CN1366058A - Refractory triosephosphate isomerase gene and its polypeptide coded by it and preparing process - Google Patents
Refractory triosephosphate isomerase gene and its polypeptide coded by it and preparing process Download PDFInfo
- Publication number
- CN1366058A CN1366058A CN01145562A CN01145562A CN1366058A CN 1366058 A CN1366058 A CN 1366058A CN 01145562 A CN01145562 A CN 01145562A CN 01145562 A CN01145562 A CN 01145562A CN 1366058 A CN1366058 A CN 1366058A
- Authority
- CN
- China
- Prior art keywords
- polypeptide
- high temperature
- triose phosphate
- temperature resistant
- phosphate isomerase
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 108700015934 Triose-phosphate isomerases Proteins 0.000 title claims abstract description 53
- 238000000034 method Methods 0.000 title claims abstract description 35
- 108090000765 processed proteins & peptides Proteins 0.000 title claims abstract description 35
- 229920001184 polypeptide Polymers 0.000 title claims abstract description 34
- 102000004196 processed proteins & peptides Human genes 0.000 title claims abstract description 34
- 230000008569 process Effects 0.000 title description 6
- 102000005924 Triose-Phosphate Isomerase Human genes 0.000 claims abstract description 43
- 108020004414 DNA Proteins 0.000 claims abstract description 14
- 230000000694 effects Effects 0.000 claims abstract description 12
- 125000003275 alpha amino acid group Chemical group 0.000 claims abstract 3
- 239000002773 nucleotide Substances 0.000 claims description 20
- 125000003729 nucleotide group Chemical group 0.000 claims description 20
- 210000004027 cell Anatomy 0.000 claims description 19
- 239000012634 fragment Substances 0.000 claims description 12
- 239000013604 expression vector Substances 0.000 claims description 11
- 230000008859 change Effects 0.000 claims description 7
- LXJXRIRHZLFYRP-VKHMYHEASA-N D-glyceraldehyde 3-phosphate Chemical compound O=C[C@H](O)COP(O)(O)=O LXJXRIRHZLFYRP-VKHMYHEASA-N 0.000 claims description 6
- 238000003780 insertion Methods 0.000 claims description 4
- 230000037431 insertion Effects 0.000 claims description 4
- 238000000926 separation method Methods 0.000 claims description 4
- 230000015572 biosynthetic process Effects 0.000 claims description 3
- 230000008034 disappearance Effects 0.000 claims description 3
- 210000003527 eukaryotic cell Anatomy 0.000 claims description 3
- 230000035772 mutation Effects 0.000 claims description 3
- 210000001236 prokaryotic cell Anatomy 0.000 claims description 3
- 238000012258 culturing Methods 0.000 claims description 2
- 108091033319 polynucleotide Proteins 0.000 claims description 2
- 102000040430 polynucleotide Human genes 0.000 claims description 2
- 239000002157 polynucleotide Substances 0.000 claims description 2
- 102000053602 DNA Human genes 0.000 claims 1
- 108090000623 proteins and genes Proteins 0.000 abstract description 36
- 102000004190 Enzymes Human genes 0.000 abstract description 15
- 108090000790 Enzymes Proteins 0.000 abstract description 15
- 238000004458 analytical method Methods 0.000 abstract description 9
- 238000012163 sequencing technique Methods 0.000 abstract description 9
- 238000002360 preparation method Methods 0.000 abstract description 7
- 238000005516 engineering process Methods 0.000 abstract description 5
- 230000009261 transgenic effect Effects 0.000 abstract description 4
- 241001465754 Metazoa Species 0.000 abstract description 3
- 108020004511 Recombinant DNA Proteins 0.000 abstract description 2
- 241001148471 unidentified anaerobic bacterium Species 0.000 abstract 1
- 108700026220 vif Genes Proteins 0.000 abstract 1
- 102000004169 proteins and genes Human genes 0.000 description 14
- 241000894006 Bacteria Species 0.000 description 13
- 235000018102 proteins Nutrition 0.000 description 12
- 150000001413 amino acids Chemical group 0.000 description 11
- 239000013598 vector Substances 0.000 description 7
- NBIIXXVUZAFLBC-UHFFFAOYSA-N Phosphoric acid Chemical compound OP(O)(O)=O NBIIXXVUZAFLBC-UHFFFAOYSA-N 0.000 description 6
- 235000001014 amino acid Nutrition 0.000 description 6
- 238000006243 chemical reaction Methods 0.000 description 5
- 238000001962 electrophoresis Methods 0.000 description 5
- 108700026244 Open Reading Frames Proteins 0.000 description 4
- 230000001580 bacterial effect Effects 0.000 description 4
- 238000002474 experimental method Methods 0.000 description 4
- 244000005700 microbiome Species 0.000 description 4
- 108020004707 nucleic acids Proteins 0.000 description 4
- 102000039446 nucleic acids Human genes 0.000 description 4
- 150000007523 nucleic acids Chemical class 0.000 description 4
- 239000006228 supernatant Substances 0.000 description 4
- 108020004705 Codon Proteins 0.000 description 3
- DSQNMNVLWGRUSL-UHFFFAOYSA-N P(=O)(=O)C(C(C)=O)(O)O Chemical compound P(=O)(=O)C(C(C)=O)(O)O DSQNMNVLWGRUSL-UHFFFAOYSA-N 0.000 description 3
- 238000012408 PCR amplification Methods 0.000 description 3
- 229910000147 aluminium phosphate Inorganic materials 0.000 description 3
- 238000010276 construction Methods 0.000 description 3
- RWSXRVCMGQZWBV-WDSKDSINSA-N glutathione Chemical class OC(=O)[C@@H](N)CCC(=O)N[C@@H](CS)C(=O)NCC(O)=O RWSXRVCMGQZWBV-WDSKDSINSA-N 0.000 description 3
- 238000003752 polymerase chain reaction Methods 0.000 description 3
- 238000001556 precipitation Methods 0.000 description 3
- 239000000047 product Substances 0.000 description 3
- LXJXRIRHZLFYRP-VKHMYHEASA-L (R)-2-Hydroxy-3-(phosphonooxy)-propanal Natural products O=C[C@H](O)COP([O-])([O-])=O LXJXRIRHZLFYRP-VKHMYHEASA-L 0.000 description 2
- 208000027219 Deficiency disease Diseases 0.000 description 2
- 241000588724 Escherichia coli Species 0.000 description 2
- 229930091371 Fructose Natural products 0.000 description 2
- RFSUNEUAIZKAJO-ARQDHWQXSA-N Fructose Chemical compound OC[C@H]1O[C@](O)(CO)[C@@H](O)[C@@H]1O RFSUNEUAIZKAJO-ARQDHWQXSA-N 0.000 description 2
- 239000005715 Fructose Substances 0.000 description 2
- CTKINSOISVBQLD-UHFFFAOYSA-N Glycidol Chemical compound OCC1CO1 CTKINSOISVBQLD-UHFFFAOYSA-N 0.000 description 2
- 108091092724 Noncoding DNA Proteins 0.000 description 2
- 108010076504 Protein Sorting Signals Proteins 0.000 description 2
- 229920002684 Sepharose Polymers 0.000 description 2
- 238000013459 approach Methods 0.000 description 2
- 230000033228 biological regulation Effects 0.000 description 2
- 238000006555 catalytic reaction Methods 0.000 description 2
- 239000004927 clay Substances 0.000 description 2
- 238000004440 column chromatography Methods 0.000 description 2
- 238000007405 data analysis Methods 0.000 description 2
- 238000013461 design Methods 0.000 description 2
- GNGACRATGGDKBX-UHFFFAOYSA-N dihydroxyacetone phosphate Chemical compound OCC(=O)COP(O)(O)=O GNGACRATGGDKBX-UHFFFAOYSA-N 0.000 description 2
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 2
- 238000012268 genome sequencing Methods 0.000 description 2
- 230000034659 glycolysis Effects 0.000 description 2
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 2
- 239000007788 liquid Substances 0.000 description 2
- 230000004060 metabolic process Effects 0.000 description 2
- 238000012544 monitoring process Methods 0.000 description 2
- 230000036961 partial effect Effects 0.000 description 2
- 239000013612 plasmid Substances 0.000 description 2
- 238000012545 processing Methods 0.000 description 2
- 238000000746 purification Methods 0.000 description 2
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 2
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Chemical compound O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 2
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 1
- -1 50 μ l Substances 0.000 description 1
- 244000063299 Bacillus subtilis Species 0.000 description 1
- UXVMQQNJUSDDNG-UHFFFAOYSA-L Calcium chloride Chemical compound [Cl-].[Cl-].[Ca+2] UXVMQQNJUSDDNG-UHFFFAOYSA-L 0.000 description 1
- 208000031229 Cardiomyopathies Diseases 0.000 description 1
- 108091035707 Consensus sequence Proteins 0.000 description 1
- 241000195493 Cryptophyta Species 0.000 description 1
- 108090000371 Esterases Proteins 0.000 description 1
- 241000186394 Eubacterium Species 0.000 description 1
- 102000001390 Fructose-Bisphosphate Aldolase Human genes 0.000 description 1
- 108010068561 Fructose-Bisphosphate Aldolase Proteins 0.000 description 1
- 108010024636 Glutathione Proteins 0.000 description 1
- 238000003794 Gram staining Methods 0.000 description 1
- 101000911390 Homo sapiens Coagulation factor VIII Proteins 0.000 description 1
- 108091029795 Intergenic region Proteins 0.000 description 1
- 102000004195 Isomerases Human genes 0.000 description 1
- 108090000769 Isomerases Proteins 0.000 description 1
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 1
- 108020005091 Replication Origin Proteins 0.000 description 1
- 241000186339 Thermoanaerobacter Species 0.000 description 1
- 201000003399 Triose phosphate-isomerase deficiency Diseases 0.000 description 1
- 108700034122 Triosephosphate Isomerase Deficiency Proteins 0.000 description 1
- 208000035896 Twin-reversed arterial perfusion sequence Diseases 0.000 description 1
- LPQOADBMXVRBNX-UHFFFAOYSA-N ac1ldcw0 Chemical compound Cl.C1CN(C)CCN1C1=C(F)C=C2C(=O)C(C(O)=O)=CN3CCSC1=C32 LPQOADBMXVRBNX-UHFFFAOYSA-N 0.000 description 1
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 1
- 230000009604 anaerobic growth Effects 0.000 description 1
- 238000009835 boiling Methods 0.000 description 1
- 239000001110 calcium chloride Substances 0.000 description 1
- 229910001628 calcium chloride Inorganic materials 0.000 description 1
- 238000001818 capillary gel electrophoresis Methods 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 230000001684 chronic effect Effects 0.000 description 1
- 230000000295 complement effect Effects 0.000 description 1
- 238000005520 cutting process Methods 0.000 description 1
- 238000010586 diagram Methods 0.000 description 1
- 239000001177 diphosphate Substances 0.000 description 1
- XPPKVPWEQAFLFU-UHFFFAOYSA-J diphosphate(4-) Chemical compound [O-]P([O-])(=O)OP([O-])([O-])=O XPPKVPWEQAFLFU-UHFFFAOYSA-J 0.000 description 1
- 235000011180 diphosphates Nutrition 0.000 description 1
- 201000010099 disease Diseases 0.000 description 1
- 239000012153 distilled water Substances 0.000 description 1
- 238000004043 dyeing Methods 0.000 description 1
- 239000000284 extract Substances 0.000 description 1
- 238000001502 gel electrophoresis Methods 0.000 description 1
- 238000010353 genetic engineering Methods 0.000 description 1
- 239000003292 glue Substances 0.000 description 1
- 230000002414 glycolytic effect Effects 0.000 description 1
- 230000012010 growth Effects 0.000 description 1
- 208000007475 hemolytic anemia Diseases 0.000 description 1
- 238000004128 high performance liquid chromatography Methods 0.000 description 1
- 102000057593 human F8 Human genes 0.000 description 1
- 238000009396 hybridization Methods 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 208000015181 infectious disease Diseases 0.000 description 1
- 239000004615 ingredient Substances 0.000 description 1
- 230000002401 inhibitory effect Effects 0.000 description 1
- 230000000968 intestinal effect Effects 0.000 description 1
- 238000012177 large-scale sequencing Methods 0.000 description 1
- 239000012160 loading buffer Substances 0.000 description 1
- 239000006166 lysate Substances 0.000 description 1
- 238000003754 machining Methods 0.000 description 1
- 238000004519 manufacturing process Methods 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- 238000012269 metabolic engineering Methods 0.000 description 1
- 229960000485 methotrexate Drugs 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 230000003387 muscular Effects 0.000 description 1
- 210000005036 nerve Anatomy 0.000 description 1
- 235000015097 nutrients Nutrition 0.000 description 1
- 230000000050 nutritive effect Effects 0.000 description 1
- KLAKIAVEMQMVBT-UHFFFAOYSA-N p-hydroxy-phenacyl alcohol Natural products OCC(=O)C1=CC=C(O)C=C1 KLAKIAVEMQMVBT-UHFFFAOYSA-N 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 230000007170 pathology Effects 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- 230000000737 periodic effect Effects 0.000 description 1
- 239000012071 phase Substances 0.000 description 1
- 230000000243 photosynthetic effect Effects 0.000 description 1
- 238000002264 polyacrylamide gel electrophoresis Methods 0.000 description 1
- 238000003259 recombinant expression Methods 0.000 description 1
- 229940047431 recombinate Drugs 0.000 description 1
- 230000006798 recombination Effects 0.000 description 1
- 238000005215 recombination Methods 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 230000002441 reversible effect Effects 0.000 description 1
- 238000012216 screening Methods 0.000 description 1
- 238000012772 sequence design Methods 0.000 description 1
- 239000007790 solid phase Substances 0.000 description 1
- 241000894007 species Species 0.000 description 1
- FRGKKTITADJNOE-UHFFFAOYSA-N sulfanyloxyethane Chemical compound CCOS FRGKKTITADJNOE-UHFFFAOYSA-N 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- 231100000167 toxic agent Toxicity 0.000 description 1
- 239000003440 toxic substance Substances 0.000 description 1
- 238000013518 transcription Methods 0.000 description 1
- 230000035897 transcription Effects 0.000 description 1
- 230000009466 transformation Effects 0.000 description 1
- 241001430294 unidentified retrovirus Species 0.000 description 1
- 210000005253 yeast cell Anatomy 0.000 description 1
Images
Landscapes
- Enzymes And Modification Thereof (AREA)
Abstract
The invention discloses a high-temperature-resistant triosephosphate isomerase gene, a polypeptide coded by the gene and a preparation method of the gene. It relates to a separated DNA for coding high-temp. resistant triosephosphate isomerase activity or its functional equivalent variant and the polypeptide with high-temp. resistant triosephosphate isomerase activity or its functional equivalent variant produced by using said separated DNA by means of recombinant DNA technology. The invention clones and separates the high temperature resistant triosephosphate isomerase gene based on sequencing and analysis of Tengchong thermophilic anaerobic bacteria whole genome. The gene is used to produce transgenic microbe or transgenic animal and plant of high temperature resistant triosephosphate isomerase, and the enzyme coded by the gene is recovered. In addition, the invention also provides an amino acid sequence and functional equivalent of the polypeptide with the high-temperature-resistant triosephosphate isomerase activity. Meanwhile, the invention also provides a method for preparing, separating and purifying the polypeptide with the high-temperature-resistant triosephosphate isomerase activity.
Description
Technical field
The present invention relates to field of genetic engineering, particularly, relate to a kind of high temperature resistant triose phosphate isomerase gene and encoded polypeptides thereof and prepare the method for this polypeptide.
Background technology
The triose phosphate isomerase that relates among the present invention (triosephosphate isomerase) is one of enzyme in the glycolytic pathway, and its effect is that the catalysis phosphodihydroxyacetone changes into glyceraldehyde 3-phosphate.The molecular weight of triose phosphate isomerase is 27261 dalton, constitutes around centronucleus around 8 strands of α coiled strands outside being reached by 8 strands of parallel β chains.Phosphoric acid is weak competitor in this reaction, but this reaction is then had had strong inhibitory effects when phosphoric acid and Racemic glycidol formation phosphoric acid Racemic glycidol.
The triose phosphate isomerase is a kind of natural enzyme that extensively is present in, and its effect is catalysis phosphodihydroxyacetone (DHAP) and glyceraldehyde 3-phosphate mutual exchange reaction in can energy-producing glycolytic pathway.The biochemical characteristics of the triose phosphate isomerase deficiency that isozygotys be exactly in a organized way in the activity of this enzyme descend significantly, also be accompanied by simultaneously owing in the cell especially in red corpuscle phosphodihydroxyacetone gather the blocking-up that causes the metabolism in the glycolytic cycle.Clinical triose phosphate isometry enzyme deficiency disease is a rare autosomal recessive character pathology (30 cases was only reported in the whole world at present), it shows as chronic hemolytic anemia disease, periodic infection, myocardosis, serious and muscular nerve disease that be gradation.These complication are threatening patient's life often.Though before first case came across 30 years, up to the present, triose phosphate isometry enzyme deficiency disease did not also obtain the effective treatment.Also effectively do not studied about the possibility that the replacement of this enzyme is treated.
Be exactly that the people intends making up and utilizes CO in addition at present about the research of triose phosphate isomerase
2The transgenic blue algae of synthetic monose.Main thought is to strengthen photosynthetic fixation of C O
2Calvin (Calvin) circulation in triose phosphate ester isomerase fructose 1, the metabolic engineering of 6-bisphosphate aldolase and these three relevant enzyme of fructose diphosphate esterase.
The Tengchong thermophilc anaerobe that the present invention relates to (Thermoanaerobacter tangcongensis), it is a kind of microorganism that lives in the hot spring of Yunnan Province of China province Tengchong County, it is a kind of thermophilic eubacterium (eubacteria), optimum growth temperature is 75 degrees centigrade, anaerobic growth, the gramstaining reaction is positive.It is at first to be found and carried out the analysis on the taxonomy by Microbe Inst., Chinese Academy of Sciences.Bacterial classification is kept at Chinese microorganism and preserves center MB4
T(Chinese collection of microorganisms AS 1.2430
T=JCM 11007
T).This thermophilc anaerobe is the distinctive species of China, and the high temperature resistant triose phosphate isomerase that is had in its body also has own its specific structure.
Summary of the invention
One of purpose of the present invention provides a kind of isolating, and coding has the nucleotide sequence of the active polypeptide of high temperature resistant triose phosphate isomerase.
Two of purpose of the present invention provides a kind of isolating high temperature resistant triose phosphate isometry peptide activity that has.
Purpose of the present invention also provide the DNA that contains the high temperature resistant triose phosphate isomerase of encoding recombinant vectors, contain the host cell of aforementioned recombinant vectors, and this proteic method of preparation.
A first aspect of the present invention provides a kind of coding to have the nucleotide sequence of the active polypeptide of high temperature resistant triose phosphate isomerase.This nucleotide sequence can encode the polypeptide with the aminoacid sequence among the SEQ ID NO.2 or the modified forms of described polypeptide, on this modified forms function quite or relevant with the triose phosphate isomerase.Nucleotide sequence has the polynucleotide sequence of SEQ ID NO.1 and its mutant form, and mutation type comprises: disappearance, nonsense, insertion, missense.
A second aspect of the present invention provides a kind of high temperature resistant triose phosphate isomerase active polypeptide.This polypeptide has polypeptide or its conservative property variation polypeptide or its active fragments or its reactive derivative of the aminoacid sequence among the SEQ ID NO.2.
The present invention also provides the method for preparing high temperature resistant triose phosphate isomerase, and this method comprises the steps:
1) isolate the coding high temperature resistant triose phosphate isomerase gene nucleotide sequence SEQ IDNO.1;
2) structure contains the expression vector of the nucleotide sequence of SEQ ID NO.1;
3) with step 2) in expression vector change host cell over to, form the reconstitution cell can produce high temperature resistant triose phosphate isomerase;
4) culturing step 3) in reconstitution cell;
5) separation, purifying obtain high temperature resistant triose phosphate isomerase.
The present invention relates to the separation and the expression of the triose phosphate isomerase gene of thermophilc anaerobe.Based on Tengchong thermophilc anaerobe genome sequencing and analysis, clone and separate high temperature resistant triose phosphate isomerase gene.Use the transgenic microorganism or the animals and plants of the high temperature resistant triose phosphate isomerase of this genes produce, and reclaim the enzyme that obtains this genes encoding.In addition, the present invention also provides and has had active amino acid sequence of polypeptide of high temperature resistant triose phosphate isomerase and functional equivalent body.Simultaneously, the present invention also provides preparation, separates, and purifying has the method for the active polypeptide of high temperature resistant triose phosphate isomerase.
Description of drawings
Fig. 1 is an order-checking library construction flow chart of steps;
Fig. 2 is order-checking and data analysis schema.
Embodiment
The invention provides isolating, the encode nucleic acid molecule of the active polypeptide of high temperature resistant triose phosphate isomerase, this nucleic acid molecule has the nucleotide sequence shown in the SEQ.ID NO.1 by Tengchong thermophilc anaerobe genome sequencing and analysis are obtained.It has been encoded and has had that high temperature resistant triose phosphate isomerase is active 248 amino acid whose polypeptide, and the supposition molecular weight of this polypeptide is 27261 dalton.
The present invention also provides a kind of recombinant vectors, and this carrier comprises isolating nucleic acid molecule of the present invention, and the host cell that includes recombinant vectors.Simultaneously, the present invention includes the method that makes up this recombinant vectors and host cell, and utilize the recombined engineering technology to produce the method for high temperature resistant triose phosphate isomerase.
The present invention provides a kind of isolating high temperature resistant triose phosphate isomerase or polypeptide further, and it has the aminoacid sequence shown in the SEQ.IDNO.2, or at least 70% is similar, more preferably, have at least 90%, 95%, 99% identical.
In the present invention, " isolating " DNA is meant that this DNA or fragment have been arranged in its both sides under native state sequence separates, refer to that also this DNA or fragment with under the native state follow the component of nucleic acid to separate, and separate with the protein of in cell, following it.
In the present invention, " high temperature resistant triose phosphate isomerase gene " refers to encode and has the nucleotide sequence of the active polypeptide of high temperature resistant triose phosphate isomerase, as nucleotide sequence and the degenerate sequence thereof of SEQ.ID NO.1.This degenerate sequence be meant have one or more codons to be encoded in this sequence the degenerate codon of same amino acid replaces the back and the sequence that produces.Because the degeneracy of known codon, so be low to moderate about 70% the degenerate sequence described aminoacid sequence of SEQ ID NO.2 of also encoding out with SEQ IDNO.1 nucleotide sequence homology.This term also comprises can be under the rigorous condition of moderate, more preferably under highly rigorous condition with the nucleotide sequence of the nucleotide sequence hybridization of SEQ ID NO.1.This term also comprises and SEQ ID NO.1 nucleotide sequence homology 70% at least, preferably at least 80%, more preferably at least 90%, and at least 95% nucleotide sequence best.
In the present invention, " isolating " proteic polypeptide is meant that it accounts at least 20% of the total material of sample at least, preferably at least 50%, more preferably at least 80%, and at least 90% (by dry weight or weight in wet base) best.Purity can be measured with any suitable method, as uses column chromatography, and PAGE or HPLC method are measured the purity of polypeptide.Isolated polypeptide is substantially free of the component of following it under the native state.
In the present invention, " high temperature resistant triose phosphate isomerase " refers to have the active SEQ ID of high temperature resistant triose phosphate isomerase NO.2 polypeptide of sequence.This term also comprises the varient of SEQ ID NO.2 sequence, and these varients have and natural high temperature resistant triose phosphate isomerase identical functions.These varients include, but is not limited to several amino acid whose disappearances, insert and/or replace, and add one or several amino acid at C latter end and/or N-terminal, also can be the difference that does not influence on the modified forms of sequence.For example, for known in the field, when replacing, can not change proteinic function usually with the close or similar amino acid of performance.Again such as, add one or several amino acid at C latter end and/or N-terminal and also can not change proteinic function usually.This term also comprises the active fragments and the reactive derivative of high temperature resistant triose phosphate isomerase.
In the present invention, can select various carrier known in the art for use, as various plasmids, clay, phage and the retrovirus of selling on the market etc.When producing high temperature resistant triose phosphate isomerase of the present invention, high temperature resistant triose phosphate isomerase gene order operationally can be connected in expression regulation sequence, thereby form high temperature resistant triose phosphate isomerase expression vector.This expression vector contains replication origin and expression regulation sequence, promotor, enhanser and necessary machining information site.Expression vector also must contain alternative marker gene, as a) providing to microbiotic or other toxicant (penbritin, the protein or the b of resistance kantlex, methotrexate etc.)) complementary auxotroph protein or c) protein of the essential nutritive ingredient that does not have in the complex medium is provided.Various different hosts' appropriate flags gene is well known in the art or production firm's specification sheets indicates.These expression vectors can be with recombinant DNA technology known in those skilled in the art preparation, as can be with reference to people's such as Sambrook way (1989), or people's such as Ausubel way (1992).
Recombinant expression vector can be introduced host cell with method well known in the art, and these methods comprise: electrotransformation, Calcium Chloride Method, particle bombardment etc.The process that the external source recombinant vectors is imported host cell is called " conversion ".By cultivating host cell, induce the expression of desirable proteins, and by protein separation technology known in the art, obtain required protein as column chromatography etc.Also can adopt these protein of synthetic such as solid phase technique.
In the present invention, term " host cell " comprises prokaryotic cell prokaryocyte and eukaryotic cell.Prokaryotic cell prokaryocyte such as intestinal bacteria commonly used, Bacillus subtilus etc.Eukaryotic cell such as yeast cell commonly used, or various animal and plant cells.High temperature resistant triose phosphate isomerase full length gene sequence of the present invention or its fragment can be used PCR (polymerase chain reaction) TRAP usually, recombination method, or the method for synthetic obtains.For the pcr amplification method, can be disclosed according to the present invention relevant nucleotide sequence design primer, is template with the thermophilc anaerobe complete genome DNA of ordinary method preparation well known by persons skilled in the art, increases and obtains relevant sequence.In case obtained relevant sequence, just it can be cloned into relevant carrier, change host cell again over to, from the host cell after the propagation, separate obtaining large batch of relevant sequence then by ordinary method.
Below in conjunction with specific embodiment, further set forth the present invention.Should be understood that these embodiment only to be used to the present invention is described and be not used in and limit the scope of the invention.The experimental technique of unreceipted actual conditions in the following example, usually according to normal condition, people such as Sambrook for example, molecular cloning: laboratory manual (NewYork:Cold Spring Harbor Laboratory Press, 1989) condition described in, or the condition of advising according to manufacturer.
Embodiment 1: make up the order-checking library
The structure in order-checking library adopts full genome shotgun approach (shotgun) to carry out.At first cultivate the Tengchong thermophilc anaerobe, cultural method is pressed Marmur (1961) method and is collected bacterium by (Yanfen Xue, 2000) improved MB substratum (Balch et al., 1979), extracts total DNA.For the randomness of the library construction that guarantees to check order, farthest avoid producing the problem of breakage hot spot, that adopts several different methods, different condition builds the storehouse principle.Adopt earlier physics cutting method (comprise supersonic method and shear with Hydroshear Machine), next is selected for use AluI to carry out the random partial enzyme according to this bacterium genome signature and cuts.Adopt varying strength to handle sample when physics is sheared, handle sample by enzyme amount gradient is set when enzyme is cut.Sample after the processing adopts electrophoresis fraction collection 1.5-4kbDNA fragment after flat terminal the processing, be connected with the dephosphorylized pUC18 that cuts through the SmaI enzyme, connects product has made up random sequencing by electric Transformed E .coli DH5 α library.Simultaneously, (cut genomic dna in the order-checking library that has also made up long insertion fragment (about 10kb) for the ease of the later overlap joint of contig (contig) with Sau3AI random partial enzyme, electrophoresis is collected the fragment about 10kb, is connected, makes up the library with the dephosphorylized pUC18 that cuts through the BamHI enzyme).The order-checking of these two ends in library can obtain the relation between the contig (contig) in structure is finished the process of figure (finishing), and can solve the difficulty that cause filling-up hole in bigger hole (gap).Build storehouse flow process such as (see figure 1).
Embodiment 2: gene order-checking
When finishing the genomic order-checking of Tengchong thermophilc anaerobe, two kinds of full-automatic sequenator: ABI377 and MegaBACE 1000 have mainly been used.These two kinds of sequenators all are to utilize the principle of electrophoresis (see figure 2) that checks order, and can finish 96 samples at every turn.ABI377 is the product of ABI company, is a kind of of ABI series.It belongs to the plate gel electrophoresis sequenator.MegaBACE 1000 is products of Pharmacia Corp, belongs to the capillary gel electrophoresis sequenator.
Embodiment 3: data analysis
1) Basecalling and sequencing quality monitoring
So-called Basecalling is meant the process that obtains correct base sequence from the raw data file that sequenator obtains.Because that obtain on the sequenator is A, T, G, the light intensity variation track (trace) of the different wave length that four kinds of base pairs of C are answered need take certain algorithm therefrom correctly to identify the base of different track correspondences with computer.What we used is Phred software (Ewing B, Hillier L, 1998), and reason is that its result is more reliable, and other programs that its result exports in the same software package of being more convenient for are further analyzed.
Phred carries out the algorithm principle of Basecalling, is the shape according to each peak in the track, and spacing, and factor such as signal to noise ratio are judged the base type, simultaneously this base are provided reliability information, i.e. the sequencing quality of base.
In large scale sequencing, the monitoring of sequencing quality is crucial, and it directly influences the decision-making to order-checking, comprises the structure in library, the size of fraction of coverage.Can in time feed back the error that may occur in the order-checking experiment simultaneously.
2) sequence assembly
So-called sequence assembly, the sample sequence that full genome shotgun approach (claiming shotgun again) random sequencing is obtained is assembled into successive contig (contig) exactly, mainly utilizes the overlap between them for referencial use.Consider the influence that has carrier in the order-checking, need earlier sample sequence to be unloaded body and handle.Here used software cross match and the back used software Phrap of splicing are the software (Gordon D, Abajian C, 1998) of U.S. Washington university, and its ultimate principle is Swith-Waterman algorithm (WatermanMS, 1990).This is a kind of dynamic algorithm, after having considered the comparison between the sequence in twos, can obtain the publicly-owned sequence (consensus sequence) of one group of sequence.Sample sequence behind the removal carrier splices with Phrap again.In when splicing, the sequencing quality of base also has been considered, and the confidence level of resulting publicly-owned each base of sequence is calculated by the sequencing quality of the sample of forming this publicly-owned sequence.
3): gene annotation
After obtaining genomic most of sequence (frame diagram of finishing the work) substantially, just need carry out note, comprise and carry out open reading frame (Open Reading Frame, prediction ORF) genome, the prediction of gene function, and the segmental analysis of special RNA etc.
The first step adopts the GLIMMER2.0 (Delcher of default parameter, A.L., Harmon, D.1999) and ORPHEUS (Frishman, D.1998) software prediction gene coded sequence, open frame and the non-coding region (intergenic region) of all predictions all use BLAST software (Altschul, S.F.et al.1997) and the irredundant albumen database (non-redundant proteindatabase) of NCBI (American National biotechnology information center) relatively to find the gene that may miss then.When judging the starting point of a gene, will be with reference to various relevant informations, as sequence homology, ribosome bind site, possible signal peptide sequence and promoter sequence etc.If when in an open reading frame, a plurality of promotor occurring, generally adopt the starting point of first promotor as gene.(Ermolaeva M.D.2000) predicts the transcription terminator that does not rely on Rho (ρ) factor at non-coding region to adopt TransTerm software.If this terminator be positioned at a gene the catchment too at a distance, then may hint a minigene lose or the mistake that checks order has shortened this gene artificially, can be used as the reference of further analysis.When determining to move frame sudden change and point mutation, main basis is judged with the proteinic similarity in the database.If protein is corresponding to the situation of two encoding sequences adjacent one another are, then be considered to a non-activity gene (pseudogene seudogenes), produce the abort phenomenon because this illustrates between these two encoding sequences owing to suddenling change, and then gene is lost activity.All analytical resultss use Artemis sequence viewer software (Rutherford, K.et al.2000) to carry out manual analysis again.Some are obviously shown eclipsed with other code sequence and open frame, and length does not have homology and wherein do not have tangible promotor or open reading frame that termination is regional will be removed less than 150 base pairs and in the data with existing storehouse.
Proteinic function fragment (motif) and functional area (domain) employing and Pfam, PRINTS, PROSITE, ProDom and SMART database respectively compare, the result uses InterPro database (Apweiler, R.et al.2001) to carry out Macro or mass analysis again.According to the COGs database (Tatusov, R.L.et al.2001) of NCBI and with reference to other result of querying database determine protein in the COGs classification functional classification and possible pathways metabolism.Confirm membranin, abc transport albumen and stride the film functional domain with TMHMM software (Krogh, A.et al.2001).The employing Gram-negative bacteria is a parameter, with SIGNALP2.0 software (Nielsen, H.et al.1999) analytical signal peptide zone.
4) filling-up hole
After finishing genomic work frame chart, will carry out the filling-up hole work of difficulty more, promptly finish the order-checking of whole genome 100%, obtain an annular genome.Groundwork is exactly that the contig that obtains is previously coupled together.Main method comprises:
A. utilize the forward and reverse order-checking sample message in the order-checking
In the order-checking process, we have carried out two-way order-checking to some sample intentionally, check order simultaneously promptly that certain inserts segmental two ends, institute's calling sequence are spliced with other sequences again.Because the relation of this a pair of sequence on genome is certain, distance between them is roughly known, according to this information, one can confirm whether certain section contig is reliable, the 2nd, when this a pair of sequence lays respectively on the different contig, can determine direction relations and the position relation of these two contig, for further contrived experiment provides reference.
B. long fragment and equipment type carrier clay (Cosmid) end sequencing of inserting
Based on same principle, we can make up the insertion fragment library of different lengths, and only to its two ends order-checking, its particular location is analyzed in splicing then.These libraries comprise that length is the long Cosmid library of inserting about sheet phase library and 20-40Kb of 9-12Kb.Specific analytical method is same as above.
C.PCR and terminal extend (Walking) test
The direction of the contig that is provided according to above-mentioned steps A and B and position relation, further Biochemistry Experiment just can have been carried out.As design a pair of primer and carry out pcr amplification, or carry out end extension (Walking) with a certain contig end sequence synthetic primer and come filling-up hole etc.
Embodiment 4: the preparation of triose phosphate isomerase and purification
The triose phosphate isomerase full length gene encoding sequence (SEQID NO.1) that obtains according to gene annotation among the embodiment, design and to amplify the primer that complete coding is read frame, and on positive anti-primer, introduce restriction endonuclease sites respectively, so that construction of expression vector.Plasmid DNA with the order-checking library that obtains among the embodiment 1 is a template, behind pcr amplification, guarantee to read recombinate under the correct prerequisite of frame to the pGEX-2T carrier (Pharmacia, Piscataway, NJ).Again recombinant vectors is transformed into that (method for transformation is CaCL in the bacillus coli DH 5 alpha
2Method or electrotransformation).The engineering bacteria DH5 α-pGEX-2T-TpiA that contains expression vector that Screening and Identification obtains.
The engineering bacteria DH5 α-pGEX-2T-TpiA of picking list bacterium colony contains in the LB substratum of 100 μ g/ml penbritins jolting in 3ml and cultivates 37 ℃ and spend the night, draw nutrient solution by 1: 100 concentration and in new LB substratum (containing 100 μ g/ml penbritins), cultivated about 3 hours, to OD
600After reaching 0.5, add IPTG, continue at 37 ℃ and cultivated respectively 0,1,2,3 hours to final concentration 1mmol/L.It is centrifugal to get the different 1ml bacterium liquid of incubation time, in the bacterial precipitation thing, add lysate (2 * SDS sample-loading buffer, 50 μ l, distilled water 45 μ l, 3-mercaptoethanol 5 μ l), the suspendible bacterial precipitation, boiled in the boiling water bath 5 minutes, centrifugal 1 minute of 10000rpm, supernatant adds electrophoresis in the 12%SDS-PAGE glue.The bacterial strain that the protein content of dyeing back observation expection molecular weight size increases with the IPTG induction time is the engineering bacteria of expressing desirable proteins.
As stated above behind the engineering bacteria of abduction delivering desirable proteins, with bacterium centrifugation, add 50% saturated Triptide Sepharose 4B of 20ml PBS by every 400ml bacterium, 37 ℃ of joltings were in conjunction with 30 minutes, 10000rpm precipitated the Triptide Sepharose 4B that combines desirable proteins in centrifugal 10 minutes, abandoned supernatant.Add 100 μ l reduced glutathione elutriants by every milliliter of ultrasonic liquid gained precipitation, room temperature was put 10 minutes, and supernatant is the albumen of wash-out.Repeat twice of wash-out.The supernatant of wash-out is stored in-80 ℃, and carries out SDS-PAGE SEQ ID NO.1 electrophoresis, detects purification effect.Protein band at 27261 dalton place is the triose phosphate isomerase.
1、EQIDNO.1 ( 1 ) :a.:747b.:DNAc.:d.: ( 2 ) : ( 3 ) :ttgagaaggcctataattgcaggaaattggaaaatgcataagaccccttcagaggcagtgaaattggtagaagagctgattcctctaghaaaagatgcaaaagccgaagtagtagtaattcccccttttgtagatttgacagaagttgctagagtcataaaaggtactaatatattgctgggagcacaaaacatgttctgggaagaaaagggggcttacacaggagaaatttcacctgtaatgctaaaagaaataggagtaacttatgtggtaattggccattctgaaagaaggcagtattttaaagagacagatgaaatggtgaataaaaaagtgttgtctgccctttcacacgatttaaaacctatcgtctgtgtaggagaatctctttctcaaagagaggaaggaaaaacttacgatgtagttttaactcagacaagggaagctttaaaaggcgtatctgaggaagatataacaaaagtagtcatcgcttatgagcctgtttgggcaatagggacgggtaaaaatgctactccacaggacgccaatgaggttataaaagctataaggaatacaatagcagaactttatgggaaagataaggctgaaatggtgagaatacagtacggaggaagtgtgaaacctgataacatctctggtttcatggcagaaagcgatatagacggagctttggttggcggtgccagccttgtggctgaggattttgcaaagattgtgaattactaa2.SEQ ID NO.2 ( 1 ) :a.:248b.:c.:d.: ( 2 ) : ( 3 ) LRRPIIAGNWKMHKTPSEAVKLVEELIPLVKDAKAEVVVIPPFVDLTEVARVIKGTNILLGAQNMFWEEKGAYTGEISPVMLKEIGVTYVVIGHSERRQYFKETDEMVNKKVLSALSHDLKPIVCVGESLSQREEGKTYDVVLTQTREALKGVSEEDITKVVIAYEPVWAIGTGKNATPQDANEVIKAIRNTIAELYGKDKAEMVRIQYGGSVKPDNISGFMAESDIDGALVGGASLVAEDFAKIVNY
Claims (8)
1. an isolated DNA molecule is characterized in that: be the nucleotide sequence that coding has the polypeptide of high temperature resistant triose phosphate isomerase protein-active.
2. dna molecular as claimed in claim 1, it is characterized in that: the polypeptide of the aminoacid sequence among the said nucleotide sequence coded SEQ.ID of the having NO.2 or the modified forms of this polypeptide, on this modified forms function quite or relevant with high temperature resistant triose phosphate isomerase.
3. dna molecular as claimed in claim 1 is characterized in that: said nucleotide sequence has the polynucleotide sequence of SEQ ID NO.1 and its mutant form, and mutation type comprises: disappearance, nonsense, insertion, missense.
4. polypeptide separated, it is characterized in that: it has high temperature resistant triose phosphate isometry enzymic activity.
5. polypeptide as claimed in claim 4 is characterized in that: it has polypeptide or its conservative property variation polypeptide or its active fragments or its reactive derivative of the aminoacid sequence among the SEQ ID No.2.
6. carrier, it is characterized in that: it contains the DNA in the claim 1.
7. host cell is characterized in that: it is prokaryotic cell prokaryocyte or the eukaryotic cell that transforms with the described carrier of claim 6.
8. a method for preparing high temperature resistant triose phosphate isomerase is characterized in that this method comprises the steps:
1) isolate the coding high temperature resistant triose phosphate isomerase gene nucleotide sequence SEQ IDNO.1;
2) structure contains the expression vector of the nucleotide sequence of SEQ ID NO.1;
3) with step 2) in expression vector change host cell over to, form the reconstitution cell can produce high temperature resistant triose phosphate isomerase;
4) culturing step 3) in reconstitution cell;
5) separation, purifying obtain high temperature resistant triose phosphate isomerase.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN01145562A CN1366058A (en) | 2001-12-27 | 2001-12-27 | Refractory triosephosphate isomerase gene and its polypeptide coded by it and preparing process |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN01145562A CN1366058A (en) | 2001-12-27 | 2001-12-27 | Refractory triosephosphate isomerase gene and its polypeptide coded by it and preparing process |
Publications (1)
Publication Number | Publication Date |
---|---|
CN1366058A true CN1366058A (en) | 2002-08-28 |
Family
ID=4678237
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN01145562A Pending CN1366058A (en) | 2001-12-27 | 2001-12-27 | Refractory triosephosphate isomerase gene and its polypeptide coded by it and preparing process |
Country Status (1)
Country | Link |
---|---|
CN (1) | CN1366058A (en) |
-
2001
- 2001-12-27 CN CN01145562A patent/CN1366058A/en active Pending
Similar Documents
Publication | Publication Date | Title |
---|---|---|
CN1418954A (en) | High temp. resistant HSP 70 molecular chaperone and coded polypeptide and preparation process thereof | |
CN1420172A (en) | High-temp resistant CTP synthetase gene, polypeptide coded therewith and preparing method thereof | |
CN1366059A (en) | Refractory phosphomannose isomerase gene and its polypeptide coded by it and preparing process | |
CN1371996A (en) | High-temperature resistant spermidine synthase gene sequence, polypeptide coded by same and method for preparing polypeptide | |
CN1198928C (en) | High-temperature resistant ribosomal protein L15 gene and its coded polypeptide and preparing process | |
CN1366058A (en) | Refractory triosephosphate isomerase gene and its polypeptide coded by it and preparing process | |
CN1417338A (en) | High temperature-resisting DNA polymerase gene sequence and its encoded polypeptide and prepn process | |
CN1164750C (en) | High-temperature resistant transaldolase gene, polypeptide coded by same and preparation method of polypeptide | |
CN1367249A (en) | High-temp. resistant chorismate synthase gene and its coded polypeptide and preparation method | |
CN1390943A (en) | High-temp. resistant 6-phosphoglucose isomerase gene and its coded polypeptide and preparing process | |
CN1366054A (en) | Refractory glutaminic acid imine methyltransferase gene and its polypeptide coded by it and preparing process | |
CN1367250A (en) | High-temperature-resistant isocitrate dehydrogenase gene, polypeptide coded by same and preparation method of polypeptide | |
CN1420175A (en) | High-tamp. resistant threonine synthetase gene, polypeptide coded therewith and preparing method thereof | |
CN1379103A (en) | High-temperature resistant glucan phosphorylase gene and polypeptide coded by same and preparation method | |
CN1379097A (en) | Refractory phosphoglyceromutase 1 gene and its polypeptide coded by it and preparing process | |
CN1364907A (en) | High-temperature-resistant methylglyoxal synthase gene sequence, encoded polypeptide and preparation method | |
CN1379102A (en) | Refractory S-adenosylmethionine synthetase gene and its polypeptide coded by it and preparing process | |
CN1379094A (en) | High-temperature-resistant tyrosyl tRNA synthetase gene, polypeptide coded by same and preparation method | |
CN1371997A (en) | High-temp. resistant dihydroorotate dehydrogenase gene sequence and its coded polypeptide and preparing process | |
CN1420173A (en) | High-temp. resistant biotin synthetase gene, polypeptide coded therewith and preparing method thereof | |
CN1420174A (en) | High-temp. resistant 6-phosphofructokinase gene, polypeptide coded therewith and preparing method thereof | |
CN1379100A (en) | High-temp. resistant dihydroorotate synthase gene and its coded polypeptide and preparing method | |
CN1367251A (en) | High-temperature-resistant spermine succinic lyase gene and polypeptide coded by same and preparation method | |
CN1418957A (en) | High temp. resistant acetyl-coA carboxylase gene and coded polypeptide and preparation process thereof | |
CN1371998A (en) | High-temp. resistant guanosine triphosphate cyclic hydrolase gene sequence and its coded polypeptide and preparation method |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
C06 | Publication | ||
PB01 | Publication | ||
C10 | Entry into substantive examination | ||
SE01 | Entry into force of request for substantive examination | ||
C12 | Rejection of a patent application after its publication | ||
RJ01 | Rejection of invention patent application after publication |