CN117924450A - Transcription factor CIB1 and application of coding gene thereof - Google Patents
Transcription factor CIB1 and application of coding gene thereof Download PDFInfo
- Publication number
- CN117924450A CN117924450A CN202410170561.XA CN202410170561A CN117924450A CN 117924450 A CN117924450 A CN 117924450A CN 202410170561 A CN202410170561 A CN 202410170561A CN 117924450 A CN117924450 A CN 117924450A
- Authority
- CN
- China
- Prior art keywords
- cib1
- transcription factor
- desmodium styracifolium
- coding gene
- plant
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Granted
Links
- 108091023040 Transcription factor Proteins 0.000 title claims abstract description 65
- 102000040945 Transcription factor Human genes 0.000 title claims abstract description 65
- 108090000623 proteins and genes Proteins 0.000 title claims abstract description 42
- 102100032216 Calcium and integrin-binding protein 1 Human genes 0.000 title claims abstract description 27
- 101000943475 Homo sapiens Calcium and integrin-binding protein 1 Proteins 0.000 title claims abstract 21
- 244000227573 Desmodium styracifolium Species 0.000 claims abstract description 72
- 241000196324 Embryophyta Species 0.000 claims abstract description 61
- 230000012010 growth Effects 0.000 claims abstract description 20
- 230000001737 promoting effect Effects 0.000 claims abstract description 20
- 235000006200 Glycyrrhiza glabra Nutrition 0.000 claims abstract description 14
- 238000009395 breeding Methods 0.000 claims abstract description 14
- 230000001488 breeding effect Effects 0.000 claims abstract description 14
- 244000303040 Glycyrrhiza glabra Species 0.000 claims abstract description 9
- 125000003275 alpha amino acid group Chemical group 0.000 claims abstract description 9
- LPLVUJXQOOQHMX-QWBHMCJMSA-N glycyrrhizinic acid Chemical compound O([C@@H]1[C@@H](O)[C@H](O)[C@H](O[C@@H]1O[C@@H]1C([C@H]2[C@]([C@@H]3[C@@]([C@@]4(CC[C@@]5(C)CC[C@@](C)(C[C@H]5C4=CC3=O)C(O)=O)C)(C)CC2)(C)CC1)(C)C)C(O)=O)[C@@H]1O[C@H](C(O)=O)[C@@H](O)[C@H](O)[C@H]1O LPLVUJXQOOQHMX-QWBHMCJMSA-N 0.000 claims abstract description 8
- 235000011477 liquorice Nutrition 0.000 claims abstract description 8
- 230000002018 overexpression Effects 0.000 claims description 15
- 239000002773 nucleotide Substances 0.000 claims description 12
- 125000003729 nucleotide group Chemical group 0.000 claims description 12
- 239000013604 expression vector Substances 0.000 claims description 9
- 238000000034 method Methods 0.000 claims description 9
- 239000013598 vector Substances 0.000 claims description 9
- 241000894006 Bacteria Species 0.000 claims description 6
- 235000001453 Glycyrrhiza echinata Nutrition 0.000 claims description 6
- 235000017382 Glycyrrhiza lepidota Nutrition 0.000 claims description 6
- 229940010454 licorice Drugs 0.000 claims description 6
- 230000001976 improved effect Effects 0.000 claims description 5
- 230000014509 gene expression Effects 0.000 claims description 3
- 230000008635 plant growth Effects 0.000 claims description 3
- 241000894007 species Species 0.000 abstract description 3
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Chemical compound O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 11
- 239000007788 liquid Substances 0.000 description 9
- 241000589156 Agrobacterium rhizogenes Species 0.000 description 6
- 239000002609 medium Substances 0.000 description 6
- 229930000044 secondary metabolite Natural products 0.000 description 6
- 241000202807 Glycyrrhiza Species 0.000 description 5
- 230000001580 bacterial effect Effects 0.000 description 5
- 230000015572 biosynthetic process Effects 0.000 description 5
- 230000002786 root growth Effects 0.000 description 5
- 239000000725 suspension Substances 0.000 description 5
- 238000003786 synthesis reaction Methods 0.000 description 5
- 241000589158 Agrobacterium Species 0.000 description 4
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 4
- 238000011161 development Methods 0.000 description 4
- 230000018109 developmental process Effects 0.000 description 4
- 239000000047 product Substances 0.000 description 4
- 239000007787 solid Substances 0.000 description 4
- 108010027344 Basic Helix-Loop-Helix Transcription Factors Proteins 0.000 description 3
- 102000018720 Basic Helix-Loop-Helix Transcription Factors Human genes 0.000 description 3
- 239000012634 fragment Substances 0.000 description 3
- 239000001963 growth medium Substances 0.000 description 3
- 102000004169 proteins and genes Human genes 0.000 description 3
- 238000011144 upstream manufacturing Methods 0.000 description 3
- 102100030988 Angiotensin-converting enzyme Human genes 0.000 description 2
- 241000219195 Arabidopsis thaliana Species 0.000 description 2
- 102100032214 Calcium and integrin-binding family member 4 Human genes 0.000 description 2
- 102100026280 Cryptochrome-2 Human genes 0.000 description 2
- 241000522190 Desmodium Species 0.000 description 2
- 240000008917 Glycyrrhiza uralensis Species 0.000 description 2
- 235000000554 Glycyrrhiza uralensis Nutrition 0.000 description 2
- 101000943460 Homo sapiens Calcium and integrin-binding family member 4 Proteins 0.000 description 2
- 101000855613 Homo sapiens Cryptochrome-2 Proteins 0.000 description 2
- TWRXJAOTZQYOKJ-UHFFFAOYSA-L Magnesium chloride Chemical compound [Mg+2].[Cl-].[Cl-] TWRXJAOTZQYOKJ-UHFFFAOYSA-L 0.000 description 2
- AIGAZQPHXLWMOJ-UHFFFAOYSA-N Tanshinone I Chemical compound C1=CC2=C(C)C=CC=C2C(C(=O)C2=O)=C1C1=C2C(C)=CO1 AIGAZQPHXLWMOJ-UHFFFAOYSA-N 0.000 description 2
- 239000003242 anti bacterial agent Substances 0.000 description 2
- 229940088710 antibiotic agent Drugs 0.000 description 2
- 238000006243 chemical reaction Methods 0.000 description 2
- 238000010367 cloning Methods 0.000 description 2
- 239000002299 complementary DNA Substances 0.000 description 2
- 230000001276 controlling effect Effects 0.000 description 2
- 238000012258 culturing Methods 0.000 description 2
- 238000001514 detection method Methods 0.000 description 2
- 230000002068 genetic effect Effects 0.000 description 2
- 238000010353 genetic engineering Methods 0.000 description 2
- 239000005457 ice water Substances 0.000 description 2
- 238000004519 manufacturing process Methods 0.000 description 2
- 238000002844 melting Methods 0.000 description 2
- 230000008018 melting Effects 0.000 description 2
- 238000002156 mixing Methods 0.000 description 2
- 239000000203 mixture Substances 0.000 description 2
- 238000010369 molecular cloning Methods 0.000 description 2
- 230000000877 morphologic effect Effects 0.000 description 2
- 229910052757 nitrogen Inorganic materials 0.000 description 2
- 230000001105 regulatory effect Effects 0.000 description 2
- 238000012163 sequencing technique Methods 0.000 description 2
- 239000008223 sterile water Substances 0.000 description 2
- 239000006228 supernatant Substances 0.000 description 2
- 238000012546 transfer Methods 0.000 description 2
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 1
- 241000589155 Agrobacterium tumefaciens Species 0.000 description 1
- 102100035765 Angiotensin-converting enzyme 2 Human genes 0.000 description 1
- 108090000975 Angiotensin-converting enzyme 2 Proteins 0.000 description 1
- 108700009971 Arabidopsis CIB1 Proteins 0.000 description 1
- 101100325958 Arabidopsis thaliana BHLH76 gene Proteins 0.000 description 1
- 101100325959 Arabidopsis thaliana BHLH77 gene Proteins 0.000 description 1
- 101100438273 Arabidopsis thaliana CAN1 gene Proteins 0.000 description 1
- 101100401088 Arabidopsis thaliana MES10 gene Proteins 0.000 description 1
- JMGZEFIQIZZSBH-UHFFFAOYSA-N Bioquercetin Natural products CC1OC(OCC(O)C2OC(OC3=C(Oc4cc(O)cc(O)c4C3=O)c5ccc(O)c(O)c5)C(O)C2O)C(O)C(O)C1O JMGZEFIQIZZSBH-UHFFFAOYSA-N 0.000 description 1
- 101100125371 Caenorhabditis elegans cil-1 gene Proteins 0.000 description 1
- 241000233779 Cyclocarya paliurus Species 0.000 description 1
- 108020004414 DNA Proteins 0.000 description 1
- 102000016928 DNA-directed DNA polymerase Human genes 0.000 description 1
- 108010014303 DNA-directed DNA polymerase Proteins 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 241000588724 Escherichia coli Species 0.000 description 1
- 241000620209 Escherichia coli DH5[alpha] Species 0.000 description 1
- 244000130270 Fagopyrum tataricum Species 0.000 description 1
- 235000014693 Fagopyrum tataricum Nutrition 0.000 description 1
- 101000636213 Homo sapiens Transcriptional activator Myb Proteins 0.000 description 1
- 101150014898 IBH1 gene Proteins 0.000 description 1
- 102000003960 Ligases Human genes 0.000 description 1
- 108090000364 Ligases Proteins 0.000 description 1
- 101100378100 Mus musculus Ace3 gene Proteins 0.000 description 1
- 101150086396 PRE1 gene Proteins 0.000 description 1
- 244000131316 Panax pseudoginseng Species 0.000 description 1
- 235000005035 Panax pseudoginseng ssp. pseudoginseng Nutrition 0.000 description 1
- 235000003140 Panax quinquefolius Nutrition 0.000 description 1
- 108090000882 Peptidyl-Dipeptidase A Proteins 0.000 description 1
- 108020005089 Plant RNA Proteins 0.000 description 1
- 244000061632 Prinsepia uniflora Species 0.000 description 1
- 235000008997 Prinsepia uniflora Nutrition 0.000 description 1
- 101150075111 ROLB gene Proteins 0.000 description 1
- 101150013395 ROLC gene Proteins 0.000 description 1
- 240000001341 Reynoutria japonica Species 0.000 description 1
- 235000018167 Reynoutria japonica Nutrition 0.000 description 1
- 240000007164 Salvia officinalis Species 0.000 description 1
- 240000004534 Scutellaria baicalensis Species 0.000 description 1
- 235000017089 Scutellaria baicalensis Nutrition 0.000 description 1
- 229930183118 Tanshinone Natural products 0.000 description 1
- 108090001039 Transcription factor AP-2 Proteins 0.000 description 1
- 102000004893 Transcription factor AP-2 Human genes 0.000 description 1
- 238000009825 accumulation Methods 0.000 description 1
- 239000011543 agarose gel Substances 0.000 description 1
- 229930013930 alkaloid Chemical class 0.000 description 1
- 238000000137 annealing Methods 0.000 description 1
- 230000008485 antagonism Effects 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 238000010805 cDNA synthesis kit Methods 0.000 description 1
- 238000003776 cleavage reaction Methods 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 238000004925 denaturation Methods 0.000 description 1
- 230000036425 denaturation Effects 0.000 description 1
- 238000010586 diagram Methods 0.000 description 1
- 230000000694 effects Effects 0.000 description 1
- IVTMALDHFAHOGL-UHFFFAOYSA-N eriodictyol 7-O-rutinoside Natural products OC1C(O)C(O)C(C)OC1OCC1C(O)C(O)C(O)C(OC=2C=C3C(C(C(O)=C(O3)C=3C=C(O)C(O)=CC=3)=O)=C(O)C=2)O1 IVTMALDHFAHOGL-UHFFFAOYSA-N 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 229930003935 flavonoid Natural products 0.000 description 1
- 150000002215 flavonoids Chemical class 0.000 description 1
- 235000017173 flavonoids Nutrition 0.000 description 1
- 230000004883 flower formation Effects 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 235000008434 ginseng Nutrition 0.000 description 1
- 238000000227 grinding Methods 0.000 description 1
- -1 grown under light Substances 0.000 description 1
- 230000006801 homologous recombination Effects 0.000 description 1
- 238000002744 homologous recombination Methods 0.000 description 1
- 239000005556 hormone Substances 0.000 description 1
- 229940088597 hormone Drugs 0.000 description 1
- 238000005286 illumination Methods 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 239000000411 inducer Substances 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 230000002401 inhibitory effect Effects 0.000 description 1
- 230000000977 initiatory effect Effects 0.000 description 1
- 229920005610 lignin Polymers 0.000 description 1
- 229910001629 magnesium chloride Inorganic materials 0.000 description 1
- 230000037353 metabolic pathway Effects 0.000 description 1
- 239000002207 metabolite Substances 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 239000013642 negative control Substances 0.000 description 1
- 239000013612 plasmid Substances 0.000 description 1
- 239000013641 positive control Substances 0.000 description 1
- 239000000843 powder Substances 0.000 description 1
- 238000012257 pre-denaturation Methods 0.000 description 1
- 238000000899 pressurised-fluid extraction Methods 0.000 description 1
- 238000002818 protein evolution Methods 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- FDRQPMVGJOQVTL-UHFFFAOYSA-N quercetin rutinoside Natural products OC1C(O)C(O)C(CO)OC1OCC1C(O)C(O)C(O)C(OC=2C(C3=C(O)C=C(O)C=C3OC=2C=2C=C(O)C(O)=CC=2)=O)O1 FDRQPMVGJOQVTL-UHFFFAOYSA-N 0.000 description 1
- 239000002994 raw material Substances 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 235000005412 red sage Nutrition 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 230000003938 response to stress Effects 0.000 description 1
- 238000010839 reverse transcription Methods 0.000 description 1
- IKGXIBQEEMLURG-BKUODXTLSA-N rutin Chemical compound O[C@H]1[C@H](O)[C@@H](O)[C@H](C)O[C@@H]1OC[C@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](OC=2C(C3=C(O)C=C(O)C=C3OC=2C=2C=C(O)C(O)=CC=2)=O)O1 IKGXIBQEEMLURG-BKUODXTLSA-N 0.000 description 1
- ALABRVAAKCSLSC-UHFFFAOYSA-N rutin Natural products CC1OC(OCC2OC(O)C(O)C(O)C2O)C(O)C(O)C1OC3=C(Oc4cc(O)cc(O)c4C3=O)c5ccc(O)c(O)c5 ALABRVAAKCSLSC-UHFFFAOYSA-N 0.000 description 1
- 235000005493 rutin Nutrition 0.000 description 1
- 229960004555 rutoside Drugs 0.000 description 1
- 230000007017 scission Effects 0.000 description 1
- 230000024053 secondary metabolic process Effects 0.000 description 1
- 230000035939 shock Effects 0.000 description 1
- 238000002791 soaking Methods 0.000 description 1
- 239000000126 substance Substances 0.000 description 1
- 150000003505 terpenes Chemical class 0.000 description 1
- 235000007586 terpenes Nutrition 0.000 description 1
- 238000013518 transcription Methods 0.000 description 1
- 230000035897 transcription Effects 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/415—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from plants
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/82—Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
- C12N15/8241—Phenotypically and genetically modified plants via recombinant DNA technology
- C12N15/8261—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Genetics & Genomics (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Molecular Biology (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biophysics (AREA)
- Biotechnology (AREA)
- General Engineering & Computer Science (AREA)
- General Health & Medical Sciences (AREA)
- Biomedical Technology (AREA)
- Biochemistry (AREA)
- Wood Science & Technology (AREA)
- Zoology (AREA)
- Physics & Mathematics (AREA)
- Microbiology (AREA)
- Plant Pathology (AREA)
- Cell Biology (AREA)
- Botany (AREA)
- Gastroenterology & Hepatology (AREA)
- Medicinal Chemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Breeding Of Plants And Reproduction By Means Of Culturing (AREA)
Abstract
The invention discloses desmodium styracifolium transcription factor CIB1 and application of a coding gene thereof, wherein the amino acid sequence of the desmodium styracifolium transcription factor CIB1 is shown as SEQ ID NO. 2. The invention discovers that desmodium styracifolium transcription factor CIB1 can promote the hairy roots of desmodium styracifolium and liquorice to be obviously enlarged and grow obviously faster, so that the desmodium styracifolium transcription factor CIB1 and the coding gene thereof have important application prospects in promoting the growth of the hairy roots of desmodium styracifolium, liquorice and other plants and in molecular breeding for cultivating new plant species with hairy roots growing in high quality and high yield.
Description
Technical Field
The invention belongs to the technical field of biology, relates to plant genetic engineering technology, and in particular relates to application of a transcription factor CIB1 and a coding gene thereof in promoting growth of hairy roots of plants.
Background
The hairy root has the characteristics of stable genetic property, rapid growth and short growth time. In the plant field, the hairy root can realize mass production of secondary metabolites of key medicinal components of plants, so that the hairy root of the plants is a natural high-quality raw material of the medicinal components and can synthesize secondary metabolites of flavonoids, alkaloids, terpenes and the like. Up to now, more than 100 plants are available to obtain hairy roots, mainly dicotyledonous plants, with fewer monocotyledonous plants. In the field of medicinal plants, such as baikal skullcap root, tuber fleeceflower root, kuh-seng, ginseng, licorice, single body, stramonium and the like, hairy root culture systems have been established, and even hairy roots of some medicinal plants enter a mass production stage.
At present, people mainly improve the content of secondary metabolites in hairy roots by changing the external conditions of hairy root culture, such as the pH value of a culture medium, the components of the culture medium, illumination, temperature, exogenous hormones, inducers and the like. However, the methods of changing these conventional external growth environments are often limited by genetic factors of plants themselves, resulting in limited effects of increasing the secondary metabolite content in many hairy roots of plants.
Because of the complex secondary metabolism of plants, overexpression of one or more synthetases solely by hairy roots often fails to synthesize large quantities of secondary metabolites. Transcription factors can regulate the transcription of genes in multiple metabolic pathways simultaneously, so that the accumulation of metabolites is better improved. For example, transcription factor MYBs regulates tanshinone synthesis in hairy roots of red sage root, transcription factor ZIP promotes rutin synthesis in hairy roots of tartary buckwheat, and transcription factor AP2/ERF promotes Bai Langen lignin synthesis.
The basic-helix-loop-helix bHLH protein is a transcription factor superfamily, and plays an important role in regulating and controlling the growth and development of plants and stress response species. CIB1 (cryptochrome-INTERACTING BASIC-helix-loop-helix 1) is a protein which can interact with cryptoanthocyanin CRY2 in blue light specificity for the first time in plants, and CIB1 depends on CRY2 to regulate and control the initiation of flower formation.
CIB1 of Arabidopsis thaliana can be combined with a G-box (CANNTG) gene sequence with high affinity in vitro. CIL, CIL2, CIB4 and CIB5 in the CIB protein evolution branch have been reported in literature to be involved in cell elongation and growth, CIL1 is named ACE1, CIB4 is named ACE2, and CIL2 is named ACE3.ACEs form bHLH triple antagonism system with PRE1 (HLH protein for promoting growth signal) and IBH1 (HLH factor for inhibiting cell elongation) to control cell elongation. However, studies using CIB1 transcription factor are currently focused mainly on arabidopsis thaliana, and most of them are flower-forming studies of arabidopsis thaliana. However, the research on regulating and controlling plant hairy root growth by CIB1 has not been reported so far, which limits the industrialized development of plant hairy root and the development of secondary metabolite synthesis and improved plant varieties.
Disclosure of Invention
Based on the above, the invention aims to provide application of desmodium styracifolium transcription factor CIB1 and a coding gene thereof, wherein the desmodium styracifolium transcription factor CIB1 and the coding gene thereof can remarkably promote growth of hairy roots of plants.
The technical scheme for realizing the aim of the invention comprises the following steps.
In a first aspect, the invention provides application of desmodium styracifolium transcription factor CIB1 in promoting growth of plant hairy roots or molecular breeding of plant hairy roots, wherein the amino acid sequence of the desmodium styracifolium transcription factor CIB1 is shown as SEQ ID NO. 2.
In a second aspect of the invention, the application of the coding gene of desmodium styracifolium transcription factor CIB1 in promoting plant hairy root growth or plant hairy root molecular breeding is provided, wherein the nucleotide sequence of the coding gene of desmodium styracifolium transcription factor CIB1 is shown as SEQ ID NO. 1.
In a third aspect, the invention provides an application of an overexpression vector of the desmodium styracifolium transcription factor CIB1 coding gene in promoting plant hairy root growth or plant hairy root molecular breeding.
In a fourth aspect, the invention provides the application of the genetically engineered bacterium transformed with the overexpression vector of the coding gene of desmodium styracifolium transcription factor CIB1 in promoting the growth of hairy roots of plants or the molecular breeding of hairy roots of plants.
In a fifth aspect of the present invention, there is provided a method of promoting growth of hairy roots of plants comprising the steps of: the expression of desmodium styracifolium transcription factor CIB1 or the coding gene of desmodium styracifolium transcription factor CIB1 in plants is improved.
The invention has the following beneficial effects:
the inventor firstly clones and obtains the coding gene of desmodium styracifolium (Grona styracifolia (Osbeck) H.ohashi & K.ohashi) transcription factor CIB1, then constructs a vector for over-expressing the coding gene of desmodium styracifolium transcription factor CIB1, transfers the vector into agrobacterium rhizogenes K599 to obtain a genetic engineering bacterium of the over-expression vector, and then induces desmodium styracifolium and liquorice to grow hairy roots, so that the desmodium styracifolium and liquorice hairy roots are found to be obviously enlarged and obviously grow faster, and therefore, the desmodium styracifolium transcription factor CIB1 and the coding gene thereof have important application prospects in promoting the growth of the hairy roots of desmodium styracifolium, liquorice and other plants and the molecular breeding for cultivating new plant species with hairy roots high quality and high yield development, and a feasible method is provided for plant hairy root application.
Drawings
FIG. 1 is a phylogenetic diagram of desmodium styracifolium transcription factor CIB1 and other CIB family members in example 1 of the present invention.
FIG. 2 is a chart of PCR identification of desmodium styracifolium and licorice hairy roots in example 3 of the present invention.
FIG. 3 is a morphological feature of inducing desmodium styracifolium and licorice hairy roots for 1 month in example 3 of the present invention.
Detailed Description
The present invention will be described more fully hereinafter in order to facilitate an understanding of the present invention. This invention may be embodied in many different forms and is not limited to the embodiments described herein. Rather, these embodiments are provided so that this disclosure will be thorough and complete.
The experimental methods, which are not specified in the following examples, are generally carried out according to conventional conditions, such as Green and Sambrook-s.A.fourth edition, molecular cloning, instruction manual (Molecular Cloning: ALaboratory Manual), published in 2013, or according to the conditions recommended by the manufacturer. The various chemicals commonly used in the examples are commercially available.
Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. The terminology used in the description of the invention herein is for the purpose of describing particular embodiments only and is not intended to be limiting of the invention. The term "and/or" as used herein includes any and all combinations of one or more of the associated listed items.
In some embodiments of the invention, the application of desmodium styracifolium transcription factor CIB1 in promoting the growth of hairy roots of plants is disclosed, wherein the amino acid sequence of the desmodium styracifolium transcription factor CIB1 is shown as SEQ ID NO. 2.
In other embodiments of the invention, the application of desmodium styracifolium transcription factor CIB 1in plant hairy root molecular breeding is disclosed, wherein the amino acid sequence of the desmodium styracifolium transcription factor CIB1 is shown as SEQ ID NO. 2.
In other embodiments of the invention, the application of the coding gene of desmodium styracifolium transcription factor CIB1 in promoting the growth of hairy roots of plants is disclosed, wherein the nucleotide sequence of the coding gene of desmodium styracifolium transcription factor CIB1 is shown as SEQ ID NO. 1.
In other embodiments of the invention, the application of the coding gene of desmodium styracifolium transcription factor CIB1 in plant hairy root molecular breeding is disclosed, wherein the nucleotide sequence of the coding gene of desmodium styracifolium transcription factor CIB1 is shown as SEQ ID NO. 1.
SEQ ID NO:1：
ATGTTGCACTGTATGAACACGTCGGGGAATGTGGGTGGAGATATGACAGTCTTGGAAAGACAGAGAGCGAGGATGATGAAGTTGCAAGAAGACCAAGGTTACTTTTCTTCCTTCAATGGCGTTTTCTCATCTTCTCTAAATACTCATCATTCCATGATGCTAGCTGCGGATTCCGGTTCTGCCCTTGCTGAAGTAGTGGCTCATGCTCAGCATCAACCTCAGCCAACAACAGTTCATGGGTTTGATGCGGGTTCTTCACTATCCAGGACTTTTAGCTGTCCACCTACTCTCGTGGAGCCCGAGCCCGAGCCCGAGCCCAAGCCCAAGCCCACGAATTCTTCAATTGGTAAAGAGAGTTTAAAGAAGAGGAAGCATGACAAGACTCCGAATACAAAGTTTGTTGCAGAAAATGATAACAAAGACAAGAGGATCAAAGTGGGTGCAGATGATGGTGAATCCAAAATCACGGTGCAGACCAACAGCAAGAGTAACACAACAAACGCAAATAGCAACAAAAGAGAAACCTGTGCGGATAATACTTCAAATTCAAAACCTTTAGAGGTTCAAAAGTCCGATTACATTCATGTTCGTGCACGTCGTGGTCAAGCCACAGATAGCCATAGCTTAGCTGAAAGAGTTAGAAGGGAAAAAATTAGTGAGAGAATGAAGTATTTACAAGATTTAGTACCCGGTTGCAACAAAATCACTGGAAAAGCTGGAATGCTTGATGAAATCATCAATTATGTTCAATCTCTTCAGCGGCAAGTTGAGTTTCTGTCAATGAAATTGGCTTCTGTGAACCCAAGGCTTGACTTCAGTGTTGATGATCTATTTGAAAAAGAGGTGTTTCCTGCTTGTGCTACAAATTTTCCAAACATGGGAATGCCATCAGATATGACTAACGCTGCATATCTTCAGTTTAATTCACCGCATCAAATTGTTTCGTTTGGTGGATTAGATACAGTGATTAACCCTTCCGATGTGGGGCTTAAAAGGACCATAAGTGCCCCTGTAACAATGCCTGAAACATATCTTCACTCGTCTGGTTTCACACAAATGATACCT TCCTCAACATGGGAAGGTGATTTCCAAAACCTGTGCAATTTTGATTTTGATCAAGCACGAGCAACATCTTTCCCTTCTCAGCTGTTCTCAGGTCTTGTTGAAGCTAGCAATCTAAAGATGGGGATGTAG
SEQ ID NO:2：
MLHCMNTSGNVGGDMTVLERQRARMMKLQEDQGYFSSFNGVFSSSLNTHHSMMLAADSGSALAEVVAHAQHQPQPTTVHGFDAGSSLSRTFSCPPTLVEPEPEPEPKPKPTNSSIGKESLKKRKHDKTPNTKFVAENDNKDKRIKVGADDGESKITVQTNSKSNTTNANSNKRETCADNTSNSKPLEVQKSDYIHVRARRGQATDSHSLAERVRREKISERMKYLQDLVPGCNKITGKAGMLDEIINYVQSLQRQVEFLSMKLASVNPRLDFSVDDLFEKEVFPACATNFPNMGMPSDMTNAAYLQFNSPHQIVSFGGLDTVINPSDVGLKRTISAPVTMPETYLHSSGFTQMIPSSTWEGDFQNLCNFDFDQARATSFPSQLFSGLVEASNLKMGM*
In some embodiments, the plant is a leguminous plant, and/or the leguminous plant is desmodium styracifolium or licorice.
In other embodiments of the invention, the application of an over-expression vector of the coding gene of desmodium styracifolium transcription factor CIB1 in promoting plant hairy root growth or plant hairy root molecular breeding is disclosed, wherein the nucleotide sequence of the coding gene of desmodium styracifolium transcription factor CIB1 is shown as SEQ ID NO. 1.
In some of these embodiments, the over-expression vector comprises psuper promoter; or, the over-expression vector is psuper1300,1300 vector.
In other embodiments of the invention, the application of the genetically engineered bacterium transformed with the overexpression vector of the coding gene of desmodium styracifolium transcription factor CIB1 in promoting plant hairy root growth or plant hairy root molecular breeding is disclosed, wherein the nucleotide sequence of the coding gene of desmodium styracifolium transcription factor CIB1 is shown as SEQ ID NO. 1.
In some embodiments, the genetically engineered bacterium is agrobacterium rhizogenes.
In other embodiments of the present invention, a method for promoting growth of hairy roots of plants is disclosed, comprising the steps of: the expression of desmodium styracifolium transcription factor CIB1 or the coding gene of desmodium styracifolium transcription factor CIB1 in plants is improved, the amino acid sequence of desmodium styracifolium transcription factor CIB1 is shown as SEQ ID NO. 2, and the nucleotide sequence of the coding gene of desmodium styracifolium transcription factor CIB1 is shown as SEQ ID NO. 1.
In some embodiments, the plant is a medicinal plant; and/or, the medicinal plant is desmodium styracifolium or liquorice.
The invention will be described in further detail with reference to the drawings and the specific examples.
Example 1 cloning of the coding gene of desmodium styracifolium transcription factor CIB1 and construction of the over-expression vector comprises the following steps:
1. Taking whole tissue sample of rhizome and leaf of desmodium styracifolium stored at-80deg.C, grinding into powder with liquid nitrogen, and extracting RNA (product number: R4151-03C, brand: magen/Meyer group organism) with plant RNA double column kit.
2. The synthesis of the first strand of cDNA was performed according to the procedure of PRIMESCRIPT TM II 1st Strand cDNA Synthesis Kit reverse transcription kit (cat# 6210A, brand: takara/Bao Bio) instructions.
3. Based on the CDS sequence GsCIB obtained by sequencing the desmodium styracifolium genome, an upstream primer F and a downstream primer R are designed and utilizedMax DNAPolymerase Hi-Fi enzyme (cat# R045B, brand: taKaRa) amplified the cDNA sequence of GsCIB.
Upstream primer F (SEQ ID NO: 3):
CGACTCTAGAAAGCTTATGTTGCACTGTATGAACAC；
downstream primer R (SEQ ID NO: 4):
CCTCGCCCTTGCTCATGGTACCCATCCCCATCTTTAGATTG；
PCR reaction system: primestarMix. Mu.L, 2. Mu.L of upstream primer, 2. Mu.L of downstream primer, 1. Mu.L of template and 20. Mu.L of sterile water.
The reaction procedure: pre-denaturation at 98 ℃ for 5min; denaturation at 98℃for 30s, annealing at 55℃for 30s, extension at 72℃for 1min for 33 cycles; extending at 72℃for 5min.
4. The PCR product is subjected to agarose gel and then the target fragment is recovered by using a DNA gel recovery kit.
5. Over-expression vectors were constructed using FastDNAAssemblyMix (cat# E0201S, brand: CISTRO). And (3) connecting the target fragment purified in the step (4) with an over-expression vector to obtain a connection product.
Homologous recombination system: after purification, 1. Mu.L of the target fragment (100 ng/. Mu.L), 1. Mu.L of the vector (100 ng/. Mu.L) after cleavage and AssemblyMix. Mu.L were ligated at 50℃for 15 minutes.
E.coli competent DH5 alpha ice bath sample adding, ice bath standing for 5min until competent melting. Adding the ligation product to 100 mu L of escherichia coli DH5 alpha in an ice-water mixture state, flicking and uniformly mixing, and then carrying out ice bath for 20min; heat shock at 42 ℃ for 60s; standing on ice for 3min; adding 700 mu L of LB liquid medium without antibiotics; 200rpm, and culturing at 37 ℃ for 1h in a shaking way; centrifuging for 1min at 10,000Xg; the supernatant was discarded, and after 50. Mu.L of the suspended cells remained, an appropriate amount of the cell liquid was applied to LB solid medium containing 50mg/LKan, and the culture was inverted at 37℃overnight until single colonies were grown.
6. The positive clone obtained in the previous step is selected for positive clone detection and sequencing (Optimus Prinsepia Roxburghii Co.) to obtain the over-expression vector (named OE-GsCIB hereinafter) of the coding gene (the nucleotide sequence is shown as SEQ ID NO:1, the amino acid sequence is shown as SEQ ID NO: 2) of desmodium styracifolium transcription factor GsCIB.
The sequences of desmodium styracifolium transcription factor CIB1 obtained by cloning in the present invention and other CIB family members (5 CIB transcription factors, 2 CIL transcription factors) were aligned by using clustalW, and the result of the phylogenetic tree of 11 candidate proteins obtained by using the NJ distance method is shown in FIG. 1. The results indicate that among 17 members of subgroup 18 of the bHLH family, cyclocarya paliurus CIB1 was found to be similar in affinity to arabidopsis CIB 1.
Examples 2 OE-GsCIB1 transfer into Agrobacterium rhizogenes K599 competent
Agrobacterium rhizogenes K599 competent ice bath sample addition, ice bath standing for 10min until Agrobacterium competent melting. Adding OE-GsCIB1 with correct sequence to 100 mu L of Agrobacterium rhizogenes K599 in an ice-water mixture state, flicking and mixing uniformly, and then carrying out ice bath for 5min; liquid nitrogen for 5min; water bath at 37 ℃ for 5min, ice bath for 5 min. Adding 700 mu L of LB liquid medium without antibiotics; 200rpm, and culturing at 28 ℃ for 3 hours in an oscillating way; centrifuging for 1min at 10,000Xg; after 50. Mu.L of suspended bacteria remained, the supernatant was discarded, and an appropriate amount of the bacterial liquid was applied to LB solid medium containing 50mg/LKan +50mg/L of Str, and the culture was inverted at 28℃overnight until single colonies were grown, and positive clone detection was performed.
Example 3 OE-GsCIB1 bacterial liquid promoting growth of desmodium styracifolium and Glycyrrhiza uralensis hairy root
The positive Agrobacterium single colony obtained in example 2 was picked up, cultured to an OD600 of 0.8, and centrifuged at 4000rpm for 10min to collect the cells. The suspension (100. Mu. Mol. L -1,MgCl2 mM, MES10 mM) was used as suspension to resuspend the bacterial suspension, the OD600 was adjusted to 0.8, and the suspension was allowed to stand at room temperature for 1h to obtain Agrobacterium resuspension.
Cutting cotyledons of the aseptic seedlings of the desmodium styracifolium and the liquorice, respectively soaking the cotyledons into the prepared agrobacterium tumefaciens heavy suspension for 1h, taking out, sucking residual bacterial liquid by filter paper, and placing the bacterial liquid on a 1/2MS solid culture medium for dark culture for 3 days. Then transferred to 1/2MS+200cefmg/L solid medium, grown under light, and medium changed every 15 days. After 1 month, positive hairy roots were transplanted to 1/2MS+200cefmg/L for further growth, and photographed for recording.
The results of PCR identification of hairy roots of desmodium styracifolium (NC represents negative control, sterile water as template, PC represents positive control, and Agrobacterium positive monoclonal as template) by rolB and rolC, respectively, are shown in FIG. 2. From the results, two bands of 750bp and 500bp were obtained, indicating that Agrobacterium rhizogenes carried desmodium transcription factor CIB1 into desmodium to produce hairy roots.
Figure 3 is a morphological feature of desmodium styracifolium and licorice hairy roots at 1 month of age. As can be seen from FIG. 3, when the transcription factor GsCIB was overexpressed, the hairy roots of desmodium styracifolium and Glycyrrhiza uralensis were significantly larger and grown faster than CK (hairy roots of desmodium styracifolium induced by empty plasmid without transcription factor CIB 1).
The above examples illustrate only a few embodiments of the invention, which are described in detail and are not to be construed as limiting the scope of the invention. It should be noted that it will be apparent to those skilled in the art that several variations and modifications can be made without departing from the spirit of the invention, which are all within the scope of the invention. Accordingly, the scope of protection of the present invention is to be determined by the appended claims.
Claims (10)
1. The application of desmodium styracifolium transcription factor CIB1 in promoting growth of hairy roots of plants is provided, wherein the amino acid sequence of the desmodium styracifolium transcription factor CIB1 is shown as SEQ ID NO. 2.
2. The application of desmodium styracifolium transcription factor CIB1 in molecular breeding of plant hairy roots is provided, wherein the amino acid sequence of the desmodium styracifolium transcription factor CIB1 is shown as SEQ ID NO. 2.
3. The application of the coding gene of desmodium styracifolium transcription factor CIB1 in promoting the growth of hairy roots of plants is provided, wherein the nucleotide sequence of the coding gene of desmodium styracifolium transcription factor CIB1 is shown as SEQ ID NO. 1.
4. The application of the coding gene of desmodium styracifolium transcription factor CIB1 in plant hairy root molecular breeding is provided, wherein the nucleotide sequence of the coding gene of desmodium styracifolium transcription factor CIB1 is shown as SEQ ID NO. 1.
5. The use according to any one of claims 1 to 4, wherein the plant is a medicinal plant and/or the medicinal plant is desmodium styracifolium or licorice.
6. The application of the overexpression vector of the coding gene of the desmodium styracifolium transcription factor CIB1 in promoting the growth of plant hairy roots or the molecular breeding of plant hairy roots is disclosed, and the nucleotide sequence of the coding gene of the desmodium styracifolium transcription factor CIB1 is shown as SEQ ID NO. 1.
7. The use of claim 6, wherein the over-expression vector comprises psuper promoter.
8. The application of the genetically engineered bacterium transformed with the overexpression vector of the coding gene of desmodium styracifolium transcription factor CIB1 in promoting the growth of plant hairy roots or the molecular breeding of the plant hairy roots is disclosed, and the nucleotide sequence of the coding gene of desmodium styracifolium transcription factor CIB1 is shown as SEQ ID NO. 1.
9. A method for promoting growth of hairy roots of plants, comprising the steps of: the expression of desmodium styracifolium transcription factor CIB1 or the coding gene of desmodium styracifolium transcription factor CIB1 in plants is improved, the amino acid sequence of desmodium styracifolium transcription factor CIB1 is shown as SEQ ID NO. 2, and the nucleotide sequence of the coding gene of desmodium styracifolium transcription factor CIB1 is shown as SEQ ID NO. 1.
10. The method of claim 9, wherein the plant is a medicinal plant; and/or, the medicinal plant is desmodium styracifolium or liquorice.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN202410170561.XA CN117924450B (en) | 2024-02-06 | 2024-02-06 | Transcription factor CIB1 and application of coding gene thereof |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN202410170561.XA CN117924450B (en) | 2024-02-06 | 2024-02-06 | Transcription factor CIB1 and application of coding gene thereof |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| CN117924450A true CN117924450A (en) | 2024-04-26 |
| CN117924450B CN117924450B (en) | 2024-06-21 |
Family
ID=90753833
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN202410170561.XA Active CN117924450B (en) | 2024-02-06 | 2024-02-06 | Transcription factor CIB1 and application of coding gene thereof |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN117924450B (en) |
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20210403932A1 (en) * | 2017-12-04 | 2021-12-30 | Swetree Technologies Ab | Plants with Improved Growth |
| CN116200422A (en) * | 2023-01-06 | 2023-06-02 | 兰州大学 | Transcription factor MaMYB4 and application thereof in synergistic regulation of scopolamine biosynthesis with MaTT8 gene |
| CN117343156A (en) * | 2023-12-04 | 2024-01-05 | 中国农业科学院作物科学研究所 | Tartary buckwheat-derived bHLH transcription factor, coding gene and application thereof |
-
2024
- 2024-02-06 CN CN202410170561.XA patent/CN117924450B/en active Active
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20210403932A1 (en) * | 2017-12-04 | 2021-12-30 | Swetree Technologies Ab | Plants with Improved Growth |
| CN116200422A (en) * | 2023-01-06 | 2023-06-02 | 兰州大学 | Transcription factor MaMYB4 and application thereof in synergistic regulation of scopolamine biosynthesis with MaTT8 gene |
| CN117343156A (en) * | 2023-12-04 | 2024-01-05 | 中国农业科学院作物科学研究所 | Tartary buckwheat-derived bHLH transcription factor, coding gene and application thereof |
Non-Patent Citations (2)
| Title |
|---|
| SCHMUTZ, J.: "Phaseolus vulgaris hypothetical protein (PHAVU_009G023500g) mRNA, complete cds", NCBI REFERENCE SEQUENCE: XM_007136104.1, 12 March 2014 (2014-03-12) * |
| 梁云飞;张林成;蒲全明;雷镇泽;施松梅;姜宇鹏;任雪松;高启国;: "甘蓝转录因子BoLH27的克隆与转基因甘蓝的表型分析", 作物学报, no. 03, 11 December 2017 (2017-12-11) * |
Also Published As
| Publication number | Publication date |
|---|---|
| CN117924450B (en) | 2024-06-21 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CN109652423B (en) | Rice flowering phase regulating protein and application thereof in breeding | |
| CN101265293B (en) | Flowering time correlated albumen from arabidopsis, and coding gene and application thereof | |
| CN107815452A (en) | A kind of specific expressed promoter of plant leaf blade and its application | |
| KR20070110615A (en) | Myb60 gene for the inhibition of anthocyanin biosynthesis, the transgenic lettuces that the myb60 gene is transduced and the preparing method thereof | |
| CN117924450B (en) | Transcription factor CIB1 and application of coding gene thereof | |
| CN111621504A (en) | Stress-resistant gene BjuIBS of tumorous stem mustard and application thereof | |
| CN109161549A (en) | Regulate and control ARF8.1 and ARF8.2 gene and its application of tomato lateral bud development | |
| CN105695479B (en) | Chrysanthemum symmetry gene CmCYC2c and application thereof | |
| CN117924451B (en) | Transcription factor CIB3 and application of coding gene thereof | |
| CN105039279A (en) | Protein kinase in arabidopsis thaliana, coding gene and application of coding gene | |
| CN112430260B (en) | Application of abundant protein DoLEA36 in late embryonic development or coding gene thereof in regulation and control of plant callus formation | |
| CN109593768B (en) | Application of Pagl1 gene in regulating and controlling plant epidermal hair | |
| CN107653253B (en) | NtMADS2 gene for regulating and controlling tobacco flowering period and cloning method and application thereof | |
| CN107177602B (en) | NtDR1 gene related to drought tolerance of plant and application thereof | |
| CN107815454B (en) | Tobacco flowering phase regulation gene NtMADS1, and cloning method and application thereof | |
| CN117947049B (en) | Application of CsMYB108 and/or CsAGL gene in regulating cucumber yield | |
| CN116837000B (en) | Gene, expression vector and application for regulating chrysanthemum flowering phase | |
| CN114891802B (en) | Application of OsDUF6 gene and encoding protein thereof in rice salt tolerance breeding | |
| CN114591968B (en) | Application of tobacco NtSCL32 gene in plant branch regulation and control | |
| CN113151268B (en) | African agapanthus dehydratin ApY 2 SK 2 Gene promoter sequence and use thereof | |
| CN118406698B (en) | Application of ZmWIND gene in improving corn genetic transformation efficiency | |
| CN114703200B (en) | Apple drought-enduring negative regulation gene MdbHLH108 and application thereof | |
| CN113151269B (en) | African agapanthus dehydrin protein ApSK 3 Promoter sequence of gene and application thereof | |
| CN113549135B (en) | Limonium bicolor gene LbCPC and application thereof | |
| CN112725353B (en) | Recombinant vector, transformant, primer for amplifying AtNAC58 gene and preparation method and application thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PB01 | Publication | ||
| PB01 | Publication | ||
| SE01 | Entry into force of request for substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| GR01 | Patent grant | ||
| GR01 | Patent grant |