CN1400316A - Collapsin reaction medium protein-1 - Google Patents

Abstract

The present invention relates to a discovery based on relativity of collapsin response mediator protein-1 (CRMP-I) and tumor metastasis. THe CRMP-1 or mRNA level can be used as guiding principle for detecting cell virulence anjd testing the capability of compound for changing cell virulence. The extent of CRMP-1 protein can be changed, for example, it can reduce virulence.

Description

Collapsin reaction medium protein-1-1

No. the 60/301st, 075, the application's case request u.s. patent application serial number, in the right of priority of application on June 26 calendar year 2001, for all purposes, its complete content system incorporates into as the reference data.

Technical field

Collapsin reaction medium protein-1 (Collapsing Response Mediator Proteins, CRMPs) belong to the proteic gang of phosphoric acid, this albumen media is led agate good fortune element (semaphorin)/collapsin inductive growing tip and is subside, and relevant with aixs cylinder guiding and neurone differentiation.Please refer to Nature 376:509-14 as Goshima et al. (1995); Fukada et al. (2000) J Biol Chem.275:37957-65; Minturn etal. (1995) J Neurosci 15:6757-66; Wang ﹠amp; Stittmatter (1996) J Neurosci 16:6197-207; Byk et al. (1996) J Neurosci 16:688-701; And Gaetano et al. (1997) JBiol Chem.272:12195-201.

Fifty percent member of the CRMP family relevant with 60-66kDa albumen (CRMP-1, CRMP-2, CRMP-3, CRMP-4, and CRMP-5) cloned out because of various objectives by the different experiments chamber respectively.One of CRMP family albumen feature functionality is the repulsion guiding of neuron axon.The functional role of CRMPs in this process is studied out (Quinn et al. (1999) JNeurobiol 41:158-64).Fifty percent Yuan of above-mentioned CRMPs has 50%-70% amino acid sequence similarity (Hamajima et al. (1996) Gene 180:157-63), and it once was suggested meeting via formation allos tetramer (the Wang ﹠amp that mutually combines; Stittmatter (1997) JNeurochem 69:2261-9).Yet each CRMPs member all shows unique performance kenel when neural system takes place, and can reply nerve growth factor inductive neurone differentiation (Byk et al. (1998) Eur J Biochem 254:14-24).

CRMP-2 is found relevant with Ai Zihaimo disease patient's neurofibrillary tangles (neurofibrillary tangles) (Gu et al. (2000) Biochemistry 39:4267-75).CRMP-3 and CRMP-5 are identified as autoantibody (Yu et al. (2001) the AnnNeurol 49:146-54 of small cell lung cancer with the loyal person of the newborn nervous symptoms of pair; And Honnorat et al. (1999) Eur J Neurosci 11:4226-32).

Summary of the invention

The present invention is based on relevant with some metastases at least discovery of Collapsin reaction medium protein-1-1 (CRMP-1).The nucleotide sequence illustration of one CRMP-1 coding region is as follows:

5?????????ATGTCGTACC?AGGGCAAGAA?GAGCATCCCG?CACATCACGA?GTGACCGACT?CCTCATCAAA

60

GGTGGACGGA?TCATCAACGA?TGACCAATCC?CTTTATGCTG?ACGTCTACCT?GGAGGATGGA

120

CTTATCAAAC?AAATAGGAGA?GAACTTAATC?GTTCCTGGTG?GAGTGAAGAC?CATTGAAGCC

10???180

AACGGGCGGA?TGGTTATTCC?CGGAGGTATT?GATGTCAACA?CGTACCTGCA?GAAGCCCTCC

240

CAGGGGATGA?CTGCGGCTGA?TGACTTCTTC?CAAGGGACCA?GGGCGGCACT?GGTGGGCGGG

300

15????????ACCACGATGA?TCATTGACCA?TGTTGTTCCT?GAACCTGGGT?CCAGCCTACT?GACCTCTTTC

360

GAGAAGTGGC?ACGAAGCAGC?TGACACCAAA?TCCTGCTGTG?ATTACTCCCT?CCACGTGGAC

420

ATCACAAGCT?GGTACGATGG?CGTTCGGGAG?GAGCTGGAGG?TGCTGGTGCA?GGACAAAGGC

20???480

GTCAATTCCT?TCCAAGTCTA?CATGGCCTAT?AAGGATGTCT?ACCAAATGTC?CGACAGCCAG

540

CTCTATGAAG?CCTTTACCTT?CCTTAAGGGC?CTGGGAGCTG?TGATCTTGGT?CCATGCAGAA

600

25????????AATGGAGATT?TGATAGCTCA?GGAACAAAAG?CGGATCCTGG?AGATGGGCAT?CACGGGTCCC

660

GAGGGCCATG?CCCTGAGCAG?ACCTGAAGAG?CTGGAGGCCG?AGGCGGTGTT?CCGGGCCATC

720

30???780??ACCATTGCGG?GCCGGATCAA?CTGCCCTGTG?TACATCACCA?AGGTCATGAG?CAAGAGTGCA

GCCGACATCA?TCGCTCTGGC?CAGGAAGAAA?GGGCCCCTAG?TTTTTGGAGA?GCCCATTGCC

840

GCCAGCCTGG?GGACCGATGG?CACCCATTAC?TGGAGCAAGA?ACTGGGCCAA?GGCTGCGGCG

900

35????????TTCGTGACTT?CCCCTCCCCT?GAGCCCGGAC?CCTACCACGC?CCGACTACTT?GACCTCCCTA

960

CTGGCCTGTG?GGGACTTGCA?GGTCACAGGC?AGCGGCCACT?GTCCCTACAG?CACTGCCCAG

1020

40???1080?AAGGCGGTGG?GCAAGGACAA?CTTTACCCTG?ATCCCCGAGG?GTGTCAACGG?GATAGAGGAG

CGGATGACCG?TCGTCTGGGA?CAAGGCGGTG?GCTACTGGCA?AAATGGATGA?GAACCAGTTT

1140

GTCGCTGTCA?CCAGCACCAA?TGCAGCCAAG?ATCTTTAACC?TGTACCCAAG?GAAAGGGCGG

1200

45????????ATTGCCGTGG?GCTCGGATGC?CGACGTGGTC?ATCTGGGACC?CCGACAAGTT?GAAGACCATA

1260

1260

5?????????GTCAACAAGG?GCATGGGCCG?CTTCATTCCG?CGGAAGGCGT?TCCCGGAGCA?CCTGTACCAG

1440

CGCGTCAAAA?TCAGGAATAA?GGTTTTTGGA?TTGCAAGGGG?TTTCCAGGGG?CATGTATGAC

1500

GGTCCTGTGT?ACGAGGTACC?AGCTACACCC?AAATATGCAA?CTCCCGCTCC?TTCAGCCAAA

10??1560

TCTTCGCCTT?CTAAACACCA?GCCCCCACCC?ATCAGAAACC?TCCACCAGTC?CAACTTCAGC

1620

TTATCAGGTG?CCCAGATAGA?TGACAACAAT?CCCAGGCGCA?CCGGCCACCG?CATCGTGGCG

1680

15????????CCCCCTGGTG?GCCGCTCCAA?CATCACCAGC?CTCGGTTGA??(SEQ?ID?NO：1)??1719

The aminoacid sequence of CRMP-1 is as follows:

MSYQGKKSIPHITSDRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLIVP

GGVKTIEANGRMVIPGGIDVNTYLQKPSQGMTAADDFFQGTRAALVGGTTMIID

HVVPEPGSSLLTSFEKWHEAADTKSCCDYSLHVDITSWYDGVREELEVLVQDKG?20??VNSFQVYMAYKDVYQMSDSQLYEAFTFLKGLGAVILVHAENGDLIAQEQKRILE

MGITGPEGHALSRPEELEAEAVFRAITIAGRINCPVYITKVMSKSAADIIALARKK

GPLVFGEPIAASLGTDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYLTSLLACGD

LQVTGSGHCPYSTAQKAVGKDNFTLIPEGVNGIEERMTVVWDKAVATGKMDEN

QFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDKLKTITAKSHKSAVEYNIF?25??EGMECHGSPLVVISQGKIVFEDGNINVNKGMGRFIPRKAFPEHLYQRVKIRNKVF

GLQGVSRGMYDGPVYEVPATPKYATPAPSAKSSPSKHQPPPIRNLHQSNFSLSGA

QIDDNNPRRTGHRIVAPPGGRSNITSLG(SEQ?ID?NO：2).

CRMP-1 also once was recorded in SWISS-PROT registration Q14194 number, gene library gene position D78012, and gene library gene position BAA11190.Its also be considered to the dihydropyrimidinase related protein-1 (dihydropyrimidinase related protein-1, DRP-1).

An aspect of of the present present invention provides the method that a therapeutical peptide gives an individuality.This method comprises identifies that an individuality is that needs are treated with prevention, alleviate, or the metastases of stopping; One cell is provided, and this cell comprises an exogenous nucleic acid, and its coding one has the aminoacid sequence numbering: the polypeptide of SEQ ID NO:2 or its functional fragment; Allow the human cell to express a polypeptide, and bestow this polypeptide to one individuality.This cell can be human cell, for example people's fibroblast.This individuality can be people or laboratory animal.

So-called " functional fragment " represents a nucleic acid or a polypeptide herein, has at least one encoding sequence numbering: the polypeptide active of SEQ ID NO:2, can suppress metastases.Segmental functional can be by expressing this fragment in CL _1-5Lung carcinoma cell is also assessed cells transfected and is invaded the ability of basilar membrane and measure in reconstruction in vitro basilar membrane invasive test.One functional fragment will suppress CL _1-5The intrusion phenotype of lung carcinoma cell.

CRMP-1 nucleic acid has the sequence that is selected from following group: (1) comprises the nucleotide sequence at least 80% homologous nucleic acid with SEQ ID NO:1; (2) comprise the segmental nucleic acid of at least 150 Nucleotide of the nucleotide sequence of SEQ ID NO:1; (3) coding contains the nucleic acid of polypeptide of the aminoacid sequence of SEQ ID NO:2; And (4) coding contains the segmental nucleic acid of polypeptide of the aminoacid sequence of SEQ ID NO:2, and wherein this fragment comprises the amino acid of at least 50 SEQ ID NO:2.The CRMP-1 polypeptide has the sequence that is selected from following group: (1) comprises the aminoacid sequence at least 80% homologous polypeptide of sequence with SEQ ID NO:2; (2) contain the fragment of the aminoacid sequence of SEQ ID NO:2, wherein this fragment comprises the amino acid of at least 50 SEQ IDNO:2; (3) by the polypeptide of the nucleic acid encoding of the nucleotide sequence that contains SEQ ID NO:1; And (4) by with the polypeptide of the nucleotide sequence at least 80% homologous nucleic acid encoding of SEQ ID NO:1.In certain embodiments, therapeutical peptide can be antibody or its Fab, and it combines with CEMP-1 polypeptide reaction or specificity.

Another aspect of the invention is in order to treat first method that an individual tumors shifts.This method comprises determines individual need treatment metastases; One cell is provided, and this cell comprises a coding one and has the polypeptide of aminoacid sequence of SEQ IDNO:2 or the exogenous nucleic acid of its functional fragment; And allow expression in vivo one polypeptide of this cell in an individuality, and treat this individual metastases.

Another related fields of the present invention also are one in order to treat second method that an individual tumors shifts.This method comprises determines individual need treatment metastases; And send into a cell to this individuality, this cell comprises a coding one and has the polypeptide of aminoacid sequence of SEQ ID NO:2 or the exogenous nucleic acid of its functional fragment, and this cell is suitable for expressing the symptom that this polypeptide of q.s shifts with ameliorate tumor, and treats this individual metastases.

Another aspect of the present invention is the method that the tumour of a diagnosis one individuality is invaded potentiality or transfer.This method comprises the sample that an individuality is provided; The expression degree of CRMP-1 in the working sample; Comparative sample is expressed and a reference expression value; And the graded samples expression is lower than the individuality of this reference expression value for having tumour intrusion potentiality or transfer.Sample is expressed or reference expression is respectively the mRNA of assessment a large amount of (1) by a CRMP-1 transcribed nucleic acid; Or the polypeptide of (2) one CRMP-1.The polypeptide of this CRMP-1 can be detected, for example adopts antibody, as Y21 antibody.Present method also can be used for (1) monitoring one individual tumors therapeutic process; Or the metastases treatment situation of (2) monitoring one individuality.

The reference expression value can be arbitrarily or is relevant with a reference sample or a reference state.Reference sample can be the sample of one or more (1) normal individual; (2) sample of cell in vitro is as a tumor cell line, as adenocarcinoma of lung strain, a cell strain as described here; (3) by sample with the metastasis symptom and the individual gained of just treating; And the sample of (4) evaluated individuality, early stage sample or normal specimens that for example should individuality.During one course of treatment, this law more comprises before comparative sample CRMP-1 polypeptide level or CRMP-1 expression of nucleic acid level and this individual treatment or preceding sample levels takes place disease in monitoring.In certain embodiments, the expression of nucleic acid level of the polypeptide level of individual CRMP-1 or CRMP-1 is a decision interval (as the interval of rule) in therapeutic process.

The expression level of CRMP-1 gene product or mRNA can merely be measured by the expression level of 10,50,100 or 1000 other genes or gene product at least.For example No. the 60/300th, 991, Application No., application on June 26 calendar year 2001, and the expression level of promptly having described other gene is very useful for monitoring.

Another aspect of the invention is the method that a kind of qualification test compound is useful on prevention or treats metastases.Present method comprises following steps: with a cells contacting one test compound; And measure whether test compound has been adjusted CRMP-1 nucleic acid or CRMP-1 polypeptide expression in the cell.This test compound can be used as the antagonist of CRMP-1 polypeptide." antagonist " is meant a part herein, when its when peptide combines more than CRMP-1, can increase or prolong the process of CRMP-1 effect.

Test compound can be a giant molecule or small molecules, for example a part has molecular weight less than every mole about 10,000 gram, one organic or inorganic compound has molecular weight less than every mole about 5,000 gram, one organic or inorganic compound has molecular weight less than every mole of about 1,000 gram, and an organic or inorganic compound has molecular weight less than every mole of about 500 grams.Giant molecule for example comprises, polypeptide, protein complex, or nucleic acid (as DNA, RNA, or peptide nucleic acid(PNA)).Small molecules for example comprises, peptide, peptide analogs (as S class peptide), nucleic acid, nucleic acid analog, oligonucleotide, oligonucleotide analogs, Nucleotide, nucleotide analog, organic or inorganic compound (the organic or organometallic compound as allos).

Feature of the present invention also is the pharmaceutical compositions of a treatment metastases.Said composition comprises a medicament and a pharmaceutically acceptable carrier of an effective dose.This medicament can be peptide more than the CRMP-1, the nucleic acid of a CRMP-1, or the test compound of an adjustable CRMP-1 expression level, and wherein the expression of CRMP-1 is the nRNA of assessment a large amount of (1) by the CRMP-1 transcribed nucleic acid; Or the polypeptide of (2) CRMP-1.This pharmaceutical compositions can comprise one and transmit agent, for example liposome or virus vector.Said composition or transmission agent can be engaged in a tumour target site (tumor targeting moiety), for example antibody of an antitumor specific antigen.This feature is an antibody also, is incorporated into the polypeptide with SEQ ID NO:2.For example, this antibody can be antibody described herein, or its functional fragment, as a Fab.

Another aspect of the invention is a gene construct, it comprises the marker gene of a coding one labelled protein.This marker gene operability ground links with a CRMP-1 regulating and controlling sequence, as the CRMP-1 promotor.In one embodiment, this marker gene is one section that (in-frame) is blended in CRMP-1 encoding sequence at least in the framework.This construct can be used for a kind of method of the CRMP-1 of assessment genetic expression.This method comprises there is this labelled protein in a large number and/or not in cells contacting one test compound and an assessment that contains this gene construct.Feature of the present invention also is a host cell, and it comprises this gene construct, a cells of mamma animals for example, a lung carcinoma cell.

Category of the present invention also comprises the medicine that adopts aforementioned medicament to make a treatment metastases.

The detailed content of one or more embodiment of the present invention will be illustrated in down.Further feature of the present invention, purpose, and advantage will be more remarkable via this specification sheets and claim.

Embodiment

CRMP-1 a: metastasis related gene

One has clone's relevant cell strain modular system is set up by human lung adenocarcinoma cell's strain.This cell strain is as CL _1-0And inferior strain is (as CL _1-1With CL _1-5) have at external or intravital different infiltration capabilities.In order to differentiate the gene determinant relevant with metastases, adopt to have the mRNA expression level of the cDNA microarray of 9,600 different IPs acid probes with the characterization gene, and, then identify metastasis related gene.In the metastasis related gene that identifies, the expression level of CRMP-1 gene and gene product and lung cancer cell line infiltration capability retrocorrelation.CRMP-1 expresses more not extensive in the cell strain of more intrusion.Carry out Northern hybridization and Western blotting with anti-CRMP-1 monoclonal antibody specific, to confirm this retrocorrelation.The dependency of CRMP-1 expression and metastases adopts the research of real-time quantitative reverse transcription PCR more with some cancerous lung tissues.Make the CRMP-1 great expression alleviate the formation of cilium foot (filapodia) and suppress external infiltration capability with transfection method in a high intrusion sexual cell strain meeting.The CRMP-1 polypeptide be DYNAMIC DISTRIBUTION in cell, and can be positioned to divide spindle axle and centriole.CRMP-1 mRNA in the low expression of cancerous lung tissue be significantly with tumor development (III, IV phase), nodus lymphoideus transferring rate, early stage postoperative recurrence, and short survival rate is relevant.

The polypeptide of CRMP-1, nucleic acid, and CRMP-1 specific antibody

The polypeptide of CRMP-1 can be used for several different methods.For example, the polypeptide of CRMP-1 can be used for the substrate of screening CRMP-1 polypeptide, the active compound of screening regulation and control CRMP-1, and treatment is characterized as and reduces the active disease of CRMP-1, and some metastases at least for example is as lung cancer.

The polypeptide of CRMP-1 can adopt standard protein purification technique to separate by the cell or tissue source, for example with the recombinant dna expression technical combinations.The polypeptide of CRMP-1 can be expressed in an allos system, for example culturing cell or transgenic animal.When the allos system expression, can cause same with n cell in fact posttranslational modification.The sequence of CRMP-1 polypeptide can be different from sequence numbering: the sequence of SEQ ID NO:2, for example at least one but be less than 15,10, or the difference of 5 amino-acid residues.Perhaps, also be different from SEQID NO:2 sequence at least one residue but be less than 20%, 15%, 10% or 5% residue.This does not exist together and can be non-important residue or conservative substitution.

Conservative amino acid replacement refers to have the exchange of the residue of similar side chain.For example, one has aliphatic lateral chain amino acid group for glycine, L-Ala, Xie Ansuan, leucine, and Isoleucine; One has aliphatics-hydroxy side chain amino acid group is Serine and Threonine; One has amide containing side chain amino acid group is aspartic acid and glutamine; One has aromatic series side chain amino acid group is phenylalanine, tyrosine, and tryptophane; One has basic side chain amino acid group is Methionin, arginine, and Histidine; One has acid side-chain amino acid group is asparagine, L-glutamic acid, and Histidine; The one amino acid group with sulfur-containing side chain is halfcystine and methionine(Met).According to required, amino acid can exchange with group person.Some additional conservative amino acid substituted radical is: Val-Leu-Isoleucine; Phenylalanine-tyrosine; Methionin-arginine; L-Ala-Xie Ansuan; And aspartic acid-glutamine.

CRMP-1 nucleic acid can be used for, for example expresses on the genetics of CRMP-1 polypeptide (for example in the cell of host cell or organism) with detection CRMP-1 mRNAs (as in a biological sample) or CRMP-1 gene to change, and regulation and control CRMP-1 polypeptide active.CRMP-1 nucleic acid can comprise a fragment with as probe or primer and the part of detect or increase CRMP-1 nucleic acid or CRMP-1 fragment coding CRMP-1 polypeptide, for example immunogen of a CRMP-1 polypeptide or biologically-active moiety.This fragment can comprise a sequence corresponding to a district (domain), a zone (region), or a position of function.CRMP-1 probe and primer also can provide.Probe/primer is the oligonucleotide of isolated or purified traditionally.This oligonucleotide comprises a nucleotide sequence usually and can be under tight a beautiful gem condition has at least 7,12 with the sequence of the SEQ ID NO:1 of justice or antisense, or 15, or about 20,25,30,35,40,45,50,55,60,65, or the parts of 75 continuous nucleotide hybridization.CRMP-1 nucleic acid comprises the nucleic acid molecule of the nucleotide sequence that is different from SEQ ID NO:2.This species diversity may be the degeneration because of gene-code, and causes a coding that the nucleic acid of same CRMP-1 polypeptide is arranged.CRMP-1 nucleic acid has nucleotide sequence coded one and has the sequence at least 1 that aminoacid sequence is different from SEQ IDNO:2, but is less than 5,10,20, or the protein of 50 amino-acid residues.

CRMP-1 specific antibody or its fragment (as its Fab) can be used for detecting and separation of C RMP-1 polypeptide, regulate the biological utilisation of CRMP-1 polypeptide, and regulation and control CRMP-1 activity.So-called " antibody " is meant immunoglobulin molecules or its immunocompetence part, i.e. a Fab herein.So-called herein " immunoglobulin (Ig) " is meant that a protein comprises one or above polypeptide and encodes from immunoglobulin gene in fact.Known human immunoglobulin gene comprise κ, λ, α (IgAl and IgA2), γ (IgG1, IgG2, IgG3, IgG4), δ, ∈ and μ fixed position gene, and countless immunoglobulin (Ig) diversity region genes.

The CRMP-1 specific antibody can adopt known techniques production.This antibody can comprise, but is not limited to, many strains, and individual plant, chimeric, strand, Fab fragment, and the fragment that shows the storehouse generation by Fab.Anti-CRMP-1 monoclonal antibody can adopt any technology preparation of the antibody molecule generation of being cultivated by a successive cell strain.The example of these technology has hybridoma technology, human B cell hybridoma technology, EBV hybridoma technology (Kohleret al. (1975) Nature 256:495-497; Kozbor et al. (1985) J.Immunol.Methods 81:31-42; Cote et al. (1983) Proc.Natl.Acad.Sci.USA 80:2026-2030; Or Cole et al. (1984) Mol.Cell.Biol.62:109-120).In addition, also can utilize by " chimeric antibody " production technology development and the technology of coming, this technology be splicing mouse antibodies gene to human antibody gene to obtain having suitable antigen-specific and bioactive molecule (Morrison et al. (1984) Proc.Natl.Acad.SciUSA 81:6851-6855; Neuberger et al. (1984) Nature 312:604-608; Or Takeda et al. (1985) Nature 314:452-454).Perhaps, the technology that is used for the manufacture order chain antibody also is suitable for, and utilizes prior art method, to produce the CRMP-1 specific single-chain antibody.The CRMP-1 specific antibody can be by high specific wedding agent group (Orlandi et al. (1989) the Proc.Natl.Acad.Sci.USA 86:3833-3837 of the production of inductor endolymph cell mass or screening immunoglobulin (Ig) storehouse or document record; Or Winter et al. (1991) Nature 349:293-299).

In order to produce the CRMP-1 specific antibody, comprise goat, rabbit, rat, mouse, the mankind, and other etc. many host's injectable CRMP-1 polypeptide with immunity.According to host type, can adopt many different adjuvants to increase immune response.These adjuvants comprise, but be not limited to, the FreundShi method, mineral rubber such as aluminium hydroxide, and interfacial activity material such as molten Yelkin TTS, Pluronic polyols (pluronic polyols), polyanion, peptide, oil-emulsion, keyhole limpet hemocyanin (keyhole limpet hemocyanin), and dinitrophenol.The CRMP-1 specific antibody can be entirely human antibodies, for example has antibody that generation is made from the mouse of the antibody of human immunoglobulin sequence or non-human antibody with the genetically engineered processing, muroid (mouse or rat) for example, goat, primates (as monkey), camel antibody.The method that produces rodent antibody is all known techniques.Can reference, for example Wood et al. international application WO91/00906; Kucherlapatiet al.PCT application case WO 91/10741; Lonberg et al. international application WO 92/03918; Or Kay et al. international application 92/03917.The CRMP-1 specific antibody can be a diversity region, or its part producing is in an inhuman organism, for example rat or mouse.Antibody producing is behind inhuman organism, and for example rat or mouse can be modified, and for example in many backbones or FX, to decrease in the antigenicity among the mankind, these also all are contained in category of the present invention.

The CRMP-1 polypeptide of whole section sequence or the antigenic peptide fragment of CRMP-1 polypeptide can be used as immunogen or differentiate the CRMP-1 specific antibody that is caused by other immunogen, and other immunogen is as cell, membrane prepare etc.The antigenic peptide of CRMP-1 polypeptide comprises at least 8 amino-acid residues in the aminoacid sequence of SEQ ID NO:2, and comprises antigen decision a small bundle of straw, etc. for silkworms to spin cocoons on of CRMP-1 polypeptide.Antigenic peptide can comprise at least 10,15,20, or the amino-acid residue of 30 CRMP-1 polypeptide.

Methods of treatment

The CRMP-1 polypeptide can be used for gene therapy method has the analogue of CRMP-1 polypeptide or the nucleic acid of antagonist to transmit coding.The present invention is characterized as the interior transfection of body and expresses the expression vector of CRMP-1 polypeptide in a specific cells kind, so that rebuild the function of CRMP-1 polypeptide, perhaps its function of emulation in the not normal cell of this expression of polypeptides.CRMP-1 expression of polypeptides construct can any biological effective carrier throw with, for example anyly can effectively transmit prescription or the composition of CRMP-1 gene in vivo to cell.Expression construct can comprise nucleic acid sequence encoding has the CRMP-1 polypeptide functionally to be incorporated into an allogeneic promoter, brings out promotor as one.The gene therapy method can comprise bring out promotor inductor to this individuality.

The method of bestowing comprises inserts target gene in virus vector, comprises recombinant retrovirus, adenovirus, adeno-associated virus (AAV), and hsv-1, or recombinant bacteria or eucaryon plasmid.Virus vector direct transfection cell; Plasmid DNA can be by means of for example cationic lipid plasmid (lipofectin) or derivatize (as antibodies), and is poly-from the amino acid combination, carrier in the Gramacidin S, artificial viral mantle or other this class cell, and this gene construct of direct injection or with CaPO ₄The precipitator method are carried out in body.

Introducing CRMP-1 nucleic acid to the method for cell can adopt one to contain nucleic acid in the body, as the virus vector of cDNA, and this cDNA coding CRMP-1 polypeptide.The target cell that has a height ratio with the viral vector infection cell can be accepted the advantage of this nucleic acid.In addition, coding molecule in the virus vector for example by containing the cDNA virus vector, can be expressed in the cell of the nucleic acid of possessing virus vector efficiently.

Retroviral vector and adeno-associated virus (AAV) carrier can be used for the recombination transfer system, to transmit foreign gene in body, particularly the mankind.These carriers provide effective ground because of going into the transmission of cell, and the nucleic acid of transfer can stably embed host's chromosomal DNA.The development of special cell strain (being called " packing cell (Packaging cells) ") only produces duplicates-the defective retrovirus, this virus increases the usability that retrovirus is used for gene therapy, and defective is retroviral to be characterized as the transgenosis (can be with reference to Miller, A.D. (1990) Blood 76:271) that is used for the gene therapy purpose.The replication defective retrovirus can adopt the standard method by helper virus to be packaged into virosome to be used for target cell infection.Produce recombinant retrovirus and be used to external or body in cells infected can be with reference to Current Protocols in MolecularBiology, Ausubel, F.H.et al. (eds.) Greene Publishing Association, (1989), Section9.10-9.14 and other standard laboratory handbook.The retrovirus example that is fit to comprises ripe in this skill personage known pLJ, pZIP, pWE and pEM.Be suitable for preparing and have close environment concurrently or both packaging virus strain example of parent comprises yCrip, yCre, y2 and yAm.Retrovirus has been used to import several genes and has entered many different cell kenels, comprises epidermic cell, external with and/or body in (please refer to Eglitis, et al. (1985) Science 230:1395-1398; Danos and Mulligan (1988) Proc.Natl.Acad.Sci.USA 85:6460-6464; Wilson et al. (1988) Proc.Natl.Acad.SciUSA 85:3014-3018; Armentano et al. (1990) Proc.Natl.Acad.Sci.USA 87:6141-6145; Huber et al. (1991) Proc.Natl.Acad.Sci.USA 88:8039-8043; Ferry etal. (1991) Proc.Natl.Acad.Sci.USA 88:8377-8381; Chowdhury et al. (1991) Science 254:1802-1805; Van Beusechem et al. (1992) Proc.Natl.Acad.Sci.USA89:7640-7644; Kay et al. (1992) Human Gene Therapy 3:641-647; Dai et al. (1992) Proc.Natl.Acad.Sci.USA 89:10892-10895; Hwu et al. (1993) J Immunol.150:4104-4115; 4,868, No. 116 of United States Patent (USP); United States Patent (USP) the 4th, 980, No. 286; PCT applies for WO No. 89/07136; PCT applies for WO No. 89/02468; PCT applies for WO No. 89/05345; And ask WO among the PCT No. 92/07573).

Another useful virogene transfer system comprises the carrier in adenovirus source.The genome of adenovirus is operable as coding and expresses required gene product but can keep not activated form and duplicate in the normal molten cell virus lifetime.Please refer to Berkner et al. (1988) Bio Techniques 6:616; Rosenfeld et al. (1991) Science 252:431-434; And Rosenfeld et al. (1992) Cell 68:143-155.The adenovirus carrier that is fit to be ripe in this skill personage well known for coming from adenopathy strain Ad type 5 d1324 or other adenopathy strain (for example Ad2, Ad3, Ad7 etc.).Recombinant adenovirus has and can not infect Unseparated Cell under some situation and can be used for infecting many cell kenels, comprises the epidermic cell advantage of (Rosenfeld et al. (1992) as described above).And therefore this virus particle quite stable is suitable for purifying and concentrates, and as above-mentioned can the modification to change its infection scope.In addition, import adenovirus DNA (foreign DNA that comprises with it) and can't embed host genome, but exist, thereby the potential problems of avoiding importing DNA embedding host genome (for example retrovirus DNA) and the sudden change of original position imbedibility may taking place with the form of gene episome (episomal).Person very, the capacity that the adenoviral gene group is carried foreign DNA with respect to other gene import system big (can reach 8,000 bases) (Berkber et al. as described above; Haj-Ahmand and Graham (1986) J.Virol.57:267).

Another virus carrier system that is fit to carry the CRMP-1 gene is adeno-associated virus (AAV) (AAV).Adeno-associated virus (AAV) is abiogenous defective virus, it needs other virus, and for example adenovirus or helper virus are effectively duplicated and productive life cycle (please refer to Muzyczka etal. (1992) Curr.Topics in Micro.And Immunol.158:97-129) to reach as helper virus.This also is that minority can embed one of its DNA virus to the somatoblast not, and shows that the stable imbedibility of high frequency (please refer to Flotte et al. (1992) Am.J.Respir.Cell.Mol.Biol.7:349-356; Samulski et al. (1989) J.Virol.63:9822-9828; And McLaughlin et al. (1989) J.Virol.62:1963-1973).Have to lack and still can pack and embed to the AAV carrier of 300 base pairs.The space constraint of foreign DNA is about 4.5kb.The AAV carrier can be used to import DNA to cell as person as described in Tratschin et al. (1985) Mol.Cell.Biol.5:3251-3260.Multiple nucleic acid has been used the AAV carrier and has imported different cell kenels and (please refer to Hermonat et al. (1984) Proc.Natl.Acad.Sci.USA 81:6466-6470; Tratschin et al. (1985) Mol.Cell.Biol.4:2072-2081; Wondisford et al. (1988) Mol.Endocrinol.2:32-39; Tratschin et al. (1984) J.Virol.51:611-619; And Flotte et al. (1993) J.Biol.Chem.268:3781-3790).

Except above-mentioned virus vector method, also can adopt non-viral method to express the CRMP-1 polypeptide in animal tissues.Major part non-viral gene cloning process system is used for taking in based on Mammals and iuntercellular shifts macromolecular normal mechanism.In certain embodiments, non-viral gene transfer system of the present invention depends on the cell endocytic approach and makes target cell absorption CRMP-1 nucleic acid.The example of these gene import systems comprises the system in liposome source, poly-bad amino acid combination, and artificial viral mantle.Other embodiment comprises the plasmid injected system, once is described in Meuli et al. (2001) J Invest Dermatol.116 (1): 131-135; Cohen et al. (2000) Gene Ther 7 (22): 1896-905; Or Tam et al. (2000) GeneTher 7 (21): 1867-74.

Represent among the embodiment one, the nucleic acid of coding CRMP-1 polypeptide can be retained in the liposome (for example lipofectin) of surperficial nominal price, and (in case of necessity) is with antibody labeling (Mizuno etal. (1992) the No Shinkei Geka 20:547-551 of anti-target tissue cell-surface antigens; PCT discloses WO91/06309 number; No. the 1047381st, Japanese patent application; And European patent discloses EP-A-43075 number).

When clinical the setting, therapeutic CRMP-1 nucleic acid gene transfer system can adopt any method to import sufferer, and all methods are all known.For example, the pharmacy preparation of gene transfer system can import general, as intravenous injection, and carry out specific proteins transduction (transduction) at the significant target cell of transfection specificity that transmits carrier for gene and provide, it is because transcriptional regulatory sequences control acceptor gene is expressed that cell kenel or organizational patterns are expressed, or its reorganization.Implement kenel in other, the initial transmission of recombination can more be subjected to importing the position of animal and limit.For example, gene transmission carrier can import (please refer to United States Patent (USP) the 5th, 328, No. 470) or import (Chen et al. (1994) PNAS 91:3054-3057) with the solid injection by conduit.

The pharmacy preparation of gene therapy construct mainly is contained in the gene transfer system that can accept in the thinner, or comprises the sustained-release matrix that is embedded with gene transmission carrier.Perhaps, as long as complete gene transfer system can be produced smoothly by reconstitution cell, reverse transcription carrier for example, this pharmacy preparation can comprise the one or more cells that can produce these gene transfer systems.

Diagnostic method

The present invention also provides intrusion potentiality or the metastatic method of a kind of diagnosing tumour at an individuality.Present method also can be used for the therapeutic process of (1) monitoring one individuality; Perhaps (2) assessment one is suspected or known individuality with tumor disease.

Present method comprises by an individual sample (as biopsy, blood, or other tissue sample) that obtains; CRMP-1 expression level in the working sample; Comparative sample is expressed and the reference expression value; And classification is individual for having tumour intrusion potentiality or transitivity when the sample expression is lower than the reference expression value.Each sample is expressed or reference expression is the mRNA of assessment a large amount of (1) by the CRMP-1 transcribed nucleic acid; Or (2) CRMP-1 polypeptide.Sample comprises by the isolating tissue of individuality, cell and biological liquid, and be present in intraindividual tissue, cell and liquid.One of sample example is a serum.

The CRMP-1 gene expression dose can be by the mRNA horizontal survey corresponding to CRMP-1 gene in the cell.This measurement can be by original position and in vitro tests decision, for example hybridization or amplification test, and it comprises, but is not limited to, and Northern analyzes, polymerase chain reaction and probe array.Detect one of mRNA level diagnostic method and involve this mRNA of contact and the nucleic acid probe that can hybridize with the genes encoding mRNA that institute's desire detects.Nucleic acid probe can be for the CRMP-1 nucleic acid as total length, as the sequence of SEQ ID NO:1, or its part, as have at least 7,15,30,50,100,250 or 500 length of nucleotides and be enough under tight a beautiful gem condition specific hybrid to the oligonucleotide of CRMP-1 mRNA or genomic dna.This probe can be deposited on an array address.Other probe that is suitable for this diagnostic test is described as follows.In a kenel (as the Northern blotting), mRNA (or cDNA) is fixed in a surface and contact probe, for example carries out separating mRNA and is shifted on this mRNA to one film, as nitrocellulose by gel in sepharose.In another kenel, probe stationary is in a surface and mRNA (or cDNA, as the cDNA of mark) contact probe, for example in following two-dimentional gene chip array.Ripely can adopt known mRNA detection method to be used to detect the mRNA amount of coding CRMP-1 gene in this skill person.

The mRNA amount also can be assessed by nucleic acid amplification in one sample, for example by rtPCR (Mullis (1987) United States Patent (USP) the 4th, 683, No. 202), joining enzyme chain reaction (Barany (1991) Proc.Natl.Acad.Sci.USA 88:189-193), support sequence replicating (Guatelli et al. (1990) Proc.Natl.Acad.Sci.USA 87:1874-1878) from body, (the Kwoh et al. (1989) of transcription amplification system, Proc.Natl.Acad.Sci.USA 86:1173-1177), Q-Beta duplicates (Lizardi et al. (1988) Bio/Technology 6:1197), circle replication (rolling circle replication rolls, Lizardi et al. United States Patent (USP) the 5th, 854, No. 033) or any other nucleic acid amplification method, then can adopt known techniques to detect the molecule of amplification.The amplimer that adopt in this place is to be defined as (to be respectively normal chain and minus strand to a gene; The a pair of nucleic acid molecule of 5 ' to 3 ' regional annealing or on the contrary), and the weak point that comprises therebetween is regional.Generally speaking, amplimer is made up of 10 to 30 length of nucleotides, and crosses over about 50 to 200 length of nucleotides.Under felicity condition and suitable reagent, these primers allow amplified nucleic acid molecules to comprise the nucleotide sequence that primer is crossed over.

There is several different methods to can be used for measuring the amount of CRMP-1 polypeptide.Generally speaking, these methods comprise contact one alternative and are bonded to the reagent of CRMP-1 polypeptide, and the antibody in the sample for example is with the amount of polypeptide in the assessment sample.Antibody can connect detectable mark.So-called herein " mark " refer to for probe or antibody, prepare connecting (and physical property links) detectable substance to antibody or probe and as directly label probe or antibody, and to react indirect labelling probe or antibody with a detectable substance.

Can adopt detection method with the CRMP-1 polypeptide in the test sample in external or body.Method at vitro detection CRMP-1 polypeptide comprises enzyme linked immunosorbent assay (ELISAs), immunosedimentation test, immunofluorescence technique, enzyme immunity test (EIA), radioimmunoassay (RIA), and Western engram analysis.The method that detects the CRMP-1 polypeptide in vivo comprises CRMP-1 specific antibody to an individuality that imports a mark.For example, antibody can be demarcated substance markers with radioactivity, and existence and the position of this demarcation thing in individuality can be detected by the standard imaging technique.In another embodiment, sample is labeled, and contacts as biotinylation and with antibody.Sample can be detected, for example to have a fluorescently-labeled avidin.

In the method, cell or tissue can prepare/handle and be fixed on the upholder in position, and normally slide then contacts with the probe that can hybridize the coding CRMP-1 gene mRNA that will analyze.Diagnosis can more comprise compound or reagent that a control sample and can be detected CRMP-1 mRNA or genomic dna with prognostic assay and contact, and CRMP-1 mRNA or genomic dna amount in CRMP-1 mRNA or genomic dna amount and the test group sample in the compare group sample.The serial analysis of genetic expression, as United States Patent (USP) the 5th, 695, No. 937 described, also can be used to detect CRMP-1 transcript level.

The screening test compound

The invention provides a kind of method of qualification test compound, test compound is material standed for or reagent, adjustable CRMP-1 nucleic acid or CRMP-1 polypeptide expression level.

Test compound can adopt the mode of any known combination data base method to obtain, and comprises: biometric database; The class peptide database (the molecular data storehouse, it is functional that its molecule has peptide, but but have novel non-peptidic backbone and antienzyme degraded and biologically active still please refer to Zuckermann et al. (1994) J.Med.Chem.37:2678-85); Sterically defined parallel solid-state or liquid database; Need go the generated data storehouse method of circling round; " particle one compound " data base method; And the generated data storehouse method that adopts the affinity chromatographic analysis to select.Biometric database and class peptide database method are limited to peptide database, yet other four kinds of methods can be applicable to peptide, non-peptide oligomer or compound small molecules database (Lam (1997) AnticancerDrug Des.12:145).

The example of the synthetic method in molecular data storehouse is a known techniques, for example can be with reference to DeWitt et al. (1993) Proc.Natl.Acad.Sci.USA 90:6909; Erb et al. (1994) Proc.Natl.Acad.Sci USA91:11422; Zuckermann et al. (1994) J.Med.Chem.37:2678; Cho et al. (1993) Science 261:1303; Carrell et al. (1994) Angew.Chem.Int.Ed.Engl.33:2059; Carell er al. (1994) Angew.Chem.Int.Engl.33:2061; And Gallop et al. (1994) J.Med.Chem.37:1233.

Compound database can be shown in solution (as Houghten (1992) Biotechniques13:412-421), on particle (Lam (1991) Nature 354:82-84), on the chip (Fodor (1993) Nature 364:555-556), on the bacterium, (Ladner, United States Patent (USP) the 5th, 223, No. 409), (Ladner, United States Patent (USP) the 5th, 223 on the spore, No. 409), (Scott and Smith (1990) Science 249:386-390 on (Cull et al. (1992) Proc.Natl.Acad.Sci.USA 89:1865-1869) or the phage on the plasmid; Devlin (1990) Science 249:404-406; Cwirla et al. (1990) Proc.Natl.Acad.Sci.87:6378-6382; Felici (1991) J.Mol.Biol.222:301-310; Ladner such as above-mentioned).The example of combinatorial chemistry database comprises, but is not limited to, and peptide database (please refer to United States Patent (USP) the 5th, 010, No. 175, Furka, Int.J.Pept.Prot.Res.37:487-493 (1991) and Houghton et al.Nature 354:84-88 (1991)).Other chemical process that produces the changeable database of compound also can adopt.These chemical processes comprise, but be not limited to: class peptide (PCT discloses WO91/19735 number), encoded peptide (PCT discloses WO93/20242 number), biological at random oligomer (PCT discloses WO92/00091 number), benzene chloromethane phenyl benzene di-nitrogen humulone (benzodiazepines United States Patent (USP) the 5th, 288, No. 514), many bodies benzene chloromethane phenyl benzene di-nitrogen humulone and dipeptides (Hobbs et al. (1993) Proc.Natl.Acad.Sci.USA 90:6906-6913), vinyl polypeptide (Hagihara et al. (1992) J.Amer.Chem.Soc.114:6568), the non-peptide that has the glucose framework, peptide simulacrumy (Hirschmann et al. (1992) J.Amer.Chem.Soc.114:9217-9218), the small molecules database of similar organic synthesis (Chen et al. (1994) J Amer.Chem.Soc.116:2661), few amino-carbon hydrochlorate (Cho et al. (1993) Science 261:1303), with and/or peptide phosphoric acid salt (Campbell et al. (1994) J.Org.Chem.59:658), nucleic acid database (please refer to Ausubel, Berger and Sambrook such as above-mentioned), the peptide nucleic acid(PNA) database (please refer to as United States Patent (USP) the 5th, 539, No. 083), the antibody database (please refer to as Vaughn et al. (1996) NatureBiotechnology 14 (3): 309-314, with PCT/US96/10287), the carbohydrate database (please refer to as Liang et al. (1996) Science 274:1520-1522 and United States Patent (USP) the 5th, 593, No. 853), little organic molecule database (please refer to as benzene chloromethane phenyl benzene di-nitrogen humulone, Baum C﹠amp; EN, Jan 18, Page33 (1993); The class iso pentane two floride, United States Patent (USP) the 5th, 569, No. 588; Thiazolidone and metathiazole ketone, United States Patent (USP) the 5th, 549, No. 974; Pyrrolidone, United States Patent (USP) the 5th, 525, No. 735 and the 5th, 519, No. 134; The woods compound, United States Patent (USP) the 5th, 506, No. 337; Benzene chloromethane phenyl benzene di-nitrogen humulone, the 5th, 288, No. 514 etc.).

Test compound regulation and control CRMP-1 expression of nucleic acid can be identified.For example, cell or acellular mixture contact with test compound, and contact with CRMP-1 mRNA or polypeptide expression with respect to the expression level of the CRMP-1 mRNA of no test compound or polypeptide.When CRMP-1 mRNA or polypeptide expression during greater than non-existent situation, confirm that this test compound is the stimulator of CRMP-1 mRNA or polypeptide expression in the situation that has test compound.On the contrary, the situation that has a test compound when CRMP-1 mRNA or polypeptide expression less than (as on adding up significantly less than) during non-existent situation, confirm that this candidate compound is the inhibition of CRMP-1 mRNA or polypeptide expression.CRMP-1 mRNA or polypeptide expression can be measured by aforementioned " diagnostic method ".

Test compound regulation and control CRMP-1 polypeptide is incorporated into acceptor, as the CRMP-1 acceptor, ability can be determined.This can be finished by the acceptor that for example has radio isotope or enzyme labelling, can be learnt by the mark that detects mixture as bind receptor to CRMP-1 polypeptide.On the contrary, also can be undertaken by the ability that test compound regulation and control CRMP-1 polypeptide in the CRMP-1 polypeptide monitoring mixture that has radio isotope or enzyme labelling is bonded to the CRMP-1 polypeptide receptor.For example, acceptor can ¹²⁵I, ³⁵S, ¹⁴C or ³H mark, or directly or indirectly, and radio isotope is to be excited or scintillation counting (scintillation counting) and detecting by the direct census radiation.Or test compound is with enzyme labelling, for example with horseradish peroxidase, and alkaline phosphatase, or worm luciferase, and become product to carry out the mensuration of enzyme labelling to transform suitable acceptor.

Test compound and the reaction of CRMP-1 polypeptide can be not evaluated with the ability of any labeling reaction reaction.For example, the reaction of test compound and CRMP-1 polypeptide can be adopted fluorescent energy conversion (FET) to detect (to please refer to as No. the 5th, 631,169, Lakowicz et al. United States Patent (USP); No. the 4th, 868,103, Staviranopoulos et al. United States Patent (USP)).It is to select freely that its fluorescence excitation energy will can produce fluorescence behind recipient's molecular absorption energy by a fluorescent mark in second " recipient " molecular absorption that one fluorescent substance is marked on first " person of bestowing " molecule.Selective marker is exciting different wavelengths of light, and for example " recipient " molecule marker can be differentiated with " person of bestowing " molecule.Because energy transformation usefulness is the distance that is relevant to molecular separation between mark, the spatial relation of molecule is with evaluated.FET can measure (as adopting luminoscope) with known standard fluorescence surveying instrument expediently in conjunction with the result.The reaction of test compound and CRMP-1 polypeptide can be adopted real-time biomolecular reaction analysis (Biomolecular Interaction Analysis, BIA) carrying out (can be with reference to as Sjolander, S andUrbaniczky, C (1991) Anal.Chem.63:2338-234 and Szabo et al. (1995) Curr.Opin.Struct.Biol.5:699-705)." surperficial plasmon resonance (surface plasmonresonance) " or " BIA " be the detection of biological specific reaction in real time, and without any reactant of mark (as BIA nuclear).The quality change (in conjunction with result's pointer) of mating surface has changed the luminous reflectance index (the suitableeest phenomenon of surperficial plasmon resonance (SPR)) near the surface, has produced the detected message of the pointer that can be used as the biomolecules real time reaction.

The method of qualification test compound is fit in conjunction with above-mentioned two or more tests, and identifies new compound with above-mentioned screening method.Therefore, compounds identified described herein (is the CRMP-1 regulating compound, reverse CRMP-1 nucleic acid molecule, CRMP-1 specific antibody, or CRMP-1 uniting gamete), confirm this compound efficacy in suitable zootype, toxicity, side effect, or reaction mechanism, or adopt this compounds for treating, also be contained in the present invention's category.In addition, the new compound that identifies with above-mentioned screening test can be used for treatment described herein.

And also may identify and to be incorporated into CRMP-1 nucleic acid, as be incorporated into the CRMP-1 non-coding region or the CRMP-1 coding region (is gene library NT 006051 sequence, it comprises the CRMP-1 gene, just between Nucleotide 559971..635062 or Nucleotide 540000..640000), chimeric, artificial zinc refer to (zincfinger) albumen.And can produce and comprise multiple zinc finger protein partial data storehouse.Can be with reference to Rebar et al. (1996) Methods Enzymol 267:129; Greisman and Pabo (1997) Science 275:657; Isalan et al. (2001) Nat.Biotechnol.19:656; And Wu et al. (1995) Proc.Nal.Acad.Sci.USA 92:344.

Also may prepare one or above chimeric zinc finger DNA land, for example in external selection (as adopting the phage expression method) or based on the design (as WO00/42219) of recognizing coding.Zinc finger protein can merge to transcriptional activity part transcribing with activation CRMP-1.Zinc finger protein itself also the white heterologous nucleic acids of codified to bring cell in.Be incorporated into inducible promoters to the sequence operability of encoding zinc finger protein, for example guarantee the preferable controlled levels of zinc finger protein in the cell.

High yield screening method

High yield screening method can be used for the large database of screening chemical substance.Such candidate compound can be produced or for example by Chembridge Corp., San Diego, and CA buys.Database can be designed to comprise the compound of changeable scope.For example, a database can comprise 10,000,50,000 or 100,000 or how different compound.Only narrate this method herein, one database can comprise pyridine, indoles, quinoline, furans, pyrimidine, triazole (triazines), pyrroles, imidazole, naphthalene, benzoglyoxaline, piperidines, pyrazoles, benzene azoles, tetramethyleneimine (pyrrolidines), thiophene phenol, thiazole, benzothiazole and morpholine by different ring construction.Perhaps, test before can infer that with multiple evidence an a group or a class tool strengthen the compound of potentiality.One database can design and synthesize the compound that comprises such same clan.

By pattern cell strain (CL for example _1-0Strain inferior such as CL with it _1-1With CL _1-5) cell that shifts, or can be used for the screening of high yield medicine by the cell that the neoplastic disease loyalty obtains.For example, cell can grow in microwell plate, as 6 holes, 32 holes, 64 holes, 96 holes, 384 orifice plates.The high-density microwell plate can be by polymkeric substance, as polydimethyl silane (as the Sylgard 384 of Dow-Corning company) and vinylformic acid moulding.This mold comprises the hole of grown cell, and compound can be allocated in this hole.For example, a mold contains the hole of 1536 capacity 2 μ L, or the hole of 6144 capacity 250nL.A plurality of test compounds or aforementioned data storehouse can be by screenings.Database can provide a layout that can be modified to robot manipulation's form, for example in microwell plate.Compound can add in the cell of microwell plate.After compound adds, the cell cultures specified time.Then, monitoring expression level.

Test compound also can be gathered, and tests this set.The positive reaction set can separately continue to analyze.No matter which kind of method, the compound that can change the CRMP-1 gene expression dose just is regarded as " candidate " compound or medicine.Candidate compound can be tested in transitional cell as above-mentioned again.Candidate compound again the test still positive reactor be regarded as " guide " compound.

In case identify a lead compound, can adopt the pharmaceutical chemistry standard program to produce the derivative of this compound.Derivative can screening go out to have to promote pharmacy characteristic person, for example effect, pharmacokinetics, stability, solubleness and clearance rate.The structure that compound activity part can be known in the afore-mentioned test active relevant (structure-activity relationships, SAR) test affirmation.Ripely can modify the active part of lead compound and measure modify influence to the effect of compound to produce the derivative that strengthens effect in pharmaceutical chemistry person.For example, please refer to Nagarajan et al. (1988) J.Antibiot.41:1430-8.Modification can comprise N-acylation, amination, amidation, oxygenizement, reductive action, alkanisation, esterification and hydrocarbonylation effect.In addition, when the biological chemistry target position of confirming lead compound, the structure of target position and lead compound can provide the information of design with the optimizing derivative.Molecular pattern software is market obtainable (as molecule emulation company).

Pharmaceutical compositions

The invention provides a treatment one, to have the danger (or susceptibility) of metastases individual or treat a pharmaceutical compositions with individuality of metastases.What is called " treatment " is defined as and implements or bestow medicament to an individuality herein, or implement or bestow the chorista or the cell strain of medicament to a sufferer, this sufferer has the symptom of a disease, a disease or easily dyes the physique of a disease, and the purpose of treatment is to cure, recover, alleviate, remove, change, remedy, improve, promote or influence the symptom or the susceptive disease possibility of disease, disease.One medicament comprises, but is not limited to, CRMP-1 polypeptide, CRMP-1 nucleic acid or adjustable or influence the test compound of CRMP-1 nucleic acid or CRMP-1 polypeptide.

One pharmaceutical compositions comprises an aforementioned medicament and a pharmaceutically acceptable carrier.So-called herein " pharmaceutically acceptable carrier " comprises solvent, disperses media, coating, antibacterial agent and antiseptic-germicide, waits to open with the delayed absorption agent etc., bestows mode and decides according to pharmacy.The auxiliary activity compound also can be incorporated in the composition.

One medicament can be modulated to be suitable for desire the form of the approach of bestowing.The example of bestowing approach comprises non-oral administration, as vein, intracutaneous, subcutaneous injection, oral (as suck), through skin (as the part), per mucous membrane and rectal administration.Be modulated into these dosage forms of bestowing approach and can adopt traditional method.For example, a medicament can be modulated into capsule, glue envelope or lozenge so that oral administration.Capsule can comprise on any standard pharmaceutical can accept material, for example gelatin or Mierocrystalline cellulose.Lozenge can be modulated according to traditional method, comprises the mixture and a solid-state carrier and the lubricant that compress a medicament.The example of solid-state carrier comprises starch and sugared bentonite.One medicament also can duricrust lozenge or capsule form give, it comprises a cakingagent, as lactose or seminose, a traditional weighting agent, and a binder.

Pharmaceutical compositions can non-per os approach, it is oral, local, subcutaneous to comprise, abdominal cavity, muscle and intravenously administrable.The example of non-per os dosage form comprise the aqueous solution, etc. ooze 5% glucose or other known pharmaceutically acceptable vehicle of physiological saline or active agents.But but menstruum can be used for pharmaceutical excipient to transmit healing potion as ring dextran or other ripe menstruum of knowing in this skill person.

The toxicity of one medicament and therapeutic efficiency can be measured by the standard pharmacological method in cell cultures or laboratory animal, for example measure LD ₅₀(to 50% lethal dose in the group) and ED ₅₀(to 50% treatment effective dose in the group).Toxicity is the treatment pointer with therapeutic efficiency dosage ratio, and can be expressed as LD ₅₀/ ED ₅₀The high treatment of compound exhibits pointer is preferable medicament.Medicament shows that toxic side effects person still can adopt, and with system this medicine can be positioned to be subjected to the sense tissue but should be noted that design is thrown, and reduce not feeling the latent lesion of cell, thereby lower side effect.

The data that obtained by cell culture test and animal experiment can be used for modulating the dosage range that is used for human body.The dosage of medicament is preferably based on circulation composition and falls within a scope, comprises ED ₅₀Have trace or nontoxicity.Dosage can change based on dosage form that is adopted and route of administration in this scope.For being used for any medicament of the present invention, the treatment effective dose can begin estimation by cell culture test.One dosage is adjustable to be reached the circulating plasma concentration range as for zootype and comprises as the IC in the cell cultures ₅₀(being that test compound concentration reaches half amount that symptom suppresses).Such information can be used for more accurate decision human body effective dose.Can measure content in the blood plasma, for example measure with high-effect liquid chromatography (LC).

So place definition, the treatment effective dose of polypeptide (being effective dose) scope be between about 0.001 to 30mg/kg body weight, about 0.01 to 25mg/kg body weight, about 0.1 to 20mg/kg body weight, or about 1 to 10mg/kg, and 2 to 9mg/kg, 3 to 8mg/kg, and 4 to 7mg/kg, or 5 to 6mg/kg body weight.Ripely will understand some factor in this skill person and may influence effective treatment individual required dosage and time, including but not limited to disease or uncomfortable severity, treatment before, individual health degree and age, and the existence of other disease.

For antibody, preferable dosage is 0.1mg.kg body weight (being generally 10mg/kg to 20mg/kg).If antibody is to act on brain, adopt the dosage of 50mg/kg to 100mg/kg usually.Generally speaking, partly human body antibody has the transformation period long than other antibody with complete human body antibody in human body.Therefore, may often dosage need be reduced and frequency is bestowed in minimizing.Modification as lipoprotein function can be used for stabilization of antibodies and enhancing absorption and organizes invasive (as entering brain).The method of antibody lipoprotein function is as (Cruikshank et al. (1997) J.Acquired Immune Deficiency Syndromes and HumanRetrovirology 14:193) as described in the people such as Cruikshank.

The present invention includes adjustable CRMP-1 nucleic acid or CRMP-1 polypeptide expression or active compound.One medicament can for as a small molecules.The example of dosage comprises per kilogram individuality or example weight and bestows the small molecules of milligram (milligram) or microgram (microgram) dosage (just about per kilogram 1 microgram to 500 milligram, about per kilogram 100 micrograms to 5 milligram, or about per kilogram 1 microgram is to 50 micrograms).In addition, apprehensible is that suitable dosage small molecules is based on micromolecular intensity and expression and the activity level that will regulate and control.When one or above these small molecules are administered to an animal (as the mankind) with regulation and control polypeptide of the present invention or expression of nucleic acids or when active, the suitable low dosage of can writing out a prescription when a clinicist, animal doctor or investigator begin continues increase dosage up to reaching appropriate reaction.In addition, be appreciated that given dose knows from experience based on the multiple factor any particular animals, the activity that comprises the specific compound that adopts, individual age, body weight, general health state, sex and diet, and bestow the time, bestow approach, discharge rate, any medicine that is used in combination, and the expression that will regulate and control or activity level.

The indication of pharmaceutical compositions administration can comprise a container, packing or dispersion agent together.

Following specific embodiment does not limit of the present invention open as illustrative purposes only.Need not add to describe in detail, should recognize that ripe working as in this skill personage can be based on of the present invention open, infiltration and development the present invention.Disclosed herein delivers, and comprises patent, is included in the integral body of bibliography.

Embodiment

Method

Cell strain and culture condition

Human lung adenocarcinoma cell's strain CL _1-0, CL _1-1, CL _1-5, and CL _1-5-F ₄Be be incubated at the RPMI-1640 substratum (GIBCO-BRL, Gaithersburg, MD) with 10% foetal calf serum (GIBCO-BRL, Gaithersburg, MD) and 2mM L-L-GLUTAMICACID acid amides (GIBCO-BRL, Gaithersburg, MD), and in 37 ℃, 20%O ₂With 5%CO ₂In.

CL _1-0Be maternal plant; CL _1-1With CL _1-5For coating Matrigel (CollaborativeBiomedical with the PC film, Becton Dickinson, Bedford, MA) external selection, in penetrating hole invasive chamber (Transwell invasion chamber, Chu et al. (1997) Am J Respir Cell Mol Biol 17:353-60), by CL _1-0The inferior strain of selecting out.CL _1-5Cell injects the tail vein of serious comprehensive immunological incompetence mouse, follows the tumour separation that is formed by this mouse lung and clones a cell strain.After in four repeat bodies, selecting, cell strain called after CL _1-5-F ₄(Sigma, Deisenhofen Germany) are separated by culture dish the cell that adheres to trypsinase/EDTA.Before functional trial, handle destroyed with 0.02%EDTA earlier to prevent cell-surface antigens.

Microarray analysis

The microarray test is to carry out on a nylon membrane with 9600 character array, as chroma detection methods that the people adopted such as Chen.Please refer to Chen et al. (1998) Genomics 51:313-24; And Hong etal. (2000) Am J Respir Cell Mol Biol 23:355-63.Briefly, each cell strain growth to 80% full and renew 24 hours of bright substratum in culturing cell after extract mRNA.Can lower the time of cell being shifted out incubator and molten born of the same parents like this.With modified guanidine thiocyanic acid-phenol-chloroform extracting method, and employing RNAzol B (Biotecx Laboraories, Houston, Texas), by the total cell RNA of cell extraction.MRNA adopts the oligotex-dT resin, and (Qiagen, Hilden Germany) extract.To obtain the mRNA reverse transcription of 5 μ g and with biotin labeling by each lung cancer cell line.The film that carries double-stranded complementary DNA (cDNA) target is with 7mL hybridization buffer (5X SSC, 0.1%N-lauroylsacosine, 0.1%SDS, the made closed reagent mixed solution of 1% Luo Shi molecular chemistry, and 50 μ g/mL salmon sperm dna), carried out preceding hybridization in last hour in 68 ℃ of hybridization.Containing human COT-1 DNA replaces the 80 μ L hybridization solutions and the cDNA probe of salmon sperm dna to be encapsulated in a hybridization bag with a microarray.Behind the hybridization, this film hatch in 1mL contain 700X dilution STREP-GAL (1.38U/mL enzymic activity) (GIBCO-BRL), 4% polyoxyethylene glycol 8000 (Sigma), be dissolved in the mixture 2 hours of 1X TBS damping fluid with 0.3%BSA.Color reaction is then ended with the 1X PBS that contains 20mM EDTA.Quantitatively carry out with the MuCDA program, this program can be write certainly or be obtained by Academia Sinica (Taibei, Taiwan).This program is separated different expressing genes to measure the every bit integral density, carries out the regression analysis of integral density data, and the location is added up upward, and the segregator is different expressing genes.

Molecular cloning and plasmid construction

(Gibco-BRL, Rockville Maryland) carry out the reverse transcription of RNA with six poly-primers at random to adopt Superscript II RTase.Encode the cDNA of whole section human CRMP-1 (gene library is logined D78012 number) coding region by CL _1-0CDNA through pcr amplification.Primer sequence is as follows: 5 ' primer: 5 '-CTCCGTCCGTGTCTCTATCC-3 ' (SEQ ID NO::3,24-43 the Nucleotide of D78012); And 3 ' primer: 5 '-CCTCCATCAGCACCAACTAAA-3 ' (SEQ ID NO:4,1955-1975 the Nucleotide of D78012).Reaction mixture is in 94 ℃ of sex change 30 seconds, in 55 ℃ of annealing 30 seconds, and prolongs 3 minutes in 72 ℃.These reactions repeat 30 circulations.One 1952-bp CRMP-1cDNA fragment is cloned into TA carrier (pGEM-T-Easy cloning kit according to manufacturers's indication step; Promega, Madison, Wisconsin).CRMP-1 cDNA sequential analysis demonstration and reported sequence (Hamajima et al. (1996) Gene 180:157-63) have 100% homogeny.

(Promega, Madison insert CRMP-1 cDNA (24-1975 the Nucleotide of D78012) to make up pCIneo-CRMP-1 between EcoR I Wisconsin) and Not I in pCI-neo mammals expression vector.Partly (Invitrogen, Carlsbad is California) to make up pRSET-CRMP-1 as the usefulness of producing fusion rotein for CRMP-1 cDNA (376-1975 Nucleotide) insertion pREST C prokaryotic expression carrier.CRMP-1 cDNA (151-1869 Nucleotide) coding region with PCR by the pCIneo-CRMP-1 plasmid amplification.Forward primer 5 '-ATTGA CTCGAGATGTCGTACCAGGGCAAGAA-3 ' (SEQ ID NO:5) comprises 151-170 Nucleotide of CRMP-1 sequence and imports Xho I position (subscript place).Reverse primer 5 '-ATAT CGAATTCTCAACCGAGGCTGGTGAT-3 ' (SEQ ID NO:6) is complementary to 1852-1869 Nucleotide and imports EcoR I site (subscript place).For carrying out the protein positioning test, the CRMP-1 fragment of amplification is by green fluorescent protein (GFP) expression vector-pEGFP-C3 (Clontech that is inserted into CMV promotor source between Xho I and EcoR I site, Palo Alto is California) to obtain pEGFP-CRMP-1.These constructs are isolated and are adopted automatic sequencer (model ABI377, PE Applied Biosystems, Forster City, California) order-checking double-stranded DNA by plasmid clone.

The production of monoclonal antibody

The pRSET-CRMP-l transfection is to e. coli strains BL21 (DE3) pLysS.Fusion rotein (called after His-CRMP-1 (76-572 amino acid)) is obtained with the form of syzygy.Syzygy dissolving and with 12.5%SDS-polyacrylamide gel electrophoresis purifying.BALA/c mouse (6 age in week) is got an injection under the skin in 0.1mL Freund's complete adjuvant (Life Technologies, Grand Island, New York) in and be aided with the fusion rotein that 0.1mL sterilization phosphate buffer normal saline (PBS) emulsive SDS-PAGE purifying is crossed.Mouse is followed and gets an injection under the skin in per three weeks again in 0.1mL Freund's incomplete adjuvant (Life Technologies, Grand Island, New York) and be aided with 0.1mL sterilization phosphate buffer normal saline (PBS) emulsive fusion rotein.Survey antibody titer with the Western blotting, and adopt preimmunization serum as negative control.(Roche GmbH, Mannhein Germany) exists down the splenocyte of being obtained by a mouse and mouse myeloma is merged in polyethylene glycol 1500.Hybridoma is allocated in and contains DMEM and RPMI-1640 (1: 1) nutrient solution adding 15%NuSerum (Collaborative Research, Bedford, Massachusetts) and inferior yellow alkali-amido pterin-thymus pyrimidine HAT (Sigma, St.Louis, 96 orifice plates Missouri).Supernatant liquor is with the anti-His-CRMP-1 of Western blotting (76-572 amino acid) fusion rotein screening.

Northern hybrid method and Western engram analysis

Each row in 0.8% agarose formaldehyde gel injects total RNA of 20 μ g, and behind the electrophoresis, the gel trace is transferred to Hybond-N with capillary tube technique in the 1XMOSP electrophoretic buffer ⁺Nylon membrane (Amershan, Buckinghamshire, United Kingdom).Behind this film of ultraviolet-crosslinkable with 5XSSC, 5X DenhardShi solution, 50mM NaPO ₄(pH6.2), 100 μ g/mL salmon sperm dnas, and 50% deionization formaldehyde, hybridization was handled 4 hours before 42 ℃ are carried out.This film is again with synthetic by RediprimeDNA Mk system (Amersham, Buckinghamshire, United Kingdom) ³²The dna probe hybridization of p-mark.Hybridize SSC, 5X DenhardShi solution, 10% asuro, 20mMNaPO in 5X ₄(pH6.2), 100 μ g/mL salmon sperm dnas, and carried out 18 hours in the 50% deionization formaldehyde, under 42 ℃.This film places room temperature to clean twice in 15 minutes with 2X SSC and 0.5% SDS, places twice of 52 ℃ of cleaning in 30 minutes with 0.1XSSC and 0.1% SDS again.This film and to be exposed to x-ray film in 70 ℃ overnight.The RNA amount of each row is that comparison records like the signal strength of G β-probe (often deposits the internal reference group of gene as the RNA amount).Please refer to Shan et al. (1992) Mol Cell Biol 12:5620-31.

Total cellular lysate (5 μ g protein) is separated with 12.5%SDS-PAGE, and with electric transfer printing be transferred to the polyvinylidene dichloride film (the Immobilon-P film, Millipore, Bedford, Massachusetts).After sealing in the PBS of 0.1% Tween-20 solution with 5% skim-milk, embrane-associated protein is surveyed with monoclonal antibody.Clean this film and handle in conjunction with anti-mouse secondary antibodies (Amersham, Buckinghamshire, United Kingdom) with horseradish peroxidase.Protein band is measured with x-ray film to strengthen chemical cold light test kit (Amersham, Buckinghamshire, United Kingdom).

Transfection and clone

As described above with 20ULipofectAMINE reagent (Gibco-BRL, Rockville, Maryland) the full CL of transfection 5 μ g pCIneo-CRMP-1 plasmids to 70% _1-5Cell.CL _1-5Cell is organized (pseudo-transfection strain) in contrast with the pCI-neo carrier transfection that does not contain inset again.Add gentamycin-G418 (Gentamicin-G418, Gibco-BRL, Rockwille, Maryland) to the concentration of 500 μ g/mL to carry out the stable transfection strain clone.Changed in per three days and once select nutrient solution totally 3 weeks.But separate resistant cell strain and amplification with identification mark.The transfection cloned DNA inserts the situation of chromosomal DNA and confirms with the Northern hybrid method.As for temporary transient transfection person, completely cultivate CL in 70% with LipofectAMINE reagent _1-0With CL _1-5Cell transfecting pEGFP-CRMP-1 plasmid.After 48 hours, directly check viable cell and show fluorescent microscope (Bio-Rad, Rockville Center, New York) photograph with the Zeiss Axiphot that is equipped with MRC-1000 scanning coordination imaging system.Please refer to Hong et al. (2000) Am J Respir CellMol Biol 23:355-63.

External invasive test and cell growth test

Transfection clone invasive is to adopt film to invade culture systems (membrane invasion culturesystem, MICS, Chu et al. (1997) Am J Respir Cell Mol Biol 17:353-60) test.In the MICS system, (Nucleopore Corp., Pleasanton California) coat with the mixture of 5mg/mL Matrigel to contain the PC film of 10 μ m holes.Above-mentioned film is placed between the upper and lower porose disc of a MICS chamber.The resuspending cell contains among the RPMI-1640 of 10%NuSerum in one, and is inoculated in the last porose disc (2.5 * 10 in the chamber respectively ⁴Cells/well).In 37 ℃ cultivate 48 hours after, the cell of invading via this coating film is removed by porose disc down with the PBS of 1mM EDTA, and with 3 μ m hole traces to the PC film.The trace cell is with propidium iodine (Sigma, St.Louis, Missori) dyeing, and employing personal computer software (analysis imaging station; Imaging Research Inc., Ontario Canada) counts the cell count of each trace in microscope (50X ratio of enlargement).Each test is through carrying out revision test three times with sample.

The cell growth is adopted and is modified 3-(4,5-dimethylthiazole-2-yl)-2,5-diphenol tetrazolium bromide (MTT) experimental measurement.Please refer to 89:271-7 as Denizot et al. (1986) J Immunol Methods.Cell divides to plant makes every hole nutrient solution (100 μ L) contain 4000 cells in 96 orifice plates.Culture plate is cultivated and is reached 4 days.In MTT test, every hole adds the MTT solution (5mg/mL) of 10 μ L, and in 37 ℃ of culturing cells 4 hours again.The Virahol that contains 0.04N HCl that adds 100 μ L in every hole, and the coloured crystallization of powerful mixing to produce in the dissolved cell.(McClean Virginia) measures the absorption spectrum of 570nm to 630nm as the reference ripple for Titertek Multiskan, Flow Laboratories with the porous scanning spectrometer.Cell survival rate records with trypan blue dyeing elimination test.The representative of each data point is by average 6 commit points that repeat same test at least 3 times.

The dyeing of F-Actin muscle

The cell that grows in cover glass cleans three times with PBS, fixes 10 minutes with the PBS that contains 3.7% trioxymethylene, and penetrates 10 minutes with the PBS that contains 0.1% Triton-X 100.Nonspecific binding site was handled 15 minutes and was sealed with the PBS that contains 5% nonfat milk.After cleaning 5 minutes with PBS, cell is hatched in rhodamine (rhodamine)-in conjunction with phalloidin (phalloidin) 5U/mL (Molecular Probe, Eugene, Oregon) 30 minutes.After the PBS cleaning, cell adopts and contains 2% n-propyl gallate salt, the PBS of 60% glycerine, and pH 8.0 lids cover liquid and are placed on the slide glass.Cell adopts Zeiss Axiphot table fluorescent microscope to inspect and adopts the T-max of Kodak 400 egative films to take a picture.

Sufferer and sample

This research comprises the continuous sufferer that Univ Nat Taiwan sets up hospital's 80 excision nonsmall-cell lung cancers (non-small cell lung cancer) between year December in September, 1994 to 1996.This research is to set up through Univ Nat Taiwan just to carry out after commission of review of institute of hospital allows.And obtain written notice by ill loyalty and agree.Owing to do not have sufferer before operation, once to accept new adjuvant chemotherapy or radiotherapy, so all neoplasmic tissue sample all are that nature is handled.The cancerous lung tissue of the time obtaining in operation with the sample of the non-tumor locus of lungs at once with the liquid nitrogen IQF and be stored in-80 ℃ and just thaw during up to use.Standard (World Health Organization (1982) Am J Clin Pathol 77:123-36) according to the World Health Organization is carried out histologic classification.Confirm tumour size, position invasive and nodus lymphoideus transferring rate situation with pathological examination.Find to confirm last disease stage in conjunction with operation and pathology, this is the tumour-tubercle-transfer system (Mountain (1997) Chest 111:1710-7) according to the classification of existing lung cancer stage.Sufferer comprises 51 male sex and 29 women (62.9 ± 10.5 years old mean age).38 of these sufferers have squamous cell carcinoma and 42 and have gland cancer.The operation of disease-pathology stage is 31 of the 1st phases, 19 of II phases, 24 of III phases, and 6 of IV phases.Neoplastic state is 15 of T1 phases, 42 of T2 phases, 9 of T3 phases, and 14 of T4 phases.42 sufferers do not have nodus lymphoideus transferring rate (N0 phase), and 38 have part or diaphragm nodus lymphoideus transferring rate (the N1 phase has 19, and the N2 phase has 18, and the N3 phase has 1).Trace data is obtained with this research tumour enrolled for service by sufferer medical treatment record.By 6.5 to 70 months, continue in June, 2000 during the tracking.The calculating of recurrence time is that the part is sent out again or system shifts to detecting by operation day.The calculating of survival time is by operation day extremely dead day.The recurrence time scope was by 2 to 42 months (middle number: 11.0 months), and the survival time scope was by 6.5 months to 53 months (middle number: 20.5 months).Sufferer dies from the postoperative complication in operation in back 30 days, and the person is excluded in outside the survival analysis.

The real-time quantitative reverse transcriptional PCR

Total mRNA extracts test kit (RNase Mini Kit by the excision cancer cells with RNA; Qiagen, Valencia California) extracts.The quality system of RNA sample is through agarose gel electrophoresis and ethidium bromide (ethidium bromide) dyeing and observe 18S and 28S RNA affirmation under UV-light.Be used for 250ng, 50ng that the typical curve sample of real-time quantitative RT-PCR comprised by the specific RNA sample of serial dilution, 10ng, with the 2ng scope.The sample packing of serial dilution also is stored in-80 ℃ and just thaws when using.CDNA sequence based on CRMP-1, in order to as follows: (1) forward primer as the primer of CRMP-1 mRNA quantitative RT-PCR, 5 '-CCACGATGATCATTGACCATGT-3 ' (SEQ IDNO:7, exon: 3), and (2) reverse primer, 5 '-AGGGAGTAATCACAGCAGGATTTG-3 ' (SEQ ID NO:8, exon: 4) (Torres (1998) DNA Res 5:393-5).Being used to detect also, the probe sequence of qualitative RT-PCR product is FAM (Fluoresceincarboxylic acid (carboxyfluorescein)) 5 '-AGCCTACTGACCTCTTTCGAGAAGTGGCA-3 ' TAMRA (N, N, N ', N '-tetramethyl--6-carboxyl rhodamine) (SEQ ID NO:9).This is specific to CRMP-1 cDNA sequence is to be selected from exon 4-exon 4 to link that contingent CRMP-1 chromosomal DNA pollutes when preventing the quantitative PCR product.Be used for the RT-PCR primer of quantitative TBP mRNA (internal reference group, gene library are logined X54993 number) and probe from Bieche et al. (1999) Clin Chem 45:1148-56.The consistence of PCR product is confirmed with dna sequencing.Each test comprises a typical curve, a no template contrast, and three reproducible results of total RNA sample.Reaction conditions is as (Yuan et al. (2000) Am JRespir Crit Care Med 162:1957-63) as described in the forefathers.(PE Applied Biosystems, Foster City California) detect on the line in real time to adopt ABI prism7700 sequence detection system by report dyeing excited fluorescent system.

Statistical study

Suitably, data show with the form of mean+SD (SD).All statistical study all are with the 8.0th edition processing of SPSS.Different experiments group data relatively are to carry out with Student ' s t test.Adopt PairedKendall ' the s W test comparison of tumor sample and the CRMP-1 mRNA of paired healthy tissues to show poor-Δ CT.Adopt Fisher ' s exact test and Student ' s t test clinical pathologic characteristic than the tumour (with sufferer) of higher and low CRMP-1 mRNA performance.Survivorship curve is obtained by the Kaplan-Meier method with the survival otherness and low and high CRMP-1 mRNA recurrence time difference is analyzed with log-rank test.All statistical study are all two-way.The P value is considered as adding up significant difference less than 0.05.

The result

Identify the different CRMP-1 of expression mRNA with the cDNA microarray

Adopt cDNA microarray and colorimetric detection method to identify the lung cancer cell line (CL of invasive feature with multiple degree _1-0, CL _1-1, CL _1-5, and CL _1-5-F ₄) between different expressing genes.These four cell strains have different invasive degree.The invasive degree is CL by little extremely big four cell strains in regular turn _1-0＜CL _1-1＜CL _1-5≤ CL _1-5-F ₄The test of all cDNA microarraies is triplicate all.Cell strain growth is in three independent culture condition, and whole to be extracted into the process that video picture analyzes by RNA all be independently to carry out.The standard deviation of experiment is 7.3%.The cDNA microarray data divides cluster analysis to show that about 500 genes have plus or minus relevant with the cancer cells invasive.Most of these genes are relevant with angiogenesis effect, cellular activity power, sticking power and proliferative effect.Wherein, CRMP-1 mRNA table county and cell invasive are negative correlation.

The Northern hybrid method confirms that the CRMP-1 expression level is in CL _1-5With CL _1-5-F ₄With respect to CL _1-0With CL _1-1Violent decline.For confirming that CRMP-1 has also reacted the protein level in the differing appearance of mRNA level, adopt the monoclonal antibody specific Y21 of anti-CRMP-1 to carry out Western blotting.Monoclonal antibody Y21 discerns CRMP-1 but other CRMPs of nonrecognition.Observe similarly in CL _1-5With CL _1-5-F ₄CRMP-1 express to descend.

The CRMP-1 overexpression can be in vitro inhibition cancer cells invasive

Express non-accidental relations for whether studying invasive expression type and CRMP-1, make up one and have CRMP-1 cDNA and grow into the plasmid of pCI-neo carrier and transfection to CL _1-5, and isolate five clone strains and can stablize performance CRMP-1.Carrying out the Northern hybrid method expresses to analyze in pseudo-transfection person and CRMP-1cDNA transfection clone's (B5, C6, C8, C10 and C22) CRMP-1.Adopt whole section CRMP-1cDNA coding region 1.95kb as probe.All five CRMP-1 transfection clones all express the CRMP-1mRNA transcript.On the contrary, pseudo-transfection person there is no any detectable CRMP-1 transcript.Adopt like G β probe as contrasting within the RNA quality.The CRMP-1 that also adopts Western blotting to analyze pseudo-transfection person and five strain CRMP-1 transfections clone expresses.Adopt CRMP-1 monoclonal antibody Y21 as an antibody.The CRMP-1 protein expression is cloned in the CRMP-1 transfection, but is not expressed in pseudo-transfection person.Adopt the test of reconstruction in vitro basilar membrane invasive to confirm whether the CRMP-1 expression influences the cancer cells invasive.CRMP-1 is expressed in CL _1-5Cell has suppressed external invasive ability.For making the relative invasive of pseudo-transfection person and CRMP-1 transfection clone (C8, C10 is with C22 for B5, C6) clearer, all numerical value are with the invasive Percentage Criterionization with respect to pseudo-transfection person (100%).Each strain is all through three revision tests.After cultivation in 48 hours, show that the CRMP-1 cloning by expression significantly reduces (40% to 60%) and invades potentiality (P＜0.01).Yet, the threshold value of a CRMP-1 is arranged, just can not more suppress invasive when surpassing and take place.

Tumour cell must be finished a complex series step and just be invaded and shift; One of all basic steps are the cell growth.Adopt modified MTT experimental measurement CRMP-1 transfection strain and pseudo-transfection person's in-vitro cell growth rate.Display change CRMP-1 expresses and does not significantly change external hyperplasia as a result, and on behalf of CRMP-1, this may regulate the cell invasive through the mechanism of acellular hyperplasia control.

In CRMP-1 overexpression cell, can change the reaction of F-actin polymerization

The F-Actin muscle is at reactivity cell polymerization and decomposition (Symons ﹠amp constantly; Mitchison (1991) J Cell Biol 114:503-13).Temporary and spatiality tabular outstanding (lamellar protrusion) is relevant and play the part of key role (Cooper (1991) Ann Rev Physol 53:585-605) when cellular activity in actin polymerization reaction and the reactivity cell, so influence the cell invasive.Phalloidin (phalloidin) is combined closely in the Actin muscle subunit of cilium, but debond is in monomer.With the ghost of rhodamine combination than toxic cyclic peptide dyeing CL _1-0, CL _1-1, CL _1-5, and CL _1-5-F ₄And under fluorescent microscope observation of cell.Cilium foot (filopodia) quantity is in CL _1-0With CL _1-1Be less than CL _1-5With CL _1-5-F ₄Transfection clone's F-Actin muscle also dyes.Observing CRMP-1 transfection clone is presented at than having than high expression level in the low intrusion sexual cell and becoming circle.Detect many cilium foots pseudo-transfection person, maternal plant CL coexists _1-0Situation.What is interesting is CRMP-1 transfection CL _1-5Show that its cilium podocytic process goes out bright product ground and reduces, be similar at CL _1-0Situation.

CRMP-1 is in the dependency of intracellular DYNAMIC DISTRIBUTION and CRMP-1 and division spindle body

CRMP-1 is in intracellular location when being determined at cell life cycle different steps, and a mammals transfection carrier is cloned into in CL in whole section CRMP-1cDNA coding region _1-0With CL _1-5Express the CRMP-1 that strengthens green fluorescent protein (EGFP) mark.The fluoroscopic image that obtains with laser scanning coordination microscope shows that the CRMP-1 of EGFP-mark is in CL _1-0With CL _1-5Distribution identical.At interval (interphase), some CRMP-1 protein aggregation is at centrosome.In the later stage (metaphase), CRMP-1 is most of relevant strongly with the division spindle body, and also is gathered in centrosome.In latter stage (anaphase), CRMP-1 keeps it and divides being associated of spindle body.In unusual last stage in later stage (telephase), it is gathered in intermediate (midbody).

Express relevant at the CRMP-1 of cancerous lung tissue mRNA with the postoperative recurrence and the survival rate of lung cancer sufferer

Adopt real-time quantitative RT-PCR with quantitative CRMP-1 transcript copies.Threshold cycle (C _T) be defined as by probe cutting and one of exceed on the basic value fixed threshold and produce the part number of cycles of fluorescence.In a threshold value of selecting, a less beginning copies can cause a higher C _TValue.In this research, adopt TATA-box binding protein (TBP) mRNA as internal reference (Bieche et al. (1999) Clin Chem 45:1148-56).Organize the relative quantity of CRMP-1mRNA, promptly standardized anti-TBP mRNA amount is expressed as-Δ CT=-[CT _CRMP-1-CT _TBP].The ratio of CRMP-1 mRNA copies/TBP mRNA copies then is calculated as 2 ^{-Δ CT}* K (K is a constant) (Yuan et al. (2000) Am J Respir Crit CareMed 162:1957-63).The CRMP-1 mRNA performance of measuring in all 80 tumor samples is markedly inferior near healthy tissues (P＜0.001, Paired Kendall ' s W test; Two-way).80 tumor samples-Δ CT scope is from-5.67 to 3.73, and mean value is that-1.94 ± 2.11 (mean+SD) and mean number are-1.95.Adopting intermediate value serves as that height shows group or hangs down performance group's (table 1) with the classification sufferer.The low member who shows group has process (III or IV) disease (P=0.010) and nodus lymphoideus transferring rate (N1, N2 is with N3) (P=0.043) (table 1) more easily than the high performance person of group.Postoperative is sent out again showed group (30.5 months in height middle several the duration; [CI]=5.6-55.5 is individual month between 95% trusted domain) also be longer than and hanged down performance group (15.9 months; [CI]-8.3-23.5 is individual month between 95% trusted domain) (log-rank test, P=0.030).High performance group (survival possibility 0.52) has survival rate (middle several survival rates 17.9 months of significantly low performance group head; CI=20.83-35.0 is individual month between 95% trusted domain) (log-rank test, P=0.016).Please, apply for June 26 calendar year 2001 also with reference to Application No. the 60/301st, 075.

Table 1 has the clinical pathologic characteristic of the tumour of high and low CRMP-1 mRNA expression

	The sick loyal number in CRMP-1 mRNA-Δ CT＜-1.95	CRMP-1 mRNA-Δ CT＞-1.95 sufferer numbers	The P value
				Mean age (yrs)	????62±10	????63±11	??0.627 *
The sex masculinity femininity	????24 ????16	????27 ????13	??0.642
				Phase I-II III-IV	????19 ????21	????31 ????9	??0.010
Neoplastic state T1-2 T3-4	????25 ????15	????32 ????8	??0.137
				Nodularity N0 N1-3	????16 ????24	????26 ????14	??0.043
Histology cell carcinoma gland cancer	????16 ????24	????22 ????18	??0.263

^*With Student ' s t test statistics, other P value adopts Fisher ' s exact test statistics. Other embodimentDisclosed all features of this specification sheets can be used for any combination.The alternative features that disclosed each feature of this specification sheets can have identical, equal or similar purpose replaces.

By the above, ripe ought be in this skill personage easily based on key character of the present invention, in not breaking away from the present invention's spirit and category, the present invention is carried out various changes and retouching to be suitable for multiple use and condition.Therefore, other embodiment of the present invention also falls into the claim scope of the following stated.

Sequence table PI022018.seq.txt sequence table＜110〉Taiwan Univ.

Research institute

＜120〉-1＜130〉13098-004001＜150〉60/301,075＜151〉2001-06-26＜160〉9＜170〉FastSEQ for Windows Version 4.0＜210〉1＜211〉1719＜212〉DNA＜213〉Homo sapiens＜400〉1atgtcgtacc agggcaagaa gagcatcccg cacatcacga gtgaccgact cctcatcaaa 60ggtggacgga tcatcaacga tgaccaatcc ctttatgctg acgtctacct ggaggatgga 120cttatcaaac aaataggaga gaacttaatc gttcctggtg gagtgaagac cattgaagcc 180aacgggcgga tggttattcc cggaggtatt gatgtcaaca cgtacctgca gaagccctcc 240caggggatga ctgcggctga tgcattcttc caagggacca gggcggcact ggtgggcggg 300 accacgatga tcattgacca tgttgttcct gaacctgggt ccagcctact gacctctttc 360gagaagtggc acgaagcagc tgacaccaaa tcctgctgtg attactccct ccacgtggac 420atcacaagct ggtacgatgg cgttcgggag gagctggagg tgctggtgca ggacaaaggc 480gtcaattcct tccaagtcta catggcctat aaggatgtct accaaatgtc cgacagccag 540ctctatgaag cctttacctt ccttaagggc ctgggagctg tgatcttggt ccatgcagaa 600aatggagatt tgatagctca ggaacaaaag cggatcctgg agatgggcat cacgggtccc 660gagggccatg ccctgagcag acctgaagag ctggaggccg aggcggtgtt ccgggccatc 720accattgcgg gccggatcaa ctgccctgtg tacatcacca aggtcatgag caagagtgca 780gccgacatca tcgctctggc caggaagaaa gggcccctag tttttggaga gcccattgcc 840gccagcctgg ggaccgatgg cacccattac tggagcaaga actgggccaa ggctgcggcg 900ttcgtgactt cccctcccct gagcccggac cctaccacgc ccgactactt gacctcccta 960ctggcctgtg gggacttgca ggtcacaggc agcggccact gtccctacag cactgcccag 1020aaggcggtgg gcaaggacaa ctttaccctg atccccgagg gtgtcaacgg gatagaggag 1080cggatgaccg tcgtctggga caaggcggtg gctactggca aaatggatga gaaccagttt 1140gtcgctgtca ccagcaccaa tgcagccaag atctttaacc tgtacccaag gaaagggcgg 1200attgccgtgg gctcggatgc cgacgtggtc atctgggacc ccgacaagtt gaagaccata 1260acagccaaaa gtcacaagtc ggcggtggag tacaacatct tcgagggtat ggagtgccac 1320ggctccccac tagtggtcat cagccagggc aagatcgtct ttgaagacgg aaacatcaac 1380gtcaacaagg gcatgggccg cttcattccg cggaaggcgt tcccggagca cctgtaccag 1440cgcgtcaaaa tcaggaataa ggtttttgga ttgcaagggg tttccagggg catgtatgac 1500ggtcctgtgt acgaggtacc agctacaccc aaatatgcaa ctcccgctcc ttcagccaaa 1560tcttcgcctt ctaaacacca gcccccaccc atcagaaacc tccaccagtc caacttcagc 1620ttatcaggtg cccagataga tgacaacaat cccaggcgca ccggccaccg catcgtggcg 1680ccccctggtg gccgctccaa catcaccagc ctcggttga 1719＜210〉2＜211〉572＜212〉PRT＜213〉Homo sapiens＜400〉2Met Ser Tyr Gln Gly Lys Lys Ser Ile Pro His Ile Thr Ser Asp Arg 1 5 10 15Leu Leu Ile Lys Gly Gly Arg Ile Ile Asn Asp Asp Gln Ser Leu Tyr

20??????????????????25??????????????????30Ala?Asp?Val?Tyr?Leu?Glu?Asp?Gly?Leu?Ile?Lys?Gln?Ile?Gly?Glu?Asn

35??????????????????40??????????????????45Leu?Ile?Val?Pro?Gly?Gly?Val?Lys?Thr?Ile?Glu?Ala?Asn?Gly?Arg?Met

50??????????????????55??????????????????60Val?Ile?Pro?Gly?Gly?Ile?Asp?Val?Asn?Thr?Tyr?Leu?Gln?Lys?Pro?Ser65??????????????????70??????????????????75??????????????????80Gln?Gly?Met?Thr?Ala?Ala?Asp?Asp?Phe?Phe?Gln?Gly?Thr?Arg?Ala?Ala

85??????????????????90??????????????????95Leu?Val?Gly?Gly?Thr?Thr?Met?Ile?Ile?Asp?His?Val?Val?Pro?Glu?Pro

100?????????????????105?????????????????110

PI022018.?seq.?txtGly?Ser?Ser?Leu?Leu?Thr?Ser?Phe?Glu?Lys?Trp?His?Glu?Ala?Ala?Asp

115?????????????????120?????????????????125Thr?Lys?Ser?Cys?Cys?Asp?Tyr?Ser?Leu?His?Val?Asp?Ile?Thr?Ser?Trp

130?????????????????135?????????????????140Tyr?Asp?Gly?Val?Arg?Glu?Glu?Leu?Glu?Val?Leu?Val?Gln?Asp?Lys?Gly145?????????????????150?????????????????155?????????????????160Val?Asn?Ser?Phe?Gln?Val?Tyr?Met?Ala?Tyr?Lys?Asp?Val?Tyr?Gln?Met

165?????????????????170?????????????????175Ser?Asp?Ser?Gln?Leu?Tyr?Glu?Ala?Phe?Thr?Phe?Leu?Lys?Gly?Leu?Gly

180?????????????????185?????????????????190Ala?Val?Ile?Leu?Val?His?Ala?Glu?Asn?Gly?Asp?Leu?Ile?Ala?Gln?Glu

195?????????????????200?????????????????205Gln?Lys?Arg?Ile?Leu?Glu?Met?Gly?Ile?Thr?Gly?Pro?Glu?Gly?His?Ala

210?????????????????215?????????????????220Leu?Ser?Arg?Pro?Glu?Glu?Leu?Glu?Ala?Glu?Ala?Val?Phe?Arg?Ala?Ile225?????????????????230?????????????????235?????????????????240Thr?Ile?Ala?Gly?Arg?Ile?Asn?Cys?Pro?Val?Tyr?Ile?Thr?Lys?Val?Met

245?????????????????250?????????????????255Ser?Lys?Ser?Ala?Ala?Asp?Ile?Ile?Ala?Leu?Ala?Arg?Lys?Lys?Gly?Pro

260?????????????????265?????????????????270Leu?Val?Phe?Gly?Glu?Pro?Ile?Ala?Ala?Ser?Leu?Gly?Thr?Asp?Gly?Thr

275?????????????????280?????????????????285His?Tyr?Trp?Ser?Lys?Asn?Trp?Ala?Lys?Ala?Ala?Ala?Phe?Val?Thr?Ser

290?????????????????295?????????????????300Pro?Pro?Leu?Ser?Pro?Asp?Pro?Thr?Thr?Pro?Asp?Tyr?Leu?Thr?Ser?Leu305?????????????????310?????????????????315?????????????????320Leu?Ala?Cys?Gly?Asp?Leu?Gln?Val?Thr?Gly?Ser?Gly?His?Cys?Pro?Tyr

325?????????????????330?????????????????335Ser?Thr?Ala?Gln?Lys?Ala?Val?Gly?Lys?Asp?Asn?Phe?Thr?Leu?Ile?Pro

340?????????????????345?????????????????350Glu?Gly?Val?Asn?Gly?Ile?Glu?Glu?Arg?Met?Thr?Val?Val?Trp?Asp?Lys

355?????????????????360?????????????????365Ala?Val?Ala?Thr?Gly?Lys?Met?Asp?Glu?Asn?Gln?Phe?Val?Ala?Val?Thr

370?????????????????375?????????????????380Ser?Thr?Asn?Ala?Ala?Lys?Ile?Phe?Asn?Leu?Tyr?Pro?Arg?Lys?Gly?Arg385?????????????????390?????????????????395?????????????????400Ile?Ala?Val?Gly?Ser?Asp?Ala?Asp?Val?Val?Ile?Trp?Asp?Pro?Asp?Lys

405?????????????????410?????????????????415Leu?Lys?Thr?Ile?Thr?Ala?Lys?Ser?His?Lys?Ser?Ala?Val?Glu?Tyr?Asn

420?????????????????425?????????????????430Ile?Phe?Glu?Gly?Met?Glu?Cys?His?Gly?Ser?Pro?Leu?Val?Val?Ile?Ser

435?????????????????440?????????????????445Gln?Gly?Lys?Ile?Val?Phe?Glu?Asp?Gly?Asn?Ile?Asn?Val?Asn?Lys?Gly

450?????????????????455?????????????????460Met?Gly?Arg?Phe?Ile?Pro?Arg?Lys?Ala?Phe?Pro?Glu?His?Leu?Tyr?Gln465?????????????????470?????????????????475?????????????????480Arg?Val?Lys?Ile?Arg?Asn?Lys?Val?Phe?Gly?Leu?Gln?Gly?Val?Ser?Arg

485?????????????????490?????????????????495Gly?Met?Tyr?Asp?Gly?Pro?Val?Tyr?Glu?Val?Pro?Ala?Thr?Pro?Lys?Tyr

500?????????????????505?????????????????510Ala?Thr?Pro?Ala?Pro?Ser?Ala?Lys?Ser?Ser?Pro?Ser?Lys?His?Gln?Pro

515?????????????????520?????????????????525Pro?Pro?Ile?Arg?Asn?Leu?His?Gln?Ser?Asn?Phe?Ser?Leu?Ser?Gly?Ala

530?????????????????535?????????????????540Gln?Ile?Asp?Asp?Asn?Asn?Pro?Arg?Arg?Thr?Gly?His?Arg?Ile?Val?Ala545?????????????????550?????????????????555?????????????????560Pro?Pro?Gly?Gly?Arg?Ser?Asn?Ile?Thr?Ser?Leu?Gly

565 570＜210〉gtctctatcc 20＜210 3＜211〉20＜212〉DNA＜213〉artificial sequence＜220〉＜223〉primer＜400〉3ctccgtccgt〉4＜211〉21＜212〉DNA＜213〉artificial sequence

PI022018.seq.txt＜220〉＜223〉＜400〉4cctccatcag caccaactaa a 21＜210〉5＜211〉31＜212〉DNA＜213〉＜220〉＜223〉＜400〉5attgactcga gatgtcgtac cagggcaaga a 31＜210〉6＜211〉29＜212〉DNA＜213〉＜220〉＜223〉＜400〉6atatcgaatt ctcaaccgag gctggtgat 29＜210〉7＜211〉22＜212〉DNA＜213〉＜220〉＜223〉＜400〉7ccacgatgat cattgaccat gt 22＜210〉8＜211〉24＜212〉DNA＜213〉＜220〉＜223〉＜400〉8agggagtaat cacagcagga tttg 24＜210〉9＜211〉29＜212〉DNA＜213〉＜220〉＜223〉＜400〉9agcctactga cctctttcga gaagtggca 29。

Claims (32)

1, a kind of method of assessment one sample, it comprises:

Mensuration comprises the level of CRMP-41 albumen in first sample of cell or mRNA;

Mensuration comprises the level of CRMP-1 albumen in second sample of cell or mRNA;

The level that compares CRMP-1 in first and second sample; And

When the level of first sample is lower than second sample, this individuality of classifying is invaded potentiality or is shifted potentiality for having tumour.

2, the method for claim 1, wherein cells contacting one test compound of first sample, and normal cell is not for contacting the cell of this test compound.

3, the method for claim 1, wherein first sample is the biopsy sample of an individuality.

4, method as claimed in claim 3, wherein biopsy sample is a tumour or lymphoglandula source.

5, method as claimed in claim 3 should individuality be human wherein.

6, a kind of method of assessment one individuality, it comprises:

Obtain a cell by this individuality;

Measure CRMP-1 albumen or mRNA expression level in this cell; And

Determine an eigenwert to represent a CRMP-1 mensuration level in this cell and a similarity grade with reference to the expression reference level of cell.

7, as claim 1 or 6 described methods, wherein the proteic level of CRMP-1 is measured.

8, method as claimed in claim 7, wherein this mensuration comprises that contact one antibody or Fab are to this individual samples.

9, method as claimed in claim 8, wherein antibody or Fab are bonded to an albumen, and this albumen has the sequence of SEQ ID NO:2.

10,, wherein measure this CRMP-1 mRNA level as claim 1 or 6 described methods.

11, method as claimed in claim 10, wherein this mensuration comprises this sample is contacted with the probe of the sequence hybridization of SEQ ID NO:1 under tight a beautiful gem condition with one.

12,, wherein measure the level of maximum 50 other genes or gene product as claim 1 or 6 described methods.

13, method as claimed in claim 6 should be a cultivation lung adenocarcinoma cell with reference to cell wherein.

14, method as claimed in claim 6, wherein this eigenwert is that this method comprises the expression level stdn with a house-keeping gene by method decision.

15, a kind of method of assessment one test compound, it comprises:

One cells of mamma animals is contacted a test compound; And

Measure whether this test compound changes CRMP-1 mRNA or protein expression level in this cells of mamma animals.

16, method as claimed in claim 15, wherein this test compound comprises that a zinc refers to the district.

17, method as claimed in claim 15, wherein this test compound comprises an immune globulin variable region.

18, method as claimed in claim 15, wherein this test compound comprises nucleic acid.

19, method as claimed in claim 15, wherein this test compound is sent into this cell by a micelle or virus.

20, method as claimed in claim 15, wherein this test compound has a molecular weight less than 2kD.

21, method as claimed in claim 15, wherein this cells of mamma animals is at this test compound of external contact.

22, method as claimed in claim 15, it further comprises, before measuring, measure, or after measuring, assessment one contacts the invasive of the cells of mamma animals of this test compound.

23, method as claimed in claim 15, wherein this cell comprises a reporter gene, this gene is operably connected to a CRMP-1 regulating and controlling sequence.

24, a kind of change one cells of mamma animals is invaded the method for characteristic, and it comprises:

Expressing a heterologous nucleic acids under one condition in a cells of mamma animals, this nucleic acid encoding one has the polypeptide of the aminoacid sequence of SEQID NO:2, and under this condition, this nucleic acid is translated and produces the polypeptide of the aminoacid sequence with SEQID NO:2.

25, method as claimed in claim 24, wherein in expression this cell external.

26, method as claimed in claim 24, it further comprises, before the expression, this cell is contacted with the virus that contains heterologous nucleic acids.

27, as the method as described in the 24th of the claim, wherein this cell is a pneumonocyte.

28, method as claimed in claim 24, wherein this cell is a tumour cell.

29, method as claimed in claim 24, wherein this cell is a human cell.

30, method as claimed in claim 29, wherein this cell is one to have the cell of the individuality of metastatic tumour.

31, a kind of pharmaceutical compositions, it comprises: a medicament of a significant quantity; And a pharmaceutically acceptable carrier, wherein this medicament is selected from: (a) polypeptide, and it contains the aminoacid sequence of SEQ ID NO:2, or its functional fragment; (b) nucleic acid, it comprises the sequence of a coding one polypeptide, this polypeptide contains the aminoacid sequence of SEQ IDNO:2, or its functional fragment; And (c) test compound, the expression of its adjustable CRMP-1.

32, an a kind of and polypeptide bonded antibody that contains the aminoacid sequence of SEQ ID NO:2,, wherein this antibody is Y21 antibody.