetics of dosage, and between 50 milligrams and 100 milligrams of BIWA4 dosage, the absorption of tumour does not have the change of relevance.

Embodiment 4

Foreword. Head and the patient of neck squamous cell cancer (HNSCC) in late period is arranged, and developing into the danger that regional area recurrent tumor and/or far-end shift increases. For these patients, the development of effective complementary whole body therapeutic method is necessary. Known HNSCC is radiosensible really, utilizes monoclonal antibody with the active nucleus RIT pattern of target HNSCC optionally, will be more effective cure.

Purpose. For determine with rhenium-186 (¹⁸⁶Re)-the Humanized monoclonal antibodies BIWA4 of mark is in the security of patient's HNSCC radioimmunotherapy, maximum tolerated dose (MTD), immunogenicity and effectiveness.

Patient and method. In patient HNSCC, carry out I phase dosage staged and enlarge research, and these patients there is no the treatment of healing and select and can adopt. In totally 20 patients, warp¹⁸⁶The BIWA 4 of Re-mark is with 20,30,40,50 or 60 millicurie/rice²Dosage in intravenous administration. Three patients are arranged, at 50 or 60 millicurie/rice²Behind the dosage at least 3 months, accept second dose of 50 millicurie/rice²。

The result. All single dose and repeat administration all can be well tolerable, and do not observe the sign of acute ill-effect. Obvious toxicity is only arranged under higher dosage, and the bone marrow toxicity that shows as portacaval mucositis and dosage-restriction comprises thrombopenia and leukopenia. MTD determines at 50 millicurie/rice² People-Anti-Human occurs and replys in one patient after single dose of administration. In 5 patients with the maximum dose level horizontal stretcher, can be observed stable disease, continued for 4 to 19 weeks.

Conclusion. Warp among patient HNSCC¹⁸⁶The radioimmunotherapy of the BIWA4 of Re-mark is safety seemingly, and can reach the dosage of killing tumour. Moreover, because low immunogenicity, so repeat administration is seemingly possible. The result that this I phase is studied, encouraged with rhenium-186 (¹⁸⁶Re)-the Humanized monoclonal antibodies BIWA4 RIT of mark further develops towards enemy and neck cancer patient's auxiliary therapy.

Sequence table

＜110〉Boehringer Ingelheim Int (Boehringer Ingelheim International GmbH)

＜120〉the specific antibody of CD44v6

<130>1-1212 PCT

＜140〉undetermined

<141>2002-05-16

<150>EP 01112237.1

<151>2001-05-18

<150>US 60/325147

<151>2001-09-26

<160>18

<170>PatentIn Ver.2.1

<210>1

<211>114

<212>PRT

＜213〉artificial sequence

<220>

＜223〉description of artificial sequence: humanized antibody sequence

<400>1

Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Lys Pro Gly Gly

1 5 10 15

Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr

20 25 30

Asp Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val

35 40 45

Ser Thr Ile Ser Ser Gly Gly Ser Tyr Thr Tyr Tyr Leu Asp Ser Ile

50 55 60

Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Ser Leu Tyr

65 70 75 80

Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys

85 90 95

Ala Arg Gln Gly Leu Asp Tyr Trp Gly Arg Gly Thr Leu Val Thr Val

100 105 110

Ser Ser

<210>2

<211>106

<212>PRT

＜213〉artificial sequence

<220>

＜223〉description of artificial sequence: humanized antibody sequence

<400>2

Glu Ile Val Leu Thr Gln Ser Pro Ala Thr Leu Ser Leu Ser Pro Gly

1 5 10 15

Glu Arg Ala Thr Leu Ser Cys Ser Ala Ser Ser Ser Ile Asn Tyr Ile

20 25 30

Tyr Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro Arg Leu Leu Ile Tyr

35 40 45

Leu Thr Ser Asn Leu Ala Ser Gly Val Pro Ala Arg Phe Ser Gly Ser

50 55 60

Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Glu Pro Glu

65 70 75 80

Asp Phe Ala Val Tyr Tyr Cys Leu Gln Trp Ser Ser Asn Pro Leu Thr

85 90 95

Phe Gly Gly Gly Thr Lys Val Glu Ile Lys

100 105

<210>3

<211>106

<212>PRT

＜213〉artificial sequence

<220>

＜223〉description of artificial sequence: humanized antibody sequence

<400>3

Glu Ile Val Leu Thr Gln Ser Pro Ala Thr Leu Ser Leu Ser Pro Gly

1 5 10 15

Glu Arg Ala Thr Leu Ser Cys Ser Ala Ser Ser Ser Ile Asn Tyr Ile

20 25 30

Tyr Trp Leu Gln Gln Lys Pro Gly Gln Ala Pro Arg Ile Leu Ile Tyr

35 40 45

Leu Thr Ser Asn Leu Ala Ser Gly Val Pro Ala Arg Phe Ser Gly Ser

50 55 60

Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Glu Pro Glu

65 70 75 80

Asp Phe Ala Val Tyr Tyr Cys Leu Gln Trp Ser Ser Asn Pro Leu Thr

85 90 95

Phe Gly Gly Gly Thr Lys Val Glu Ile Lys

100 105

<210>4

<211>342

<212>DNA

＜213〉artificial sequence

<220>

＜223〉description of artificial sequence: humanized antibody sequence

<400>4

gaagtgcagc tggtggagtc tgggggaggc ttagtgaagc ctggagggtc cctaagactc 60

tcctgtgcag cctctggatt cactttcagt agctatgaca tgtcttgggt tcgccaggct 120

ccggggaagg ggctggagtg ggtctcaacc attagtagtg gtggtagtta cacctactat 180

ctagacagta taaagggccg attcaccatc tccagagaca atgccaagaa ctccctgtac 240

ctgcaaatga acagtctgag ggctgaggac acggccgtgt attactgtgc aagacagggg 300

ttggactact ggggtcgagg aaccttagtc accgtctcct ca 342

<210>5

<211>318

<212>DNA

＜213〉artificial sequence

<220>

＜223〉description of artificial sequence: humanized antibody sequence

<400>5

gaaattgttc tcacccagtc tccagcaacc ctgtctctgt ctccagggga gagggccacc 60

ctgtcctgca gtgccagctc aagtataaat tacatatact ggtaccagca gaagccagga 120

caggctccta gactcttgat ttatctcaca tccaacctgg cttctggagt ccctgcgcgc 180

ttcagtggca gtgggtctgg aaccgacttc actctcacaa tcagcagcct ggagcctgaa 240

gattttgccg tttattactg cctgcagtgg agtagtaacc cgctcacatt cggtggtggg 300

accaaggtgg agattaaa 318

<210>6

<211>318

<212>DNA

＜213〉artificial sequence

<220>

＜223〉description of artificial sequence: humanized antibody sequence

<400>6

gaaattgttc tcacccagtc tccagcaacc ctgtctctgt ctccagggga gagggccacc 60

ctgtcctgca gtgccagctc aagtataaat tacatatact ggctccagca gaagccagga 120

caggctccta gaatcttgat ttatctcaca tccaacctgg cttctggagt ccctgcgcgc 180

ttcagtggca gtgggtctgg aaccgacttc actctcacaa tcagcagcct ggagcctgaa 240

gattttgccg tttattactg cctgcagtgg agtagtaacc cgctcacatt cggtggtggg 300

accaaggtgg agattaaa 318

<210>7

<211>444

<212>PRT

＜213〉artificial sequence

<220>

＜223〉description of artificial sequence: humanized antibody sequence

<400>7

Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Lys Pro Gly Gly

1 5 10 15

Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr

20 25 30

Asp Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val

35 40 45

Ser Thr Ile Ser Ser Gly Gly Ser Tyr Thr Tyr Tyr Leu Asp Ser Ile

50 55 60

Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Ser Leu Tyr

65 70 75 80

Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys

85 90 95

Ala Arg Gln Gly Leu Asp Tyr Trp Gly Arg Gly Thr Leu Val Thr Val

100 105 110

Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser

115 120 125

Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Ly s

130 135 140

Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu

145 150 155 160

Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu

165 170 175

Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr

180 185 190

Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val

195 200 205

Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro

210 215 220

Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe

225 230 235 240

Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val

245 250 255

Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe

260 265 270

Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro

275 280 285

Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr

290 295 300

Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val

305 310 315 320

Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala

325 330 335

Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg

340 345 350

Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly

355 360 365

Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro

370 375 380

Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser

385 390 395 400

Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln

405 410 415

Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His

420 425 430

Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys

435 440

<210>8

<211>213

<212>PRT

＜213〉artificial sequence

<220>

＜223〉description of artificial sequence: humanized antibody sequence

<400>8

Glu Ile Val Leu Thr Gln Ser Pro Ala Thr Leu Ser Leu Ser Pro Gly

1 5 10 15

Glu Arg Ala Thr Leu Ser Cys Ser Ala Ser Ser Ser Ile Asn Tyr Ile

20 25 30

Tyr Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro Arg Leu Leu Ile Tyr

35 40 45

Leu Thr Ser Asn Leu Ala Ser Gly Val Pro Ala Arg Phe Ser Gly Ser

50 55 60

Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Glu Pro Glu

65 70 75 80

Asp Phe Ala Val Tyr Tyr Cys Leu Gln Trp Ser Ser Asn Pro Leu Thr

85 90 95

Phe Gly Gly Gly Thr Lys Val Glu Ile Lys Arg Thr Val Ala Ala Pro

100 105 110

Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly Thr

115 120 125

Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys

130 135 140

Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Ser Gln Glu

145 150 155 160

Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser

165 170 175

Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr Ala

180 185 190

Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro Val Thr Lys Ser Phe

195 200 205

Asn Arg Gly Glu Cys

210

<210>9

<211>213

<212>PRT

＜213〉artificial sequence

<220>

＜223〉description of artificial sequence: humanized antibody sequence

<400>9

Glu Ile Val Leu Thr Gln Ser Pro Ala Thr Leu Ser Leu Ser Pro Gly

1 5 10 15

Glu Arg Ala Thr Leu Ser Cys Ser Ala Ser Ser Ser Ile Asn Tyr Ile

20 25 30

Tyr Trp Leu Gln Gln Lys Pro Gly Gln Ala Pro Arg Ile Leu Ile Tyr

35 40 45

Leu Thr Ser Asn Leu Ala Ser Gly Val Pro Ala Arg Phe Ser Gly Ser

50 55 60

Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Glu Pro Glu

65 70 75 80

Asp Phe Ala Val Tyr Tyr Cys Leu Gln Trp Ser Ser Asn Pro Leu Thr

85 90 95

Phe Gly Gly Gly Thr Lys Val Glu Ile Lys Arg Thr Val Ala Ala Pro

100 105 110

Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly Thr

115 120 125

Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys

130 135 140

Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Ser Gln Glu

145 150 155 160

Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser

165 170 175

Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr Ala

180 185 190

Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro Val Thr Lys Ser Phe

195 200 205

Asn Arg Gly Glu Cys

210

<210>10

<211>2135

<212>DNA

＜213〉artificial sequence

<220>

＜223〉description of artificial sequence: humanized antibody sequence

<400>10

aagctttgac agacgcacaa ccctggactc ccaagtcttt ctcttcagtg acaaacacag 60

acataggata tcacatttgc ttctgacaca actgtgttca ctagcagcct caaacagaca 120

ccatgaactt tgggctcagc ttgattttcc ttgtcctaat tttaaaaggt gtccagtgtg 180

aagtgcagct ggtggagtct gggggaggct tagtgaagcc tggagggtcc ctaagactct 240

cctgtgcagc ctctggattc actttcagta gctatgacat gtcttgggtt cgccaggctc 300

cggggaaggg gctggagtgg gtctcaacca ttagtagtgg tggtagttac acctactatc 360

tagacagtat aaagggccga ttcaccatct ccagagacaa tgccaagaac tccctgtacc 420

tgcaaatgaa cagtctgagg gctgaggaca cggccgtgta ttactgtgca agacaggggt 480

tggactactg gggtcgagga accttagtca ccgtctcctc agctagcacc aagggcccat 540

cggtcttccc cctggcaccc tcctccaaga gcacctctgg gggcacagcg gccctgggct 600

gcctggtcaa ggactacttc cccgaaccgg tgacggtgtc gtggaactca ggcgccctga 660

ccagcggcgt gcacaccttc ccggctgtcc tacagtcctc aggactctac tccctcagca 720

gcgtggtgac cgtgccctcc agcagcttgg gcacccagac ctacatctgc aacgtgaatc 780

acaagcccag caacaccaag gtggacaaga aagttggtga gaggccagca cagggaggga 840

gggtgtctgc tggaagcagg ctcagcgctc ctgcctggac gcatcccggc tatgcagccc 900

cagtccaggg cagcaaggca ggccccgtct gcctcttcac ccggagcctc tgcccgcccc 960

actcatgctc agggagaggg tcttctggct ttttcccagg ctctgggcag gcacaggcta 1020

ggtgccccta acccaggccc tgcacacaaa ggggcaggtg ctgggctcag acctgccaag 1080

agccatatcc gggaggaccc tgcccctgac ctaagcccac cccaaaggcc aaactctcca 1140

ctccctcagc tcggacacct tctctcctcc cagattccag taactcccaa tcttctctct 1200

gcagagccca aatcttgtga caaaactcac acatgcccac cgtgcccagg taagccagcc 1260

caggcctcgc cctccagctc aaggcgggac aggtgcccta gagtagcctg catccaggga 1320

caggccccag ccgggtgctg acacgtccac ctccatctct tcctcagcac ctgaactcct 1380

ggggggaccg tcagtcttcc tcttcccccc aaaacccaag gacaccctca tgatctcccg 1440

gacccctgag gtcacatgcg tggtggtgga cgtgagccac gaagaccctg aggtcaagtt 1500

caactggtac gtggacggcg tggaggtgca taatgccaag acaaagccgc gggaggagca 1560

gtacaacagc acgtaccggg tggtcagcgt cctcaccgtc ctgcaccagg actggctgaa 1620

tggcaaggag tacaagtgca aggtctccaa caaagccctc ccagccccca tcgagaaaac 1680

catctccaaa gccaaaggtg ggacccgtgg ggtgcgaggg ccacatggac agaggccggc 1740

tcggcccacc ctctgccctg agagtgaccg ctgtaccaac ctctgtccta cagggcagcc 1800

ccgagaacca caggtgtaca ccctgccccc atcccgggat gagctgacca agaaccaggt 1860

cagcctgacc tgcctggtca aaggcttcta tcccagcgac atcgccgtgg agtgggagag 1920

caatgggcag ccggagaaca actacaagac cacgcctccc gtgctggact ccgacggctc 1980

cttcttcctc tacagcaagc tcaccgtgga caagagcagg tggcagcagg ggaacgtctt 2040

ctcatgctcc gtgatgcatg aggctctgca caaccactac acgcagaaga gcctctccct 2100

gtctccgggt aaatgagtgc gacggccgcg aattc 2135

<210>11

<211>785

<212>DNA

＜213〉artificial sequence

<220>

＜223〉description of artificial sequence: humanized antibody sequence

<400>11

aagcttgatc ttcaggatat cacatttgct tctgacacaa ctgtgttcac tagcaacctc 60

aaacagacac catggatttt caggtgcaga ttttcagctt cctgctaatg agtgcctcag 120

tcataatgtc caggggagaa attgttctca cccagtctcc agcaaccctg tctctgtctc 180

caggggagag ggccaccctg tcctgcagtg ccagctcaag tataaattac atatactggt 240

accagcagaa gccaggacag gctcctagac tcttgattta tctcacatcc aacctggctt 300

ctggagtccc tgcgcgcttc agtggcagtg ggtctggaac cgacttcact ctcacaatca 360

gcagcctgga gcctgaagat tttgccgttt attactgcct gcagtggagt agtaacccgc 420

tcacattcgg tggtgggacc aaggtggaga ttaaacggac tgtggctgca ccatctgtct 480

tcatcttccc gccatctgat gagcagttga aatctggaac tgctagcgtt gtgtgcctgc 540

tgaataactt ctatcccaga gaggccaaag tacagtggaa ggtggataac gccctccaat 600

cgggtaactc ccaggagagt gtcacagagc aggacagcaa ggacagcacc tacagcctca 660

gcagcaccct gacgctgagc aaagcagact acgagaaaca caaagtctac gcctgcgaag 720

tcacccatca gggcctgagc tcgcccgtca caaagagctt caacagggga gagtgttagg 780

aattc 785

<210>12

<211>785

<212>DNA

＜213〉artificial sequence

<220>

＜223〉description of artificial sequence: humanized antibody sequence

<400>12

aagcttgatc ttcaggatat cacatttgct tctgacacaa ctgtgttcac tagcaacctc 60

aaacagacac catggatttt caggtgcaga ttttcagctt cctgctaatg agtgcctcag 120

tcataatgtc caggggagaa attgttctca cccagtctcc agcaaccctg tctctgtctc 180

caggggagag ggccaccctg tcctgcagtg ccagctcaag tataaattac atatactggc 240

tccagcagaa gccaggacag gctcctagaa tcttgattta tctcacatcc aacctggctt 300

ctggagtccc tgcgcgcttc agtggcagtg ggtctggaac cgacttcact ctcacaatca 360

gcagcctgga gcctgaagat tttgccgttt attactgcct gcagtggagt agtaacccgc 420

tcacattcgg tggtgggacc aaggtggaga ttaaacggac tgtggctgca ccatctgtct 480

tcatcttccc gccatctgat gagcagttga aatctggaac tgctagcgtt gtgtgcctgc 540

tgaataactt ctatcccaga gaggccaaag tacagtggaa ggtggataac gccctccaat 600

cgggtaactc ccaggagagt gtcacagagc aggacagcaa ggacagcacc tacagcctca 660

gcagcaccct gacgctgagc aaagcagact acgagaaaca caaagtctac gcctgcgaag 720

tcacccatca gggcctgagc tcgcccgtca caaagagctt caacagggga gagtgttagg 780

aattc 785

<210>13

<211>1392

<212>DNA

＜213〉artificial sequence

<220>

＜223〉description of artificial sequence: humanized antibody sequence

<400>13

atggagtttg ggctgagctg gctttttctt gtggctattt taaaaggtgt ccagtgtgaa 60

gtgcagctgg tggagtctgg gggaggctta gtgaagcctg gagggtccct aagactctcc 120

tgtgcagcct ctggattcac tttcagtagc tatgacatgt cttgggttcg ccaggctccg 180

gggaaggggc tggagtgggt ctcaaccatt agtagtggtg gtagttacac ctactatcta 240

gacagtataa agggccgatt caccatctcc agagacaatg ccaagaactc cctgtacctg 300

caaatgaaca gtctgagggc tgaggacacg gccgtgtatt actgtgcaag acaggggttg 360

gactactggg gtcgaggaac cttagtcacc gtctcctcag ctagcaccaa gggcccatcg 420

gtcttccccc tggcaccctc ctccaagagc acctctgggg gcacagcggc cctgggctgc 480

ctggtcaagg actacttccc cgaaccggtg acggtgtcgt ggaactcagg cgccctgacc 540

agcggcgtgc acaccttccc ggctgtccta cagtcctcag gactctactc cctcagcagc 600

gtggtgaccg tgccctccag cagcttgggc acccagacct acatctgcaa cgtgaatcac 660

aagcccagca acaccaaggt ggacaagaaa gttgagccca aatcttgtga caaaactcac 720

acatgcccac cgtgcccagc acctgaactc ctggggggac cgtcagtctt cctcttcccc 780

ccaaaaccca aggacaccct catgatctcc cggacccctg aggtcacatg cgtggtggtg 840

gacgtgagcc acgaagaccc tgaggtcaag ttcaactggt acgtggacgg cgtggaggtg 900

cataatgcca agacaaagcc gcgggaggag cagtacaaca gcacgtaccg tgtggtcagc 960

gtcctcaccg tcctgcacca ggactggctg aatggcaagg agtacaagtg caaggtctcc 1020

aacaaagccc tcccagcccc catcgagaaa accatctcca aagccaaagg gcagccccga 1080

gaaccacagg tgtacaccct gcccccatcc cgggatgagc tgaccaagaa ccaggtcagc 1140

ctgacctgcc tggtcaaagg cttctatccc agcgacatcg ccgtggagtg ggagagcaat 1200

gggcagccgg agaacaacta caagaccacg cctcccgtgc tggactccga cggctccttc 1260

ttcctctaca gcaagctcac cgtggacaag agcaggtggc agcaggggaa cgtcttctca 1320

tgctccgtga tgcatgaggc tctgcacaac cactacacgc agaagagcct ctccctgtct 1380

ccgggtaaat ga 1392

<210>14

<211>702

<212>DNA

＜213〉artificial sequence

<220>

＜223〉description of artificial sequence: humanized antibody sequence

<400>14

atggaagccc cagctcagct tctcttcctc ctgctgctct ggctcccaga taccaccgga 60

gaaattgttc tcacccagtc tccagcaacc ctgtctctgt ctccagggga gagggccacc 120

ctgtcctgca gtgccagctc aagtataaat tacatatact ggtaccagca gaagccagga 180

caggctccta gactcttgat ttatctcaca tccaacctgg cttctggagt ccctgcgcgc 240

ttcagtggca gtgggtctgg aaccgacttc actctcacaa tcagcagcct ggagcctgaa 300

gattttgccg tttattactg cctgcagtgg agtagtaacc cgctcacatt cggtggtggg 360

accaaggtgg agattaaacg tacggtggct gcaccatctg tcttcatctt cccgccatct 420

gatgagcagt tgaaatctgg aactgcctct gttgtgtgcc tgctgaataa cttctatccc 480

agagaggcca aagtacagtg gaaggtggat aacgccctcc aatcgggtaa ctcccaggag 540

agtgtcacag agcaggacag caaggacagc acctacagcc tcagcagcac cctgacgctg 600

agcaaagcag actacgagaa acacaaagtc tacgcctgcg aagtcaccca tcagggcctg 660

agctcgcccg tcacaaagag cttcaacagg ggagagtgtt ga 702

<210>15

<211>702

<212>DNA

＜213〉artificial sequence

<220>

＜223〉description of artificial sequence: humanized antibody sequence

<400>15

atggaagccc cagctcagct tctcttcctc ctgctgctct ggctcccaga taccaccgga 60

gaaattgttc tcacccagtc tccagcaacc ctgtctctgt ctccagggga gagggccacc 120

ctgtcctgca gtgccagctc aagtataaat tacatatact ggctccagca gaagccagga 180

caggctccta gaatcttgat ttatctcaca tccaacctgg cttctggagt ccctgcgcgc 240

ttcagtggca gtgggtctgg aaccgacttc actctcacaa tcagcagcct ggagcctgaa 300

gattttgccg tttattactg cctgcagtgg agtagtaacc cgctcacatt cggtggtggg 360

accaaggtgg agattaaacg tacggtggct gcaccatctg tcttcatctt cccgccatct 420

gatgagcagt tgaaatctgg aactgcctct gttgtgtgcc tgctgaataa cttctatccc 480

agagaggcca aagtacagtg gaaggtggat aacgccctcc aatcgggtaa ctcccaggag 540

agtgtcacag agcaggacag caaggacagc acctacagcc tcagcagcac cctgacgctg 600

agcaaagcag actacgagaa acacaaagtc tacgcctgcg aagtcaccca tcagggcctg 660

agctcgcccg tcacaaagag cttcaacagg ggagagtgtt ga 702

<210>16

<211>9568

<212>DNA

＜213〉artificial sequence

<220>

＜223〉description of artificial sequence: humanized antibody sequence

<400>16

ctgacgcgcc ctgtagcggc gcattaagcg cggcgggtgt ggtggttacg cgcagcgtga 60

ccgctacact tgccagcgcc ctagcgcccg ctcctttcgc tttcttccct tcctttctcg 120

ccacgttcgc cggctttccc cgtcaagctc taaatcgggg gctcccttta gggttccgat 180

ttagtgcttt acggcacctc gaccccaaaa aacttgatta gggtgatggt tcacgtaggg 240

tcgcgacgta ccgggccccc cctcgattaa ttaatcgagc tactagcttt gcttctcaat 300

ttcttatttg cataatgaga aaaaaaggaa aattaatttt aacaccaatt cagtagttga 360

ttgagcaaat gcgttgccaa aaaggatgct ttagagacag tgttctctgc acagataagg 420

acaaacatta ttcagaggga gtacccagag ctgagactcc taagccagtg agtggcacag 480

cattctaggg agaaatatgc ttgtcatcac cgaagcctga ttccgtagag ccacaccttg 540

gtaagggcca atctgctcac acaggataga gagggcagga gccagggcag agcatataag 600

gtgaggtagg atcagttgct cctcacattt gcttctgaca tagttgtgcc agcatggagg 660

aatcgatcct ccatgcttga acaagatgga ttgcacgcag gttctccggc cgcttgggtg 720

gagaggctat tcggctatga ctgggcacaa cagacaatcg gctgctctga tgccgccgtg 780

ttccggctgt cagcgcaggg gcgcccggtt ctttttgtca agaccgacct gtccggtgcc 840

ctgaatgaac tgcaggtaag tgcggccgct ctaggcctcc aaaaaagcct cctcactact 900

tctggaatag ctcagaggcc gaggcggcct cggcctctgc ataaataaaa aaaattagtc 960

agccatgcat ggggcggaga atgggcggaa ctgggcggag ttaggggcgg gatgggcgga 1020

gttaggggcg ggactatggt tgctgactaa ttgagatgca tgctttgcat acttctgcct 1080

gctggggagc ctggggactt tccacacctg gttgctgact aattgagatg catgctttgc 1140

atacttctgc ctgctgggga gcctggggac tttccacacc ctaactgaca cacattccac 1200

agaattaatt cccctagtta ttaatagtaa tcaattacgg ggtcattagt tcatagccca 1260

tatatggagt tccgcgttac ataacttacg gtaaatggcc cgcctggctg accgcccaac 1320

gacccccgcc cattgacgtc aataatgacg tatgttccca tagtaacgcc aatagggact 1380

ttccattgac gtcaatgggt ggactattta cggtaaactg cccacttggc agtacatcaa 1440

gtgtatcata tgccaagtac gccccctatt gacgtcaatg acggtaaatg gcccgcctgg 1500

cattatgccc agtacatgac cttatgggac tttcctactt ggcagtacat ctacgtatta 1560

gtcatcgcta ttaccatggt gatgcggttt tggcagtaca tcaatgggcg tggatagcgg 1620

tttgactcac ggggatttcc aagtctccac cccattgacg tcaatgggag tttgttttgg 1680

caccaaaatc aacgggactt tccaaaatgt cgtaacaact ccgccccatt gacgcaaatg 1740

ggcggtaggc gtgtacggtg ggaggtctat ataagcagag ctgggtacgt gaaccgtcag 1800

atcgcctgga gacgccatca cagatctctc accatggaag ccccagctca gcttctcttc 1860

ctcctgctgc tctggctccc agataccacc ggagaaattg ttctcaccca gtctccagca 1920

accctgtctc tgtctccagg ggagagggcc accctgtcct gcagtgccag ctcaagtata 1980

aattacatat actggtacca gcagaagcca ggacaggctc ctagactctt gatttatctc 2040

acatccaacc tggcttctgg agtccctgcg cgcttcagtg gcagtgggtc tggaaccgac 2100

ttcactctca caatcagcag cctggagcct gaagattttg ccgtttatta ctgcctgcag 2160

tggagtagta acccgctcac attcggtggt gggaccaagg tggagattaa acgtacggtg 2220

gctgcaccat ctgtcttcat cttcccgcca tctgatgagc agttgaaatc tggaactgcc 2280

tctgttgtgt gcctgctgaa taacttctat cccagagagg ccaaagtaca gtggaaggtg 2340

gataacgccc tccaatcggg taactcccag gagagtgtca cagagcagga cagcaaggac 2400

agcacctaca gcctcagcag caccctgacg ctgagcaaag cagactacga gaaacacaaa 2460

gtctacgcct gcgaagtcac ccatcagggc ctgagctcgc ccgtcacaaa gagcttcaac 2520

aggggagagt gttgaattca gatccgttaa cggttaccaa ctacctagac tggattcgtg 2580

acaacatgcg gccgtgatat ctacgtatga tcagcctcga ctgtgccttc tagttgccag 2640

ccatctgttg tttgcccctc ccccgtgcct tccttgaccc tggaaggtgc cactcccact 2700

gtcctttcct aataaaatga ggaaattgca tcgcattgtc tgagtaggtg tcattctatt 2760

ctggggggtg gggtggggca ggacagcaag ggggaggatt gggaagacaa tagcaggcat 2820

gctggggatg cggtgggctc tatggaacca gctgggacta gtagctttgc ttctcaattt 2880

cttatttgca taatgagaaa aaaaggaaaa ttaattttaa caccaattca gtagttgatt 2940

gagcaaatgc gttgccaaaa aggatgcttt agagacagtg ttctctgcac agataaggac 3000

aaacattatt cagagggagt acccagagct gagactccta agccagtgag tggcacagca 3060

ttctagggag aaatatgctt gtcatcaccg aagcctgatt ccgtagagcc acaccttggt 3120

aagggccaat ctgctcacac aggatagaga gggcaggagc cagggcagag catataaggt 3180

gaggtaggat cagttgctcc tcacatttgc ttctgacata gttgtgttgg gagcttggat 3240

agcttggaca gctcagggct gcgatttcgc gccaaacttg acggcaatcc tagcgtgaag 3300

gctggtagga ttttatcccc gctgccatca tggttcgacc attgaactgc atcgtcgccg 3360

tgtcccaaaa tatggggatt ggcaagaacg gagacctacc ctggcctccg ctcaggaacg 3420

agttcaagta cttccaaaga atgaccacaa cctcttcagt ggaaggtaaa cagaatctgg 3480

tgattatggg taggaaaacc tggttctcca ttcctgagaa gaatcgacct ttaaaggaca 3540

gaattaatat agttctcagt agagaactca aagaaccacc acgaggagct cattttcttg 3600

ccaaaagttt ggatgatgcc ttaagactta ttgaacaacc ggaattggca agtaaagtag 3660

acatggtttg gatagtcgga ggcagttctg tttaccagga agccatgaat caaccaggcc 3720

accttagact ctttgtgaca aggatcatgc aggaatttga aagtgacacg tttttcccag 3780

aaattgattt ggggaaatat aaacttctcc cagaataccc aggcgtcctc tctgaggtcc 3840

aggaggaaaa aggcatcaag tataagtttg aagtctacga gaagaaagac taacaggaag 3900

atgctttcaa gttctctgct cccctcctaa agctatgcat ttttataaga ccatgggact 3960

tttgctggct ttagatcagc ctcgactgtg ccttctagtt gccagccatc tgttgtttgc 4020

ccctcccccg tgccttcctt gaccctggaa ggtgccactc ccactgtcct ttcctaataa 4080

aatgaggaaa ttgcatcgca ttgtctgagt aggtgtcatt ctattctggg gggtggggtg 4140

gggcaggaca gcaaggggga ggattgggaa gacaatagca ggcatgctgg ggatgcggtg 4200

ggctctatgg aaccagctgg ggctcgaagc ggccgctccg gatatgccaa gtacgccccc 4260

tattgacgtc aatgacggta aatggcccgc ctggcattat gcccagtaca tgaccttatg 4320

ggactttcct acttggcagt acatctacgt attagtcatc gctattacca tggtgatgcg 4380

gttttggcag tacatcaatg ggcgtggata gcggtttgac tcacggggat ttccaagtct 4440

ccaccccatt gacgtcaatg ggagtttgtt ttggcaccaa aatcaacggg actttccaaa 4500

atgtcgtaac aactccgccc cattgacgca aatgggcggt aggcgtgtac ggtgggaggt 4560

ctatataagc agagctgggt acgtcctcac attcagtgat cagcactgaa cacagacccg 4620

tcgacatgga gtttgggctg agctggcttt ttcttgtggc tattttaaaa ggtgtccagt 4680

gtgaagtgca gctggtggag tctgggggag gcttagtgaa gcctggaggg tccctaagac 4740

tctcctgtgc agcctctgga ttcactttca gtagctatga catgtcttgg gttcgccagg 4800

ctccggggaa ggggctggag tgggtctcaa ccattagtag tggtggtagt tacacctact 4860

atctagacag tataaagggc cgattcacca tctccagaga caatgccaag aactccctgt 4920

acctgcaaat gaacagtctg agggctgagg acacggccgt gtattactgt gcaagacagg 4980

ggttggacta ctggggtcga ggaaccttag tcaccgtctc ctcagctagc accaagggcc 5040

catcggtctt ccccctggca ccctcctcca agagcacctc tgggggcaca gcggccctgg 5100

gctgcctggt caaggactac ttccccgaac cggtgacggt gtcgtggaac tcaggcgccc 5160

tgaccagcgg cgtgcacacc ttcccggctg tcctacagtc ctcaggactc tactccctca 5220

gcagcgtggt gaccgtgccc tccagcagct tgggcaccca gacctacatc tgcaacgtga 5280

atcacaagcc cagcaacacc aaggtggaca agaaagttga gcccaaatct tgtgacaaaa 5340

ctcacacatg cccaccgtgc ccagcacctg aactcctggg gggaccgtca gtcttcctct 5400

tccccccaaa acccaaggac accctcatga tctcccggac ccctgaggtc acatgcgtgg 5460

tggtggacgt gagccacgaa gaccctgagg tcaagttcaa ctggtacgtg gacggcgtgg 5520

aggtgcataa tgccaagaca aagccgcggg aggagcagta caacagcacg taccgtgtgg 5580

tcagcgtcct caccgtcctg caccaggact ggctgaatgg caaggagtac aagtgcaagg 5640

tctccaacaa agccctccca gcccccatcg agaaaaccat ctccaaagcc aaagggcagc 5700

cccgagaacc acaggtgtac accctgcccc catcccggga tgagctgacc aagaaccagg 5760

tcagcctgac ctgcctggtc aaaggcttct atcccagcga catcgccgtg gagtgggaga 5820

gcaatgggca gccggagaac aactacaaga ccacgcctcc cgtgctggac tccgacggct 5880

ccttcttcct ctacagcaag ctcaccgtgg acaagagcag gtggcagcag gggaacgtct 5940

tctcatgctc cgtgatgcat gaggctctgc acaaccacta cacgcagaag agcctctccc 6000

tgtctccggg taaatgagga tccgttaacg gttaccaact acctagactg gattcgtgac 6060

aacatgcggc cgtgatatct acgtatgatc agcctcgact gtgccttcta gttgccagcc 6120

atctgttgtt tgcccctccc ccgtgccttc cttgaccctg gaaggtgcca ctcccactgt 6180

cctttcctaa taaaatgagg aaattgcatc gcattgtctg agtaggtgtc attctattct 6240

ggggggtggg gtggggcagg acagcaaggg ggaggattgg gaagacaata gcaggcatgc 6300

tggggatgcg gtgggctcta tggaaccagc tggggctcga cagcgctgcg atcgcctcga 6360

ggccgctact aactctctcc tccctccttt ttcctgcagg acgaggcagc gcggctatcg 6420

tggctggcca cgacgggcgt tccttgcgca gctgtgctcg acgttgtcac tgaagcggga 6480

agggactggc tgctattggg cgaagtgccg gggcaggatc tcctgtcatc tcaccttgct 6540

cctgccgaga aagtatccat catggctgat gcaatgcggc ggctgcatac gcttgatccg 6600

gctacctgcc cattcgacca ccaagcgaaa catcgcatcg agcgagcacg tactcggatg 6660

gaagccggtc ttgtcgatca ggatgatctg gacgaagagc atcaggggct cgcgccagcc 6720

gaactgttcg ccaggctcaa ggcgcgcatg cccgacggcg aggatctcgt cgtgacccat 6780

ggcgatgcct gcttgccgaa tatcatggtg gaaaatggcc gcttttctgg attcatcgac 6840

tgtggccggc tgggtgtggc ggaccgctat caggacatag cgttggctac ccgtgatatt 6900

gctgaagagc ttggcggcga atgggctgac cgcttcctcg tgctttacgg tatcgccgct 6960

cccgattcgc agcgcatcgc cttctatcgc cttcttgacg agttcttctg agcgggactc 7020

tggggttcga aatgaccgac caagcgacgc ccaacctgcc atcacgagat ttcgattcca 7080

ccgccgcctt ctatgaaagg ttgggcttcg gaatcgtttt ccgggacgcc ggctggatga 7140

tcctccagcg cggggatctc atgctggagt tcttcgccca ccccaacttg tttattgcag 7200

cttataatgg ttacaaataa agcaatagca tcacaaattt cacaaataaa gcattttttt 7260

cactgcattc tagttgtggt ttgtccaaac tcatcaatct atcttatcat gtctggatcg 7320

cggccggccg caccgcggtg gagctttaat taaggcgcgc cagctccagc ttttgttccc 7380

tttagtgagg gttaatttcg agcttggcgt aatcatggtc atagctgttt cctgtgtgaa 7440

attgttatcc gctcacaatt ccacacaaca tacgagccgg aagcataaag tgtaaagcct 7500

ggggtgccta atgagtgagc taactcacat taattgcgtt gcgctcactg cccgctttcc 7560

agtcgggaaa cctgtcgtgc cagctgcatt aatgaatcgg ccaacgcgcg gggagaggcg 7620

gtttgcgtat tgggcgctct tccgcttcct cgctcactga ctcgctgcgc tcggtcgttc 7680

ggctgcggcg agcggtatca gctcactcaa aggcggtaat acggttatcc acagaatcag 7740

gggataacgc aggaaagaac atgtgagcaa aaggccagca aaaggccagg aaccgtaaaa 7800

aggccgcgtt gctggcgttt ttccataggc tccgcccccc tgacgagcat cacaaaaatc 7860

gacgctcaag tcagaggtgg cgaaacccga caggactata aagataccag gcgtttcccc 7920

ctggaagctc cctcgtgcgc tctcctgttc cgaccctgcc gcttaccgga tacctgtccg 7980

cctttctccc ttcgggaagc gtggcgcttt ctcatagctc acgctgtagg tatctcagtt 8040

cggtgtaggt cgttcgctcc aagctgggct gtgtgcacga accccccgtt cagcccgacc 8100

gctgcgcctt atccggtaac tatcgtcttg agtccaaccc ggtaagacac gacttatcgc 8160

cactggcagc agccactggt aacaggatta gcagagcgag gtatgtaggc ggtgctacag 8220

agttcttgaa gtggtggcct aactacggct acactagaag gacagtattt ggtatctgcg 8280

ctctgctgaa gccagttacc ttcggaaaaa gagttggtag ctcttgatcc ggcaaacaaa 8340

ccaccgctgg tagcggtggt ttttttgttt gcaagcagca gattacgcgc agaaaaaaag 8400

gatctcaaga agatcctttg atcttttcta cggggtctga cgctcagtgg aacgaaaact 8460

cacgttaagg gattttggtc atgagattat caaaaaggat cttcacctag atccttttaa 8520

attaaaaatg aagttttaaa tcaatctaaa gtatatatga gtaaacttgg tctgacagtt 8580

accaatgctt aatcagtgag gcacctatct cagcgatctg tctatttcgt tcatccatag 8640

ttgcctgact ccccgtcgtg tagataacta cgatacggga gggcttacca tctggcccca 8700

gtgctgcaat gataccgcga gacccacgct caccggctcc agatttatca gcaataaacc 8760

agccagccgg aagggccgag cgcagaagtg gtcctgcaac tttatccgcc tccatccagt 8820

ctattaattg ttgccgggaa gctagagtaa gtagttcgcc agttaatagt ttgcgcaacg 8880

ttgttgccat tgctacaggc atcgtggtgt cacgctcgtc gtttggtatg gcttcattca 8940

gctccggttc ccaacgatca aggcgagtta catgatcccc catgttgtgc aaaaaagcgg 9000

ttagctcctt cggtcctccg atcgttgtca gaagtaagtt ggccgcagtg ttatcactca 9060

tggttatggc agcactgcat aattctctta ctgtcatgcc atccgtaaga tgcttttctg 9120

tgactggtga gtactcaacc aagtcattct gagaatagtg tatgcggcga ccgagttgct 9180

cttgcccggc gtcaatacgg gataataccg cgccacatag cagaacttta aaagtgctca 9240

tcattggaaa acgttcttcg gggcgaaaac tctcaaggat cttaccgctg ttgagatcca 9300

gttcgatgta acccactcgt gcacccaact gatcttcagc atcttttact ttcaccagcg 9360

tttctgggtg agcaaaaaca ggaaggcaaa atgccgcaaa aaagggaata agggcgacac 9420

ggaaatgttg aatactcata ctcttccttt ttcaatatta ttgaagcatt tatcagggtt 9480

attgtctcat gagcggatac atatttgaat gtatttagaa aaataaacaa ataggggttc 9540

cgcgcacatt tccccgaaaa gtgccaca 9568

<210>17

<211>6414

<212>DNA

＜213〉artificial sequence

<220>

＜223〉description of artificial sequence: plasmid

<400>17

tcgacattga ttattgacta gttattaata gtaatcaatt acggggtcat tagttcatag 60

cccatatatg gagttccgcg ttacataact tacggtaaat ggcccgcctg gctgaccgcc 120

caacgacccc cgcccattga cgtcaataat gacgtatgtt cccatagtaa cgccaatagg 180

gactttccat tgacgtcaat gggtggagta tttacggtaa actgcccact tggcagtaca 240

tcaagtgtat catatgccaa gtacgccccc tattgacgtc aatgacggta aatggcccgc 300

ctggcattat gcccagtaca tgaccttatg ggactttcct acttggcagt acatctacgt 360

attagtcatc gctattacca tggtgatgcg gttttggcag tacatcaatg ggcgtggata 420

gcggtttgac tcacggggat ttccaagtct ccaccccatt gacgtcaatg ggagtttgtt 480

ttggcaccaa aatcaacggg actttccaaa atgtcgtaac aactccgccc cattgacgca 540

aatgggcggt aggcgtgtac ggtgggaggt ctatataagc agagctctct ggctaactag 600

agaacccact gcttaactgg cttatcgaaa ttaatacgac tcactatagg gagacccaag 660

cttctgcagg tcgacatcga tggatccggt acctcgagcg cgaattctct agaggatctt 720

tgtgaaggaa ccttacttct gtggtgtgac ataattggac aaactaccta cagagattta 780

aagctctaag gtaaatataa aatttttaag tgtataatgt gttaaactac tgattctaat 840

tgtttgtgta ttttagattc caacctatgg aactgatgaa tgggagcagt ggtggaatgc 900

ctttaatgag gaaaacctgt tttgctcaga agaaatgcca tctagtgatg atgaggctac 960

tgctgactct caacattcta ctcctccaaa aaagaagaga aaggtagaag accccaagga 1020

ctttccttca gaattgctaa gttttttgag tcatgctgtg tttagtaata gaactcttgc 1080

ttgctttgct atttacacca caaaggaaaa agctgcactg ctatacaaga aaattatgga 1140

aaaatatttg atgtatagtg ccttgactag agatcataat cagccatacc acatttgtag 1200

aggttttact tgctttaaaa aacctcccac acctccccct gaacctgaaa cataaaatga 1260

atgcaattgt tgttgttaac ttgtttattg cagcttataa tggttacaaa taaagcaata 1320

gcatcacaaa tttcacaaat aaagcatttt tttcactgca ttctagttgt ggtttgtcca 1380

aactcatcaa tgtatcttat catgtctgga tcaattctga gaaactagcc ttaaagacag 1440

acagctttgt tctagtcagc caggcaagca tatgtaaata aagttcctca gggaactgag 1500

gttaaaagat gtatcctgga cctgccagac ctggccattc acgtaaacag aagattccgc 1560

ctcaagttcc ggttaacaac aggaggcaac gagatctcaa atctattact tctaatcggg 1620

taattaaaac ctttcaacta aaacacggac ccacggatgt cacccacttt tccttccccg 1680

gctccgccct tctcagtact ccccaccatt aggctcgcta ctccacctcc acttccgggc 1740

gcgacaccca cgtgccctct cccacccgac gctaaccccg cccctgcccg tctgaccccg 1800

cccaccacct ggccccgccc cgttgaggac agaagaaacc ccgggcagcc gcagccaagg 1860

cggacgggta gacgctgggg gcgctgagga gtcgtcctct accttctctg ctggctcggt 1920

gggggacgcg gtggatctca ggcttccgga agactggaag aaccggctca gaaccgcttg 1980

tctccgcggg gcttgggcgg cggaagaatg gccgctagac gcggacttgg tgcgaggcat 2040

cgcaggatgc agaagagcaa gcccgccggg agcgcgcggc tgtactaccc cgcgcctgga 2100

gcggccacgc cggactgggc ggggccggcc tggtggaggc ggagtctgac ctcgtggagg 2160

cggggcctct gatgttcaaa taggatgcta ggcttgttga ggcgtggcct ccgattcaca 2220

agtgggaagc agcgccgggc gactgcaatt tcgcgccaaa cttgggggaa gcacagcgta 2280

caggctgcct aggtgatcgc tgctgctgtc atggttcgac cgctgaactg catcgtcgcc 2340

gtgtcccaga atatgggcat cggcaagaac ggagaccttc cctggccaat gctcaggtac 2400

tggctggatt gggttaggga aaccgaggcg gttcgctgaa tcgggtcgag cacttggcgg 2460

agacgcgcgg gccaactact tagggacagt catgaggggt aggcccgccg gctgctgccc 2520

ttgcccatgc ccgcggtgat ccccatgctg tgccagcctt tgcccagagg cgctctagct 2580

gggagcaaag tccggtcact gggcagcacc accccccgga cttgcatggg tagccgctga 2640

gatggagcct gagcacacgt gacagggtcc ctgttaacgc agtgtttctc taactttcag 2700

gaacgagttc aagtacttcc aaagaatgac caccacctcc tcagtggaag gtaaacagaa 2760

cctggtgatt atgggccgga aaacctggtt ctccattcct gagaagaatc gacctttaaa 2820

ggacagaatt aatatagttc tcagtagaga gctcaaggaa ccaccacaag gagctcattt 2880

tcttgccaaa agtctggacc atgccttaaa acttattgaa caaccagagt tagcagataa 2940

agtggacatg gtttggatag ttggaggcag ttccgtttac aaggaagcca tgaatcagcc 3000

aggccatctc agactctttg tgacaaggat catgcaggaa tttgaaagtg acacgttctt 3060

cccagaaatt gatttggaga aatataaact tctcccagag tacccagggg tcctttctga 3120

agtccaggag gaaaaaggca tcaagtataa atttgaagtc tatgagaaga aaggctaaca 3180

gaaagatact tgctgattga cttcaagttc tactgctttc ctcctaaaat tatgcatttt 3240

tacaagacca tgggacttgt gttggcttta gatcctgtgc atcctgggca actgttgtac 3300

tctaagccac tccccaaagt catgccccag cccctgtata attctaaaca attagaatta 3360

ttttcatttt cattagtcta accaggttat attaaatata ctttaagaaa caccatttgc 3420

cataaagttc tcaatgcccc tcccatgcag cctcaagtgg ctccccagca gatgcatagg 3480

gtagtgtgtg tacaagagac cccaaagaca tagagcccct gagagcatga gctgatatgg 3540

gggctcatag agataggagc tagatgaata agtacaaagg gcagaaatgg gttttaacca 3600

gcagagctag aactcagact ttaaagaaaa ttagatcaaa gtagagactg aattattctg 3660

cacatcagac tctgagcaga gttctgttca ctcagacaga aaatgggtaa attgagagct 3720

ggctccattg tgctccttag agatgggagc aggtggagga ttatataagg tctggaacat 3780

ttaacttctc cgtttctcat cttcagtgag attccaaggg atactacaat tctgtggaat 3840

gtgtgtcagt tagggtgtgg aaagtcccca ggctccccag caggcagaag tatgcaaagc 3900

atgcatctca attagtcagc aaccaggtgt ggaaagtccc caggctcccc agcaggcaga 3960

agtatgcaaa gcatgcatct caattagtca gcaaccatag tcccgcccct aactccgccc 4020

atcccgcccc taactccgcc cagttccgcc cattctccgc cccatggctg actaattttt 4080

tttatttatg cagaggccga ggcgcctctg agctattcca gaagtagtga ggaggctttt 4140

ttggaggcct aggcttttgc aaaaaagcta attcagcctg aatggcgaat gggacgcgcc 4200

ctgtagcggc gcattaagcg cggcgggtgt ggtggttacg cgcagcgtga ccgctacact 4260

tgccagcgcc ctagcgcccg ctcctttcgc tttcttccct tcctttctcg ccacgttcgc 4320

cggctttccc cgtcaagctc taaatcgggg gctcccttta gggttccgat ttagtgcttt 4380

acggcacctc gaccccaaaa acttgattag ggtgatggtt cacgtagtgg gccatcgccc 4440

tgatagacgg tttttcgccc tttgacgttg gagtccacgt tctttaatag tggactcttg 4500

ttccaaactg gaacaacact caaccctatc tcggtctatt cttttgattt ataagggatt 4560

ttgccgattt cggcctattg gttaaaaaat gagctgattt aacaaaaatt taacgcgaat 4620

tttaacaaaa tattaacgtt tacaatttca ggtggcactt ttcggggaaa tgtgcgcgga 4680

acccctattt gtttattttt ctaaatacat tcaaatatgt atccgctcat gagacaataa 4740

ccctgataaa tgcttcaata atattgaaaa aggaagagta tgagtattca acatttccgt 4800

gtcgccctta ttcccttttt tgcggcattt tgccttcctg tttttgctca cccagaaacg 4860

ctggtgaaag taaaagatgc tgaagatcag ttgggtgcac gagtgggtta catcgaactg 4920

gatctcaaca gcggtaagat ccttgagagt tttcgccccg aagaacgttt tccaatgatg 4980

agcactttta aagttctgct atgtggcgcg gtattatccc gtattgacgc cgggcaagag 5040

caactcggtc gccgcataca ctattctcag aatgacttgg ttgagtactc accagtcaca 5100

gaaaagcatc ttacggatgg catgacagta agagaattat gcagtgctgc cataaccatg 5160

agtgataaca ctgcggccaa cttacttctg acaacgatcg gaggaccgaa ggagctaacc 5220

gcttttttgc acaacatggg ggatcatgta actcgccttg atcgttggga accggagctg 5280

aatgaagcca taccaaacga cgagcgtgac accacgatgc ctgtagcaat ggcaacaacg 5340

ttgcgcaaac tattaactgg cgaactactt actctagctt cccggcaaca attaatagac 5400

tggatggagg cggataaagt tgcaggacca cttctgcgct cggcccttcc ggctggctgg 5460

tttattgctg ataaatctgg agccggtgag cgtgggtctc gcggtatcat tgcagcactg 5520

gggccagatg gtaagccctc ccgtatcgta gttatctaca cgacggggag tcaggcaact 5580

atggatgaac gaaatagaca gatcgctgag ataggtgcct cactgattaa gcattggtaa 5640

ctgtcagacc aagtttactc atatatactt tagattgatt taaaacttca tttttaattt 5700

aaaaggatct aggtgaagat cctttttgat aatctcatga ccaaaatccc ttaacgtgag 5760

ttttcgttcc actgagcgtc agaccccgta gaaaagatca aaggatcttc ttgagatcct 5820

ttttttctgc gcgtaatctg ctgcttgcaa acaaaaaaac caccgctacc agcggtggtt 5880

tgtttgccgg atcaagagct accaactctt tttccgaagg taactggctt cagcagagcg 5940

cagataccaa atactgtcct tctagtgtag ccgtagttag gccaccactt caagaactct 6000

gtagcaccgc ctacatacct cgctctgcta atcctgttac cagtggctgc tgccagtggc 6060

gataagtcgt gtcttaccgg gttggactca agacgatagt taccggataa ggcgcagcgg 6120

tcgggctgaa cggggggttc gtgcacacag cccagcttgg agcgaacgac ctacaccgaa 6180

ctgagatacc tacagcgtga gcattgagaa agcgccacgc ttcccgaagg gagaaaggcg 6240

gacaggtatc cggtaagcgg cagggtcgga acaggagagc gcacgaggga gcttccaggg 6300

ggaaacgcct ggtatcttta tagtcctgtc gggtttcgcc acctctgact tgagcgtcga 6360

tttttgtgat gctcgtcagg ggggcggagc ctatggaaaa acgccagcaa cgcc 6414

<210>18

<211>6062

<212>DNA

＜213〉artificial sequence

<220>

＜223〉description of artificial sequence: plasmid

<400>18

tcgacattga ttattgacta gttattaata gtaatcaatt acggggtcat tagttcatag 60

cccatatatg gagttccgcg ttacataact tacggtaaat ggcccgcctg gctgaccgcc 120

caacgacccc cgcccattga cgtcaataat gacgtatgtt cccatagtaa cgccaatagg 180

gactttccat tgacgtcaat gggtggagta tttacggtaa actgcccact tggcagtaca 240

tcaagtgtat catatgccaa gtacgccccc tattgacgtc aatgacggta aatggcccgc 300

ctggcattat gcccagtaca tgaccttatg ggactttcct acttggcagt acatctacgt 360

attagtcatc gctattacca tggtgatgcg gttttggcag tacatcaatg ggcgtggata 420

gcggtttgac tcacggggat ttccaagtct ccaccccatt gacgtcaatg ggagtttgtt 480

ttggcaccaa aatcaacggg actttccaaa atgtcgtaac aactccgccc cattgacgca 540

aatgggcggt aggcgtgtac ggtgggaggt ctatataagc agagctcgtt tagtgaaccg 600

tcagatcgcc tggagacgcc atccacgctg ttttgacctc catagaagac accgggaccg 660

atccagcctc cgcggccggg aacggtgcat tggaacgcgg attccccgtg ccaagagtca 720

ggtaagtacc gcctatagag aagactcttg ggtttctgat aggcactgac tctctctgcc 780

tattggtcta ttttcccacc cttaggctgc tggtgcttaa ctggcttatc gaaattaata 840

cgactcacta tagggagacc caagcttctg caggtcgaca tcgatggatc cggtacctcg 900

agcgcgaatt ctctagagat atcttgttta ttgcagctta taatggttac aaataaagca 960

atagcatcac aaatttcaca aataaagcat ttttttcact gcattctagt tgtggtttgt 1020

ccaaactcat caatgtatct tatcatgtct ggatcaattc tgaaaaacta gccttaaaga 1080

cagacagctt tgttctagtc agccaggcaa gcatatgtaa ataaagttcc tcagggaact 1140

gaggttaaaa gatgtatcct ggacctgcca gacctggcca ttcacgtaaa cagaagattc 1200

cgcctcaagt tccggttaac aacaggaggc aacgagatct caaatctatt acttctaatc 1260

gggtaattaa aacctttcaa ctaaaacacg gacccacgga tgtcacccac ttttccttcc 1320

ccggctccgc ccttctcagt actccccacc attaggctcg ctactccacc tccacttccg 1380

ggcgcgacac ccacgtgccc tctcccaccc gacgctaacc ccgcccctgc ccgtctgacc 1440

ccgcccacca cctggccccg ccccgttgag gacagaagaa accccgggca gccgcagcca 1500

aggcggacgg gtagacgctg ggggcgctga ggagtcgtcc tctaccttct ctgctggctc 1560

ggtgggggac gcggtggatc tcaggcttcc ggaagactgg aagaaccggc tcagaaccgc 1620

ttgtctccgc ggggcttggg cggcggaaga atggccgcta gacgcggact tggtgcgagg 1680

catcgcagga tgcagaagag caagcccgcc gggagcgcgc ggctgtacta ccccgcgcct 1740

ggagcggcca cgccggactg ggcggggccg gcctggtgga ggcggagtct gacctcgtgg 1800

aggcggggcc tctgatgttc aaataggatg ctaggcttgt tgaggcgtgg cctccgattc 1860

acaagtggga agcagcgccg ggcgactgca atttcgcgcc aaacttgggg gaagcacagc 1920

gtacaggctg cctaggtgat cgctgctgct gtcatggttc gaccgctgaa ctgcatcgtc 1980

gccgtgtccc agaatatggg catcggcaag aacggagacc ttccctggcc aatgctcagg 2040

tactggctgg attgggttag ggaaaccgag gcggttcgct gaatcgggtc gagcacttgg 2100

cggagacgcg cgggccaact acttagggac agtcatgagg ggtaggcccg ccggctgctg 2160

cccttgccca tgcccgcggt gatccccatg ctgtgccagc ctttgcccag aggcgctcta 2220

gctgggagca aagtccggtc actgggcagc accacccccc ggacttgcat gggtagccgc 2280

tgagatggag cctgagcaca cgtgacaggg tccctgttaa cgcagtgttt ctctaacttt 2340

caggaacgag ttcaagtact tccaaagaat gaccaccacc tcctcagtgg aaggtaaaca 2400

gaacctggtg attatgggcc ggaaaacctg gttctccatt cctgagaaga atcgaccttt 2460

aaaggacaga attaatatag ttctcagtag agagctcaag gaaccaccac aaggagctca 2520

ttttcttgcc aaaagtctgg accatgcctt aaaacttatt gaacaaccag agttagcaga 2580

taaagtggac atggtttgga tagttggagg cagttccgtt tacaaggaag ccatgaatca 2640

gccaggccat ctcagactct ttgtgacaag gatcatgcag gaatttgaaa gtgacacgtt 2700

cttcccagaa attgatttgg agaaatataa acttctccca gagtacccag gggtcctttc 2760

tgaagtccag gaggaaaaag gcatcaagta taaatttgaa gtctatgaga agaaaggcta 2820

acagaaagat acttgctgat tgacttcaag ttctactgct ttcctcctaa aattatgcat 2880

ttttacaaga ccatgggact tgtgttggct ttagatcctg tgcatcctgg gcaactgttg 2940

tactctaagc cactccccaa agtcatgccc cagcccctgt ataattctaa acaattagaa 3000

ttattttcat tttcattagt ctaaccaggt tatattaaat atactttaag aaacaccatt 3060

tgccataaag ttctcaatgc ccctcccatg cagcctcaag tggctcccca gcagatgcat 3120

agggtagtgt gtgtacaaga gaccccaaag acatagagcc cctgagagca tgagctgata 3180

tgggggctca tagagatagg agctagatga ataagtacaa agggcagaaa tgggttttaa 3240

ccagcagagc tagaactcag actttaaaga aaattagatc aaagtagaga ctgaattatt 3300

ctgcacatca gactctgagc agagttctgt tcactcagac agaaaatggg taaattgaga 3360

gctggctcca ttgtgctcct tagagatggg agcaggtgga ggattatata aggtctggaa 3420

catttaactt ctccgtttct catcttcagt gagattccaa gggatactac aattctgtgg 3480

aatgtgtgtc agttagggtg tggaaagtcc ccaggctccc cagcaggcag aagtatgcaa 3540

agcatgcatc tcaattagtc agcaaccagg tgtggaaagt ccccaggctc cccagcaggc 3600

agaagtatgc aaagcatgca tctcaattag tcagcaacca tagtcccgcc cctaactccg 3660

cccatcccgc ccctaactcc gcccagttcc gcccattctc cgccccatgg ctgactaatt 3720

ttttttattt atgcagaggc cgaggcgcct ctgagctatt ccagaagtag tgaggaggct 3780

tttttggagg cctaggcttt tgcaaaaaag ctaattcagc ctgaatggcg aatgggaaat 3840

tgtaaacgtt aatattttgt taaaattcgc gttaaatttt tgttaaatca gctcattttt 3900

taaccaatag gccgaaatcg gcaaaatccc ttataaatca aaagaataga ccgagatagg 3960

gttgagtgtt gttccagttt ggaacaagag tccactatta aagaacgtgg actccaacgt 4020

caaagggcga aaaaccgtct atcagggcga tggcccacta cgtgaaccat caccctaatc 4080

aagtttttgg ggtcgaggtg ccgtaaagca ctaaatcgga accctaaagg gagcccccga 4140

tttagagctt gacggggaaa gccggcgaac gtggcgagaa aggaagggaa gaaagcgaaa 4200

ggagcgggcg ctagggcgct ggcaagtgta gcggtcacgc tgcgcgtaac caccacaccc 4260

gccgcgctta atgcgccgct acagggcgcg tcaggtggca cttttcgggg aaatgtgcgc 4320

ggaaccccta tttgtttatt tttctaaata cattcaaata tgtatccgct catgagacaa 4380

taaccctgat aaatgcttca ataatattga aaaaggaaga gtatgagtat tcaacatttc 4440

cgtgtcgccc ttattccctt ttttgcggca ttttgccttc ctgtttttgc tcacccagaa 4500

acgctggtga aagtaaaaga tgctgaagat cagttgggtg cacgagtggg ttacatcgaa 4560

ctggatctca acagcggtaa gatccttgag agttttcgcc ccgaagaacg ttttccaatg 4620

atgagcactt ttaaagttct gctatgtggc gcggtattat cccgtattga cgccgggcaa 4680

gagcaactcg gtcgccgcat acactattct cagaatgact tggttgagta ctcaccagtc 4740

acagaaaagc atcttacgga tggcatgaca gtaagagaat tatgcagtgc tgccataacc 4800

atgagtgata acactgcggc caacttactt ctgacaacga tcggaggacc gaaggagcta 4860

accgcttttt tgcacaacat gggggatcat gtaactcgcc ttgatcgttg ggaaccggag 4920

ctgaatgaag ccataccaaa cgacgagcgt gacaccacga tgcctgtagc aatggcaaca 4980

acgttgcgca aactattaac tggcgaacta cttactctag cttcccggca acaattaata 5040

gactggatgg aggcggataa agttgcagga ccacttctgc gctcggccct tccggctggc 5100

tggtttattg ctgataaatc tggagccggt gagcgtgggt ctcgcggtat cattgcagca 5160

ctggggccag atggtaagcc ctcccgtatc gtagttatct acacgacggg gagtcaggca 5220

actatggatg aacgaaatag acagatcgct gagataggtg cctcactgat taagcattgg 5280

taactgtcag accaagttta ctcatatata ctttagattg atttaaaact tcatttttaa 5340

tttaaaagga tctaggtgaa gatccttttt gataatctca tgaccaaaat cccttaacgt 5400

gagttttcgt tccactgagc gtcagacccc gtagaaaaga tcaaaggatc ttcttgagat 5460

cctttttttc tgcgcgtaat ctgctgcttg caaacaaaaa aaccaccgct accagcggtg 5520

gtttgtttgc cggatcaaga gctaccaact ctttttccga aggtaactgg cttcagcaga 5580

gcgcagatac caaatactgt ccttctagtg tagccgtagt taggccacca cttcaagaac 5640

tctgtagcac cgcctacata cctcgctctg ctaatcctgt taccagtggc tgctgccagt 5700

ggcgataagt cgtgtcttac cgggttggac tcaagacgat agttaccgga taaggcgcag 5760

cggtcgggct gaacgggggg ttcgtgcaca cagcccagct tggagcgaac gacctacacc 5820

gaactgagat acctacagcg tgagcattga gaaagcgcca cgcttcccga agggagaaag 5880

gcggacaggt atccggtaag cggcagggtc ggaacaggag agcgcacgag ggagcttcca 5940

gggggaaacg cctggtatct ttatagtcct gtcgggtttc gccacctctg acttgagcgt 6000

cgatttttgt gatgctcgtc aggggggcgg agcctatgga aaaacgccag caacgcagct 6060

gc 6062

Claims

1. antibody molecule, or its fragment, allele variant, functional variant, the glycosylation variant, fusion molecule or its chemical derivative, this antibody molecule contain the variable region just like the defined amino acid sequence heavy chain of SEQ ID No.1.

2. antibody molecule, wherein variable region of heavy chain is comprised of the amino acid take SEQ ID No.1 amino acid sequence as feature.

3. antibody molecule, or its fragment, allele variant, functional variant, the glycosylation variant, fusion molecule or its chemical derivative, this antibody molecule contain the variable region just like the defined amino acid sequence light chain of SEQ ID No.2.

4. antibody molecule, wherein variable region of light chain is comprised of the amino acid take SEQ ID No.2 amino acid sequence as feature.

5. antibody molecule, or its fragment, allele variant, functional variant, the glycosylation variant, fusion molecule or its chemical derivative, this antibody molecule contain the variable region just like the defined amino acid sequence light chain of SEQ ID No.3.

6. antibody molecule, wherein variable region of light chain is comprised of the amino acid take SEQ ID No.3 amino acid sequence as feature.

According to claim 1 with 3 antibody molecule, or its fragment, allele variant, functional variant, the glycosylation variant, fusion molecule or its chemical derivative, this antibody contains the variable region of heavy chain just like the defined amino acid sequence of SEQ ID No.1, and contains the variable region of light chain just like the defined amino acid sequence of SEQ ID No.2.

According to claim 2 with 4 antibody molecule, variable region of heavy chain wherein is comprised of the amino acid take SEQ ID No.1 amino acid sequence as feature, and variable region of light chain wherein is comprised of the amino acid take SEQ ID No.2 amino acid sequence as feature.

According to claim 1 with 5 antibody molecule, or its fragment, allele variant, functional variant, the glycosylation variant, fusion molecule or its chemical derivative, this antibody contains the variable region of heavy chain just like the defined amino acid sequence of SEQ ID No.1, and contains the variable region of light chain just like the defined amino acid sequence of SEQ ID No.3.

According to claim 2 with 6 antibody molecule, variable region of heavy chain wherein is comprised of the amino acid take SEQ ID No.1 amino acid sequence as feature, and variable region of light chain wherein is comprised of the amino acid take SEQ ID No.3 amino acid sequence as feature.

11. an antibody molecule, or its fragment, allele variant, functional variant, take the variant of degenerate core acid code as the basis, fusion molecule or its chemical derivative, this antibody contains the variable region of heavy chain just like the defined nucleic acid sequence encoding of SEQ ID No.4.

12. an antibody molecule, variable region of heavy chain wherein is coded by the defined nucleotide sequence of SEQ ID No.4.

13. an antibody molecule, or its fragment, allele variant, functional variant, take the variant of degenerate core acid code as the basis, fusion molecule or its chemical derivative, this antibody molecule contains the variable region of light chain just like the defined nucleic acid sequence encoding of SEQ ID No.5.

14. an antibody molecule, variable region of light chain wherein is coded by the defined nucleotide sequence of SEQ ID No.5.

15. an antibody molecule, or its fragment, allele variant, functional variant, take the variant of degenerate core acid code as the basis, fusion molecule or its chemical derivative, this antibody molecule contains the variable region of light chain just like the defined nucleic acid sequence encoding of SEQ ID No.6.

16. an antibody molecule, variable region of light chain wherein is coded by the defined nucleotide sequence of SEQ ID No.6.

17. according to claim 11 with 13 antibody molecule, or its fragment, allele variant, functional variant, take the variant of degenerate core acid code as the basis, fusion molecule or chemical derivative, this antibody molecule contains the variable region of heavy chain just like the defined nucleic acid sequence encoding of SEQ ID No.4, and contains the variable region of light chain just like the defined nucleic acid sequence encoding of SEQ ID No.5.

18. according to claim 12 with 14 antibody molecule, variable region of heavy chain wherein is by such as the defined nucleic acid sequence encoding of SEQ ID No.4, and variable region of light chain wherein is by such as the defined nucleic acid sequence encoding of SEQ ID No.5.

19. according to claim 11 with 15 antibody molecule, or its fragment, allele variant, functional variant, take the variant of degenerate core acid code as the basis, fusion molecule or chemical derivative, this antibody molecule contains the variable region of heavy chain just like the defined nucleic acid sequence encoding of SEQ ID No.4, and contains the variable region of light chain just like the defined nucleic acid sequence encoding of SEQ ID No.6.

20. according to claim 12 with 16 antibody molecule, variable region of heavy chain wherein is by such as the defined nucleic acid sequence encoding of SEQ ID No.4, and variable region of light chain wherein is by such as the defined nucleic acid sequence encoding of SEQ ID No.6.

21. to 20 each antibody molecules, it is characterized in that each described variable region of light chain and variable region of heavy chain are connected to respectively human constant region according to claim 1.

22. antibody molecule according to claim 21 should mankind's constant region of light chain be human κ constant region wherein.

23. according to claim 21 or 22 antibody molecule, wherein this human heavy chain constant region is IgG 1 constant region.

24. according to claim 1 to 23 each antibody molecules, or its fragment, allele variant, functional variant, the glycosylation variant, fusion molecule or chemical derivative, this antibody contains the heavy chain that is characterised in that such as the defined amino acid sequence of SEQ ID No.7, and contains the light chain that is characterised in that such as the defined amino acid sequence of SEQ ID No.8.

25. to 24 each antibody molecules, heavy chain wherein is comprised of the amino acid take SEQ ID No.7 amino acid sequence as feature, and light chain wherein is comprised of the amino acid take SEQ ID No.8 amino acid sequence as feature according to claim 1.

26. according to claim 1 to 25 each antibody molecules, or its fragment, allele variant, functional variant, the glycosylation variant, fusion molecule or chemical derivative, this antibody contains the heavy chain that is characterised in that such as the defined amino acid sequence of SEQ ID No.7, and contains the light chain that is characterised in that such as the defined amino acid sequence of SEQ ID No.9.

27. to 26 each antibody molecules, heavy chain wherein is comprised of the amino acid take SEQ ID No.7 amino acid sequence as feature, and light chain wherein is comprised of the amino acid take SEQ ID No.9 amino acid sequence as feature according to claim 1.

28. according to claim 1 to 27 each antibody molecules, or its fragment, allele variant, functional variant, take the variant of degenerate core acid code as the basis, fusion molecule or chemical derivative, this antibody contains the heavy chain just like the defined nucleic acid sequence encoding of SEQ ID No.10, and contains the light chain that is characterised in that such as the defined nucleotide sequence of SEQ ID No.11.

29. to 28 each antibody molecules, heavy chain wherein is coded by SEQ ID No.10 nucleotide sequence, and light chain wherein is coded by the nucleotide sequence of SEQ ID No.11 according to claim 1.

30. according to claim 1 to 29 each antibody molecules, or its fragment, allele variant, functional variant, take the variant of degenerate core acid code as the basis, fusion molecule or chemical derivative, it contains the heavy chain by the defined nucleic acid sequence encoding of SEQ ID No.10, and contains the light chain that is characterised in that such as the defined nucleotide sequence of SEQ ID No.12.

31. to 30 each antibody molecules, heavy chain wherein is by the nucleic acid sequence encoding of SEQ ID No.10, and light chain wherein is coded by the nucleotide sequence of SEQ ID No.12 according to claim 1.

32. according to claim 1 to 31 each antibody molecules, or its fragment, allele variant, functional variant, take the variant of degenerate core acid code as the basis, fusion molecule or chemical derivative, this antibody molecule contains by the heavy chain such as the defined nucleic acid sequence encoding of SEQ ID No.13, and contains the light chain that is characterised in that such as the defined nucleotide sequence of SEQ ID No.14.

33. to 32 each antibody molecules, wherein heavy chain is coded by the nucleotide sequence of SEQ ID No.13, and wherein light chain is coded by the nucleotide sequence of SEQ ID No.14 according to claim 1.

34. according to claim 1 to 33 each antibody molecules, or its fragment, allele variant, functional variant, take the variant of degenerate core acid code as the basis, fusion molecule or chemical derivative, this antibody molecule contain by such as the coded heavy chain of the defined nucleotide sequence of SEQ ID No.13, and contain the light chain that is characterised in that such as the defined nucleotide sequence of SEQ ID No.15.

35. to 34 each antibody molecules, wherein heavy chain is coded by the nucleotide sequence of SEQ ID No.13, and wherein light chain is coded by the nucleotide sequence of SEQ ID No.15 according to claim 1.

36. according to claim 1 to 35 each antibody molecules, or its fragment, allele variant, functional variant, take the variant of degenerate core acid code as the basis, fusion molecule or chemical derivative, this antibody molecule contain heavy chain and the light chain by the defined nucleic acid sequence encoding of SEQ ID No.16.

37. to 36 each antibody molecules, wherein heavy chain and light chain are coded by the nucleotide sequence of SEQ ID No.16 according to claim 1.

38. to 37 each antibody proteins, wherein this antibody protein is to be connected to a kind of therapeutic agent according to claim 1.

39. antibody protein according to claim 38, wherein said therapeutic agent are to be selected from following therapeutic agent: radio isotope, toxin, toxoid, inflammatory agent and chemotherapeutant.

40. antibody protein according to claim 39, wherein said therapeutic agent are to be connected to antibody protein via connexon, this connexon is selected from: MAG-3 GABA, MAG-2 GABA or N2S2.

41. antibody protein according to claim 40, wherein said therapeutic agent are to be connected to antibody protein via MAG-2 GABA.

42. each antibody protein according to claim 38-41, wherein said radio isotope is the beta rays radio isotope.

43. antibody protein according to claim 42, wherein said radio isotope is selected from:¹⁸⁶Rhenium,¹⁸⁸Rhenium,¹³¹Iodine or⁹⁹Yttrium.

44. antibody protein according to claim 43, wherein said radio isotope is¹⁸⁶Rhenium.

45. each antibody protein according to claim 39-44, the specific activity of wherein said antibody protein by about 0.5 to about 15 millicurie/milligrams, or by about 0.5 to about 14 millicurie/milligrams, preferably by about 1 to about 10 millicurie/milligrams, preferred about 1 to about 5 millicurie/milligrams, and most preferably are 2 to 6 millicurie/milligrams or 1 to 3 millicurie/milligram.

46. to 37 each antibody proteins, it is characterized in that it is through mark according to claim 1.

47. antibody protein according to claim 46, wherein said mark are detectable marks.

48. antibody protein according to claim 47, wherein detectable mark is selected from: enzyme, dyestuff, radio isotope, foxalin or biotin.

49. according to claim 1 to 37 each antibody proteins, but it is the preparation that is connected to a kind of video picture.

50. antibody protein according to claim 49, but wherein the video picture preparation is radio isotope.

51. antibody protein according to claim 50, wherein said radio isotope are the gamma ray activity isotopes.

52. 1 antibody protein according to claim 5, wherein said radio isotope is¹²⁵I。

53. a pharmaceutical composition, it contains according to claim 1 to 45 each antibody protein and pharmaceutically acceptable carrier or excipient.

54. 3 pharmaceutical composition according to claim 5, wherein said antibody protein is to be connected to according to claim 39-44 each radio isotopes, and have specific activity by about 0.5 to about 15 millicurie/milligrams, or by about 0.5 to about 14 millicurie/milligrams, preferred about 1 to about 10 millicurie/milligrams, preferred about 1 to about 5 millicurie/milligrams, and most preferably 2 to 6 millicurie/milligrams or 1 to 3 millicurie/milligram.

55. 3 or 54 pharmaceutical composition according to claim 5, the amount of wherein wanting to be applied to radio-labeled antibody in patient's the pharmaceutical composition is 10,20,30,40,50 or 60 millicurie/rice²。

56. each pharmaceutical composition of 3-55 according to claim 5, the amount of wherein wanting to be applied to radio-labeled antibody in patient's the pharmaceutical composition is 50 millicurie/rice²。

57. each pharmaceutical composition of 3-56 wherein further contains one or more and is selected from following radiation protection agent: ascorbic acid, gentianic acid according to claim 5; reductic acid, erythritic acid, Para-Aminobenzoic; 4-HBA; niacin, niacinamide, 2; 5-dihydroxy-1; the 4-benzenedisulfonic acid, general dimension ketone, inositol and/or citrate.

58. each pharmaceutical composition of 3-57 according to claim 5, radiation protection agent wherein is ascorbic acid.

59. each pharmaceutical composition of 3-58 according to claim 5, wherein this antibody protein contains and is selected from by claim 8, defined antibody molecule in 10,18,20,24,25,28,29,32,33,36,37, and it is connected to via MAG-2 GABA¹⁸⁶Rhenium, and further contain radiation protection agent ascorbic acid.

60. according to claim 1 to 45 each the purposes of antibody protein in preparation treatment cancer drug.

61. the purposes of 0 antibody protein according to claim 6, wherein said cancer is selected from: colorectal cancer, non-small cell lung cancer, breast cancer, head and neck cancer, oophoroma, lung cancer, carcinoma of urinary bladder, the metastatic carcinoma of cancer of pancreas and brain.

62. the purposes of 0 or 61 antibody protein according to claim 6, wherein said antibody protein is to be connected to according to claim 39-44 each defined radio isotopes, and have specific activity by about 0.5 to about 15 millicurie/milligrams, or by about 0.5 to about 14 millicurie/milligrams, preferred about 1 to about 10 millicurie/milligrams, preferred about 1 to about 5 millicurie/milligrams, most preferably 2 to 6 millicurie/milligrams or 1 to 3 millicurie/milligram.

63. the purposes of 2 antibody protein according to claim 6, the amount of wherein wanting to be applied to radio-labeled antibody in patient's the pharmaceutical composition is 10,20,30,40,50 or 60 millicurie/rice²。

64. the purposes of 2 antibody protein according to claim 6, the amount of wherein wanting to be applied to radio-labeled antibody in patient's the pharmaceutical composition is 50 millicurie/rice²。

65. the method for a treatment of cancer, wherein each antibody protein of claim 1-45 is administered to this individuality that needs once to for several times, described antibody protein is optionally in conjunction with CD44v6, destroy tumour cell by the therapeutic agent that is connected with this antibody protein, and monitor the success of this treatment.

66. the method for claim 65, wherein said tumour are to be selected from following tumour: colorectal cancer, non-small cell lung cancer, breast cancer, head and neck cancer, oophoroma, lung cancer, carcinoma of urinary bladder, the metastatic carcinoma of cancer of pancreas and brain.

67. a nucleic acid is characterized in that its coding is according to claim 1 to 37 each antibody proteins.

68. a recombinant DNA carrier is characterised in that it contains according to claim 67 nucleic acid.

69. 8 recombinant DNA carrier is characterised in that it is a kind of expression vector according to claim 6.

70. 8 or 69 recombinant DNA carrier is characterised in that it is carrier pAD-CMV or its functional derivatives according to claim 6.

71. the recombinant DNA carrier of 8-70 is characterised in that it is carrier N5KG1Val or derivatives thereof according to claim 6.

72. a host is characterised in that it contains the carrier of claim 68 to 71.

73. 2 host is characterised in that it is a kind of eukaryotic host cell according to claim 7.

74. 2 or 73 host is characterised in that it is a kind of mammalian cell according to claim 7.

75. the host of 2-74 is characterised in that it is BHK, CHO or COS cell according to claim 7.

76. 2 host is characterised in that it is a kind of bacteriophage according to claim 7.

77. 2 host is characterised in that it is a kind of prokaryotic host cell according to claim 7.

78. one kind prepares according to claim 1 to 37 each the methods of antibody protein, it is characterized in that it may further comprise the steps: under described antibody protein can be by the condition of described host cell expression, cultivate each defined host of claim 72 to 77, separate again this antibody protein.

79. 8 method is characterized in that described host is a kind of mammalian cell, preferably CHO or COS cell according to claim 7.

80. 8 or 79 method is characterized in that described host cell is the common-transfection of plasmid institute that carries light or heavy chain expression unit with two according to claim 7.