CN117106851A - Screening method for EV71 protease inhibitor and inhibition effect evaluation method - Google Patents
Screening method for EV71 protease inhibitor and inhibition effect evaluation method Download PDFInfo
- Publication number
- CN117106851A CN117106851A CN202311360921.4A CN202311360921A CN117106851A CN 117106851 A CN117106851 A CN 117106851A CN 202311360921 A CN202311360921 A CN 202311360921A CN 117106851 A CN117106851 A CN 117106851A
- Authority
- CN
- China
- Prior art keywords
- amino acid
- gfp
- acid sequence
- protease
- wild
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Granted
Links
- 241001529459 Enterovirus A71 Species 0.000 title claims abstract description 71
- 230000000694 effects Effects 0.000 title claims abstract description 29
- 239000000137 peptide hydrolase inhibitor Substances 0.000 title claims abstract description 28
- 230000005764 inhibitory process Effects 0.000 title claims abstract description 23
- 238000012216 screening Methods 0.000 title claims abstract description 21
- 229940124158 Protease/peptidase inhibitor Drugs 0.000 title claims abstract description 20
- 238000000034 method Methods 0.000 title claims abstract description 18
- 238000011156 evaluation Methods 0.000 title claims abstract description 13
- 108091005804 Peptidases Proteins 0.000 claims abstract description 74
- 239000004365 Protease Substances 0.000 claims abstract description 74
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 claims abstract description 74
- 239000013612 plasmid Substances 0.000 claims abstract description 42
- 238000003776 cleavage reaction Methods 0.000 claims abstract description 29
- 230000007017 scission Effects 0.000 claims abstract description 29
- 108090000623 proteins and genes Proteins 0.000 claims abstract description 16
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 59
- 239000003112 inhibitor Substances 0.000 claims description 28
- 150000001413 amino acids Chemical class 0.000 claims description 12
- 108091005971 Wild-type GFP Proteins 0.000 claims description 11
- 101150069344 CUT1 gene Proteins 0.000 claims description 10
- 101150020073 cut-2 gene Proteins 0.000 claims description 10
- 230000014509 gene expression Effects 0.000 claims description 10
- 238000001890 transfection Methods 0.000 claims description 10
- 238000012258 culturing Methods 0.000 claims description 7
- 238000004113 cell culture Methods 0.000 claims description 6
- 230000004186 co-expression Effects 0.000 claims description 6
- 238000003780 insertion Methods 0.000 claims description 5
- 230000037431 insertion Effects 0.000 claims description 5
- 230000007480 spreading Effects 0.000 claims description 5
- 230000002401 inhibitory effect Effects 0.000 claims description 3
- 238000012986 modification Methods 0.000 claims description 3
- 230000004048 modification Effects 0.000 claims description 3
- 102000034287 fluorescent proteins Human genes 0.000 abstract description 9
- 108091006047 fluorescent proteins Proteins 0.000 abstract description 9
- 241000700605 Viruses Species 0.000 abstract description 8
- 102000004169 proteins and genes Human genes 0.000 abstract description 6
- 230000000857 drug effect Effects 0.000 abstract description 3
- 108010043121 Green Fluorescent Proteins Proteins 0.000 description 49
- 102000004144 Green Fluorescent Proteins Human genes 0.000 description 49
- 239000005090 green fluorescent protein Substances 0.000 description 46
- 210000004027 cell Anatomy 0.000 description 29
- 229940042399 direct acting antivirals protease inhibitors Drugs 0.000 description 8
- 238000010367 cloning Methods 0.000 description 6
- 230000006801 homologous recombination Effects 0.000 description 6
- 238000002744 homologous recombination Methods 0.000 description 6
- 208000020061 Hand, Foot and Mouth Disease Diseases 0.000 description 4
- 208000025713 Hand-foot-and-mouth disease Diseases 0.000 description 4
- 230000001413 cellular effect Effects 0.000 description 4
- 208000015181 infectious disease Diseases 0.000 description 4
- 239000003443 antiviral agent Substances 0.000 description 3
- 238000001514 detection method Methods 0.000 description 3
- 239000003814 drug Substances 0.000 description 3
- CAYJBRBGZBCZKO-BHGBQCOSSA-N ethyl (e,4s)-4-[[(2r,5s)-2-[(4-fluorophenyl)methyl]-6-methyl-5-[(5-methyl-1,2-oxazole-3-carbonyl)amino]-4-oxoheptanoyl]amino]-5-[(3s)-2-oxopyrrolidin-3-yl]pent-2-enoate Chemical compound C([C@@H](/C=C/C(=O)OCC)NC(=O)[C@@H](CC(=O)[C@@H](NC(=O)C1=NOC(C)=C1)C(C)C)CC=1C=CC(F)=CC=1)[C@@H]1CCNC1=O CAYJBRBGZBCZKO-BHGBQCOSSA-N 0.000 description 3
- 238000000338 in vitro Methods 0.000 description 3
- 108090000765 processed proteins & peptides Proteins 0.000 description 3
- 229950007656 rupintrivir Drugs 0.000 description 3
- 239000013598 vector Substances 0.000 description 3
- 241000709661 Enterovirus Species 0.000 description 2
- 101150066002 GFP gene Proteins 0.000 description 2
- 241000709664 Picornaviridae Species 0.000 description 2
- 108010076039 Polyproteins Proteins 0.000 description 2
- 101710172711 Structural protein Proteins 0.000 description 2
- 230000000840 anti-viral effect Effects 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 230000005284 excitation Effects 0.000 description 2
- 238000002474 experimental method Methods 0.000 description 2
- 239000013613 expression plasmid Substances 0.000 description 2
- 238000002866 fluorescence resonance energy transfer Methods 0.000 description 2
- 230000007440 host cell apoptosis Effects 0.000 description 2
- IYRMWMYZSQPJKC-UHFFFAOYSA-N kaempferol Chemical compound C1=CC(O)=CC=C1C1=C(O)C(=O)C2=C(O)C=C(O)C=C2O1 IYRMWMYZSQPJKC-UHFFFAOYSA-N 0.000 description 2
- 238000004020 luminiscence type Methods 0.000 description 2
- 208000030194 mouth disease Diseases 0.000 description 2
- 229920001184 polypeptide Polymers 0.000 description 2
- 102000004196 processed proteins & peptides Human genes 0.000 description 2
- 238000011002 quantification Methods 0.000 description 2
- 238000010791 quenching Methods 0.000 description 2
- 230000000171 quenching effect Effects 0.000 description 2
- 230000010076 replication Effects 0.000 description 2
- 230000029812 viral genome replication Effects 0.000 description 2
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 1
- FNMASAFFZKWPGI-UHFFFAOYSA-N 1-[5-(4-bromophenoxy)pentyl]-3-pyridin-4-ylimidazolidin-2-one Chemical compound C1=CC(Br)=CC=C1OCCCCCN1C(=O)N(C=2C=CN=CC=2)CC1 FNMASAFFZKWPGI-UHFFFAOYSA-N 0.000 description 1
- 108020004705 Codon Proteins 0.000 description 1
- 208000035473 Communicable disease Diseases 0.000 description 1
- UBSCDKPKWHYZNX-UHFFFAOYSA-N Demethoxycapillarisin Natural products C1=CC(O)=CC=C1OC1=CC(=O)C2=C(O)C=C(O)C=C2O1 UBSCDKPKWHYZNX-UHFFFAOYSA-N 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 108091028043 Nucleic acid sequence Proteins 0.000 description 1
- 238000012408 PCR amplification Methods 0.000 description 1
- 208000037273 Pathologic Processes Diseases 0.000 description 1
- 101800001491 Protease 3C Proteins 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 230000007416 antiviral immune response Effects 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 238000010586 diagram Methods 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- 238000009509 drug development Methods 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 230000004907 flux Effects 0.000 description 1
- 230000002779 inactivation Effects 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 230000002458 infectious effect Effects 0.000 description 1
- MWDZOUNAPSSOEL-UHFFFAOYSA-N kaempferol Natural products OC1=C(C(=O)c2cc(O)cc(O)c2O1)c3ccc(O)cc3 MWDZOUNAPSSOEL-UHFFFAOYSA-N 0.000 description 1
- 235000008777 kaempferol Nutrition 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- UXOUKMQIEVGVLY-UHFFFAOYSA-N morin Natural products OC1=CC(O)=CC(C2=C(C(=O)C3=C(O)C=C(O)C=C3O2)O)=C1 UXOUKMQIEVGVLY-UHFFFAOYSA-N 0.000 description 1
- 244000309711 non-enveloped viruses Species 0.000 description 1
- 239000002773 nucleotide Substances 0.000 description 1
- 125000003729 nucleotide group Chemical group 0.000 description 1
- 244000052769 pathogen Species 0.000 description 1
- 230000009054 pathological process Effects 0.000 description 1
- 230000035699 permeability Effects 0.000 description 1
- 239000002243 precursor Substances 0.000 description 1
- 238000002360 preparation method Methods 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 238000012827 research and development Methods 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 230000014616 translation Effects 0.000 description 1
- 238000013519 translation Methods 0.000 description 1
- 230000007502 viral entry Effects 0.000 description 1
- 230000006656 viral protein synthesis Effects 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
- C12Q1/34—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving hydrolase
- C12Q1/37—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving hydrolase involving peptidase or proteinase
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/43504—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates
- C07K14/43595—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates from coelenteratae, e.g. medusae
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/65—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression using markers
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/48—Hydrolases (3) acting on peptide bonds (3.4)
- C12N9/50—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25)
- C12N9/503—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from viruses
- C12N9/506—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from viruses derived from RNA viruses
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N21/00—Investigating or analysing materials by the use of optical means, i.e. using sub-millimetre waves, infrared, visible or ultraviolet light
- G01N21/62—Systems in which the material investigated is excited whereby it emits light or causes a change in wavelength of the incident light
- G01N21/63—Systems in which the material investigated is excited whereby it emits light or causes a change in wavelength of the incident light optically excited
- G01N21/64—Fluorescence; Phosphorescence
- G01N21/6486—Measuring fluorescence of biological material, e.g. DNA, RNA, cells
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/5005—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells
- G01N33/5008—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics
- G01N33/502—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics for testing non-proliferative effects
- G01N33/5023—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics for testing non-proliferative effects on expression patterns
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/50—Fusion polypeptide containing protease site
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/60—Fusion polypeptide containing spectroscopic/fluorescent detection, e.g. green fluorescent protein [GFP]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2800/00—Nucleic acids vectors
- C12N2800/10—Plasmid DNA
- C12N2800/106—Plasmid DNA for vertebrates
- C12N2800/107—Plasmid DNA for vertebrates for mammalian
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Genetics & Genomics (AREA)
- Organic Chemistry (AREA)
- Molecular Biology (AREA)
- Biomedical Technology (AREA)
- Zoology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Wood Science & Technology (AREA)
- Biotechnology (AREA)
- Biochemistry (AREA)
- General Health & Medical Sciences (AREA)
- General Engineering & Computer Science (AREA)
- Immunology (AREA)
- Physics & Mathematics (AREA)
- Microbiology (AREA)
- Biophysics (AREA)
- Medicinal Chemistry (AREA)
- Analytical Chemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Plant Pathology (AREA)
- Toxicology (AREA)
- Tropical Medicine & Parasitology (AREA)
- Hematology (AREA)
- Urology & Nephrology (AREA)
- Virology (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- Cell Biology (AREA)
- Food Science & Technology (AREA)
- Gastroenterology & Hepatology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
Abstract
The invention discloses a screening method and an inhibition effect evaluation method of EV71 protease inhibitor, wherein a sequence of a 3C protease related cleavage site of EV71 is inserted into fluorescent protein to form a modified fluorescent protein reporter protein, and the EV71 3C protease is cloned and expressed on a fluorescent protein reporter protein plasmid, so that the screening method and the inhibition effect evaluation method can be used for screening protease inhibitor and evaluating the activity of protease inhibitor, and finally an EV71 protease inhibitor screening and drug effect evaluation platform is formed. The invention can avoid the safety concern caused by using EV71 live virus, has low requirement on biological safety level, can meet the experimental requirement in BSL-1 level laboratory, and is high-efficiency, accurate, stable, high-flux and repeatable for EV71 protease inhibitor screening and drug effect evaluation.
Description
Technical Field
The invention relates to the technical field of biological medicines, in particular to a screening method and an inhibition effect evaluation method of EV71 protease inhibitors.
Background
Hand-foot-and-mouth disease (HFMD) is a common infectious disease of children, and can be caused by various enteroviruses, and is commonly and easily felt by preschool children and infants below three years old. Among them, enterovirus 71 (ev 71) is one of the main pathogens causing hand-foot-and-mouth disease. Of the hand-foot-and-mouth patients, 70% of the severe cases are caused by EV71 infection, with up to 90% of cases fatal to HFMD being caused by EV71 infection. Therefore, development of effective antiviral drugs is urgently required.
EV71 is a non-enveloped virus belonging to the genus Picornavirus (Enterovirus) of the family Picornavirus. The genome of EV71 is a single-stranded positive strand RNA of about 7.4. 7.4 kb, the intermediate ORF of which encodes a polypeptide of about 2194 amino acids. During EV71 replication, the polypeptide is first hydrolyzed into 3 precursor proteins (P1 to P3), and then further cleaved into four structural proteins and seven non-structural proteins by the action of virally encoded 2A protease and 3C protease. After translation of the polyprotein, the 2A protease is mainly responsible for cleavage of the junction sequence between VP1 and 2A, while the 3C protease is responsible for cleavage of the other eight junction sites in the remaining polyprotein, the primary protease. The EV71 3C protease participates in a plurality of pathological processes of EV71 and plays a very important role in various aspects of EV71 virus replication, host cell apoptosis induction, host antiviral immune response inhibition and the like, so the 3C protease can be used as one of the most main targets for the research and development of anti-EV 71 virus medicaments.
The traditional broad-spectrum antiviral medicament is mainly used for treating hand-foot-mouth disease in clinic at present. However, various antiviral drugs have been developed for EV71, including Placonaril and BPR0Z-194, which interfere with viral entry into the host, rupintrivir, which inhibits 3C protease activity, DTriP-22, which targets viral replication, and Kaempferol, which targets viral translation. Among them, 3C protease plays an important role in EV71 replication and host cell apoptosis, and EV71 3C protease has no homology with mammalian protease, which makes 3C protease the most prominent target in antiviral drug development.
Most cellular antiviral experiments of highly infectious viruses need to be performed in a laboratory of BSL-2+ or higher, however the resources of such a laboratory are rather scarce. At present, the activity evaluation method of the EV71 3C protease inhibitor is mainly a fluorescence resonance energy transfer method, and enzymatic and inhibition experiments are carried out in vitro at the in vitro or non-cellular level. Although the fluorescence resonance energy transfer method has the advantages of high flux, rapidness, sensitivity, quantification, good repeatability and the like, many inhibitors with good in vitro activity cannot fully reflect the effect of protease inhibitors in cells because of poor cell membrane permeability or specificity. Therefore, it is necessary to develop a simple, safe, high-throughput and reproducible protease activity and protease inhibitor screening and activity detection method at the cellular level.
Disclosure of Invention
The invention aims to provide a screening method and an inhibition effect evaluation method for EV71 protease inhibitors, which are free from using live viruses, have good safety, and can efficiently, accurately, stably and high-throughput screen and inhibition effect evaluation for EV71 protease inhibitors.
The technical scheme adopted for solving the technical problems is as follows:
a method of screening for an EV71 protease inhibitor, comprising the steps of:
(1) Constructing plasmids for coexpression of modified GFP and EV71 3C protease, wherein the modified GFP is formed by inserting an EV 71C protease cleavage sequence into wild GFP;
(2) Screening: spreading cells to be transfected in a porous plate, then adding plasmids of GFP and EV 71C protease which are subjected to co-expression modification for transfection, culturing the transfected cells, simultaneously adding different groups of inhibitors to be screened into the porous plate, taking the non-added inhibitors to be screened as a control, observing the state of the cells and taking a fluorescent photograph, and detecting the fluorescence intensity; if the fluorescence intensity is increased compared with the control, the inhibitor to be screened has an inhibition effect, and if the fluorescence intensity is increased, the inhibition effect of the inhibitor to be screened is stronger.
According to the invention, the sequence of the cleavage site related to the EV71 3C protease is inserted into Green Fluorescent Protein (GFP) to form a modified fluorescent protein reporter protein system, and the EV71 3C protease is cloned and expressed on the fluorescent protein reporter protein plasmid, so that the modified fluorescent protein reporter protein system can be used for screening protease inhibitors and evaluating the activity of the protease inhibitors, and finally an EV71 protease inhibitor screening and efficacy evaluating platform is formed. The invention can avoid the safety concern caused by using EV71 live virus, has low requirement on biological safety level, can meet the experimental requirement in BSL-1 level laboratory, and is a high-efficiency, accurate, stable, high-throughput and repeatable platform for EV71 protease inhibitor screening and drug effect evaluation.
Insertion sites of the EV71 3C protease cleavage sequence on the wild-type GFP amino acid sequence include site a, site B and site C;
the site A is 158 th to 159 th amino acid of the amino acid sequence of the wild GFP, or an amino acid region corresponding to the amino acid sequence with more than 99% sequence identity compared with the amino acid sequence of the wild GFP;
the site B is 117 th to 118 th amino acid of the amino acid sequence of the wild GFP, or an amino acid region corresponding to the amino acid sequence with more than 99% sequence identity compared with the amino acid sequence of the wild GFP;
the locus C is 159 th to 160 th amino acid of the amino acid sequence of the wild GFP, or an amino acid region corresponding to the amino acid sequence with more than 99% sequence identity compared with the amino acid sequence of the wild GFP;
the amino acid sequence of the wild GFP is shown in SEQ ID No. 1.
In the invention, the site A is 158 th to 159 th amino acid of the amino acid sequence of the wild GFP, or an amino acid region corresponding to the amino acid sequence with more than 99% sequence identity compared with the amino acid sequence of the wild GFP; the corresponding amino acid region refers to the position on the amino acid sequence corresponding to amino acids 158-159 of the wild-type GFP amino acid sequence that has more than 99% sequence identity as compared to the wild-type GFP amino acid sequence. Other similar expressions are referred to herein for explanation.
The inventor researches and discovers that after the three specific sites (site A, site B and site C) are inserted into the EV71 3C protease cleavage sequence, the modified GFP fluorescent protein can still detect the excited fluorescence.
The EV71 3C protease cleavage sequences comprise cut1 and cut2, the amino acid sequence of the cut1 is shown in SEQ ID No.2, and the amino acid sequence of the cut2 is shown in SEQ ID No. 3. The EV71 3C protease cleavage sequence can be accurately recognized and cleaved by EV71 3C protease, and the cleavage can destroy the luminous function of fluorescent protein, so that fluorescence quenching is caused.
The fluorescence excitation was still detectable after expression of the engineered GFP.
The preparation method of the modified GFP plasmid comprises the following steps:
cloning a gene sequence of the wild GFP into a plurality of cloning sites of an expression plasmid vector in a homologous recombination mode to construct a plasmid for expressing the wild GFP;
by homologous recombination, a nucleotide sequence corresponding to the cleavage sequence of EV 71C protease is inserted into the GFP gene sequence on the plasmid expressing wild-type GFP, so as to construct the GFP plasmid with improved expression.
A plasmid co-expressing a engineered GFP and an EV71 3C protease, said plasmid comprising a coding gene sequence that expresses an EV71 3C protease and a coding gene sequence that expresses the engineered GFP; the modified GFP is obtained by inserting an EV71 3C protease cleavage sequence into the wild GFP. After co-expression of the engineered GFP and the EV71 3C protease, the EV 71C protease can cleave the engineered GFP, resulting in fluorescence quenching. If an effective protease inhibitor exists, the protease function is inhibited, and the cleavage sequence of the EV 71C protease cannot be cut, so that the luminous function of fluorescent protein is reserved, which is the principle of screening the protease inhibitor.
A method for evaluating an inhibitory effect of an EV71 protease inhibitor, comprising the steps of:
(1) Constructing plasmids for coexpression of modified GFP and EV71 3C protease, wherein the modified GFP is formed by inserting an EV 71C protease cleavage sequence into wild GFP;
(2) Evaluation: spreading the cells to be transfected in a cell culture dish, then adding plasmids of GFP and EV 71C protease which are co-expressed and modified for transfection, culturing the transfected cells, simultaneously adding inhibitors into the cell culture dish, taking the cells without the inhibitors as a control, observing the state of the cells and taking a fluorescent photograph, and detecting the fluorescence intensity; the fluorescence intensity positively reflects the inhibition effect of the inhibitor, and a higher fluorescence intensity represents a stronger inhibition effect of the inhibitor.
The beneficial effects of the invention are as follows: the method does not need to use live viruses, has good safety, and can efficiently, accurately, stably and high-flux screen EV71 protease inhibitors and evaluate inhibition effects.
Drawings
FIG. 1 is a fluorescent image of EV71 3C protease cleavage sequence inserted into three sites of wild-type GFP and of co-expressed engineered GFP and EV 71C protease, GFP15-3Ccut1 representing engineered GFP formed by insertion of EV71 3C protease cleavage sequence cut1 at site15 of GFP, AVTQGF, and so on; pGFP15-3Ccut1 is a plasmid expressing GFP15-3Ccut1, and so on; pGFP15-3Ccut1-P2A-3C is a plasmid co-expressing GFP15-3Ccut1 and EV71 3C protease, and so on.
FIG. 2 is a schematic diagram of plasmids co-expressing engineered GFP and EV71 3C protease according to the invention.
FIG. 3 is a photograph of the fluorescence of cells 48h after inhibitor addition.
FIG. 4 is a high throughput detection fluorescence expression profile; 01 represents the average fluorescence value of three replicates after transfection of cells with plasmid expressing the engineered GFP, 02 represents the average fluorescence value of three replicates after transfection of cells with plasmid co-expressing the engineered GFP and EV71 3C protease, and 03 represents the average fluorescence value of three replicates after transfection of cells with plasmid disrupting expression of the EV71 3C protease.
Description of the embodiments
The technical scheme of the invention is further specifically described by the following specific examples.
In the present invention, the materials and equipment used are commercially available or commonly used in the art, unless otherwise specified. The methods in the following examples are conventional in the art unless otherwise specified.
Virus name
Hand-foot-mouth disease virus (Human Enterovirus 71); protease name: protease 3C; protease size 183 aa; cleavage sequence size: 6 aa.
Example 1:
a method of screening for an EV71 protease inhibitor, comprising the steps of:
(1) Constructing a modified GFP plasmid for expression, wherein the modified GFP is formed by inserting a wild GFP amino acid sequence into an EV71 3C protease cleavage sequence, and the modified GFP fluorescent protein still has the function of excitation and luminescence;
first, the gene encoding the wild-type GFP and pcDNA3.1 (+) vector (commercially available) were PCR amplified according to the Primer Star enzyme (Takara) protocol. The wild-type GFP gene sequence (SEQ ID No. 4) was cloned between the Multiple Cloning Sites (MCS) of the pcDNA3.1 (+) vector by homologous recombination (Uniclone One Step Seamless Cloning Kit kit) to construct pGFP plasmids as a subsequent template and control.
The EV 71C protease cleavage sequences cut1: AVTQ ∈GF (SEQ ID No. 2) and cut2: ALFQ ∈GP (SEQ ID No. 3) are inserted into different positions (site A: site 15-1598 aa, site B: site 20-118 aa, site C: site 24-160 aa) of the wild-type GFP amino acid sequence by homologous recombination technology (Uniclone One Step Seamless Cloning Kit kit), and the corresponding nucleotide sequences of cut1 and cut2 are gctcttttccaaggtcca (SEQ ID No. 5) and gcaacagtgcaaggcccg (SEQ ID No. 6), so that plasmids pGFP15/20/24-3Ccut1/2 (remark: GFP15/20/24 and "/" in cut1/2 represent "or" meaning, and the same applies below) are constructed. The constructed pGFP15/20/24-3Ccut1/2 plasmid was transfected into 293T cells. Cell status and fluorescence photographing were observed every 24 th h after transfection (fig. 1), and fluorescence intensity was detected.
(2) Constructing a plasmid co-expressing the engineered GFP and EV71 3C protease (FIG. 2);
based on plasmid pGFP15/20/24-3Ccut1/2, the coding gene sequence (SEQ ID No. 7) of EV71 3C protease and the coding gene sequence (modified GFP) of GFP15/20/24-3Ccut1/2 are connected through a 2A peptide coding gene by a homologous recombination mode to construct pGFP15/20/24-3Ccut1/cut2-P2A-3C plasmid and transfect 293T cells. Cell status and fluorescence photographing were observed every 24 th h after transfection (fig. 1), and fluorescence intensity was detected.
In fluorescence intensity detection, 293T cells were plated in 96-well plates and incubated overnight in a 5% CO2 incubator at 37 ℃; transfecting 0.5ug plasmid per hole, making three repeated holes, and changing liquid after 4-6 h; after culturing in a 5% CO2 incubator at 37℃for 48 hours, the fluorescence value was read on a multifunctional microplate reader (Diken trade Co., ltd.).
(3) Screening: spreading cells to be transfected in a porous plate (96-well plate), then adding pGFP15/20/24-3Ccut1/cut2-P2A-3C plasmid to transfect the cells, culturing the transfected cells, adding different groups of inhibitors to be screened into the porous plate, taking the non-added inhibitors to be screened as a control, observing the state of the cells and performing fluorescence photographing, and detecting the fluorescence intensity; if the fluorescence intensity is increased compared with the control, the inhibitor to be screened has an inhibition effect, and if the fluorescence intensity is increased, the inhibition effect of the inhibitor to be screened is stronger.
As shown in FIG. 1, pGFP15/20/24-3Ccut1/2 showed fluorescence after expression, and pGFP20-3Ccut1 had the weakest fluorescence intensity. This suggests that the modified GFP fluorescent protein formed after insertion of the EV 71C protease cleavage sequence at the specific site of the wild-type GFP, may still be observed with varying degrees of fluorescence intensity. While pGFP15/20/24-3Ccut1/cut2-P2A-3C showed a decrease in fluorescence intensity with co-expression of 3C protease, it was observed that pGFP15-3Ccut2-P2A-3C group cells were still able to observe weak fluorescence, which was determined by both the fluorescence properties of the engineered GFP and the cleavage ability of the 3C protease. Although the background of pGFP15-3Ccut2-P2A-3C group was higher than that of the other experimental groups, it can be seen from FIG. 4b that after GFP15-3Ccut2 and 3C were co-expressed (02 treatment group), the fluorescence intensity was still significantly reduced compared to 01 treatment group, and in other cases, the fluorescence intensities of pGFP15-3Ccut1-P2A-3C vs pGFP15-3Ccut1, pGFP20-3Ccut1-P2A-3Cvs pGFP20-3Ccut1, pGFP20-3Ccut2-P2A-3C vs pGFP20-3Ccut2, GFP24-3Ccut1-P2A-3Cvs pGFP24-3Ccut1 and GFP24-3Ccut2-P2A-3C vs pGFP24-3Ccut2 were all significantly reduced. This suggests that the 3C protease recognizes and cleaves the EV71 3C protease cleavage sequence to affect the fluorescent protein luminescence function.
Coding gene sequence of EV71 3C protease (SEQ ID No. 7):
ggcccgagccttgactttgctctctccctactgagaaggaacatcaggcaagtccaaacagaccaagggcatttcaccatgctgggtgttagggatcgcttagcagtcctcccacgccactcacaacctggcaaaaccatttggattgagcacaaactcgtgaacgtccttgatgcagttgaactggtggatgagcaaggagtcaacctggaattaaccctcatcactcttgataccaacgaaaagtttagggatatcaccaaattcatcccagaaaatatcagcactgctagcgatgccaccctagtgatcaacacggagcacatgccatcaatgtttgtcccggtgggtgacgttgtgcagtatggctttttgaatctcagtggtaagcctacccatcgcaccatgatgtacaattttcctactaaagcaggacagtgtggaggagtggtgacgtctgttgggaaggttgtcggtattcacattggtggcaatggcagacaaggtttttgcgcaggcctcaaaaggagttactttgctagtgaacaa(SEQ ID No.7)。
amino acid sequence of GFP:
MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK*(SEQ ID No.1)。
GFP gene sequence:
ATGGTGAGCAAGGGCGAGGAGCTGTTCACCGGGGTGGTGCCCATCCTGGTCGAGCTGGACGGCGACGTAAACGGCCACAAGTTCAGCGTGTCCGGCGAGGGCGAGGGCGATGCCACCTACGGCAAGCTGACCCTGAAGTTCATCTGCACCACCGGCAAGCTGCCCGTGCCCTGGCCCACCCTCGTGACCACCCTGACCTACGGCGTGCAGTGCTTCAGCCGCTACCCCGACCACATGAAGCAGCACGACTTCTTCAAGTCCGCCATGCCCGAAGGCTACGTCCAGGAGCGCACCATCTTCTTCAAGGACGACGGCAACTACAAGACCCGCGCCGAGGTGAAGTTCGAGGGCGACACCCTGGTGAACCGCATCGAGCTGAAGGGCATCGACTTCAAGGAGGACGGCAACATCCTGGGGCACAAGCTGGAGTACAACTACAACAGCCACAACGTCTATATCATGGCCGACAAGCAGAAGAACGGCATCAAGGTGAACTTCAAGATCCGCCACAACATCGAGGACGGCAGCGTGCAGCTCGCCGACCACTACCAGCAGAACACCCCCATCGGCGACGGCCCCGTGCTGCTGCCCGACAACCACTACCTGAGCACCCAGTCCGCCCTGAGCAAAGACCCCAACGAGAAGCGCGATCACATGGTCCTGCTGGAGTTCGTGACCGCCGCCGGGATCACTCTCGGCATGGACGAGCTGTACAAGTAA(SEQ ID NO.4)。
example 2:
a method for evaluating the inhibitory effect of an EV71 protease inhibitor, which differs from example 1 in that step (1) and step (2) are evaluated in step (3): paving 293T cells to be transfected in a cell culture dish, then adding plasmids pGFP20-3Ccut2-P2A-3C and pGFP24-3Ccut2-P2A-3C for co-expression of modified GFP and EV71 3C protease to respectively transfect the cells, culturing the transfected cells, simultaneously adding 3C protease inhibitors Rupintrivir (commercially available) with different concentrations into the cell culture dish, taking the cells without inhibitors as a control, observing cell states and performing fluorescence photographing every 24 hours, and detecting fluorescence intensity; the fluorescence intensity positively reflects the inhibition effect of the inhibitor, and a higher fluorescence intensity represents a stronger inhibition effect of the inhibitor.
As can be seen from fig. 3, after the inhibitor 1 μm Rupintrivir is added, no fluorescence is observed at 48 hours, and when the inhibitor concentration reaches 10 μm or more, the fluorescence intensity is higher as the inhibitor concentration is increased. Therefore, the plasmid for coexpression of the modified GFP and the EV 71C protease is a very simple and convenient product for evaluating the inhibition effect of the EV71 protease inhibitor at the cellular level.
Example 3: the EV71 3C protease inactivation is simulated, and the modified GFP fluorescence recovery (quantification) is verified to destroy 3C on the basis of pGFP15/20/24-3Ccut1/cut2-P2A-3C plasmid to construct a plasmid:
the specific operation is that 5 continuous stop codons TGA are added after P2A by utilizing PCR amplification (Primer Star) and homologous recombination technology (Uniclone One Step Seamless Cloning Kit kit); the constructed pGFP15/20/24-3Ccut1/cut 2-P2A-5 XSTOP-3C plasmid was transfected. Cell status and fluorescence photographing were observed every 24 th h after transfection, and fluorescence intensity was detected (fig. 4).
As can be seen from FIG. 4, after the cells were transfected with the 3C protease and GFP15/20/24-3Ccut1/cut2 co-expression plasmids (treatment group 02), the fluorescence intensity was significantly reduced compared with that of GFP15/20/24-3Ccut1/cut2 expressed alone (treatment group 03), and the fluorescence intensity was significantly or extremely significantly recovered when the expression of 3C protease was disrupted (treatment group 03), wherein pGFP15-3Ccut2-P2A-3C plasmids of FIG. 4b and pGFP24-3Ccut1-P2A-3C plasmids of FIG. 4e were significantly recovered after the protease was disrupted.
The above-described embodiment is only a preferred embodiment of the present invention, and is not limited in any way, and other variations and modifications may be made without departing from the technical aspects set forth in the claims.
Claims (7)
1. A method for screening an EV71 protease inhibitor, comprising the steps of:
(1) Constructing plasmids for coexpression of modified GFP and EV71 3C protease, wherein the modified GFP is formed by inserting an EV 71C protease cleavage sequence into wild GFP;
(2) Screening: spreading cells to be transfected in a porous plate, then adding plasmids of GFP and EV 71C protease which are subjected to co-expression modification for transfection, culturing the transfected cells, simultaneously adding different groups of inhibitors to be screened into the porous plate, taking the non-added inhibitors to be screened as a control, observing the state of the cells and taking a fluorescent photograph, and detecting the fluorescence intensity; if the fluorescence intensity is increased compared with the control, the inhibitor to be screened has an inhibition effect, and if the fluorescence intensity is increased, the inhibition effect of the inhibitor to be screened is stronger.
2. The method of claim 1, wherein the insertion sites of the EV71 3C protease cleavage sequence on the wild-type GFP amino acid sequence include site a, site B and site C;
the site A is 158 th to 159 th amino acid of the amino acid sequence of the wild GFP, or an amino acid region corresponding to the amino acid sequence with more than 99% sequence identity compared with the amino acid sequence of the wild GFP;
the site B is 117 th to 118 th amino acid of the amino acid sequence of the wild GFP, or an amino acid region corresponding to the amino acid sequence with more than 99% sequence identity compared with the amino acid sequence of the wild GFP;
the locus C is 159 th to 160 th amino acid of the amino acid sequence of the wild GFP, or an amino acid region corresponding to the amino acid sequence with more than 99% sequence identity compared with the amino acid sequence of the wild GFP;
the amino acid sequence of the wild GFP is shown in SEQ ID No. 1.
3. The screening method according to claim 1 or 2, wherein the EV71 3C protease cleavage sequence comprises cut1 and cut2, the cut1 amino acid sequence is shown in SEQ ID No.2, and the cut2 amino acid sequence is shown in SEQ ID No. 3.
4. A plasmid for coexpression of engineered GFP and EV71 3C protease, said plasmid comprising a coding gene sequence for expression of EV71 3C protease and a coding gene sequence for expression of engineered GFP; the modified GFP is obtained by inserting an EV71 3C protease cleavage sequence into the wild GFP.
5. The plasmid of claim 4, wherein the insertion sites of the EV71 3C protease cleavage sequence on the wild-type GFP amino acid sequence comprise site a, site B and site C;
the site A is 158 th to 159 th amino acid of the amino acid sequence of the wild GFP, or an amino acid region corresponding to the amino acid sequence with more than 99% sequence identity compared with the amino acid sequence of the wild GFP;
the site B is 117 th to 118 th amino acid of the amino acid sequence of the wild GFP, or an amino acid region corresponding to the amino acid sequence with more than 99% sequence identity compared with the amino acid sequence of the wild GFP;
the locus C is 159 th to 160 th amino acid of the amino acid sequence of the wild GFP, or an amino acid region corresponding to the amino acid sequence with more than 99% sequence identity compared with the amino acid sequence of the wild GFP;
the amino acid sequence of the wild GFP is shown in SEQ ID No. 1.
6. The plasmid of claim 4, wherein the EV71 3C protease cleavage sequence comprises cut1 and cut2, the cut1 amino acid sequence is shown in SEQ ID No.2, and the cut2 amino acid sequence is shown in SEQ ID No. 3.
7. A method for evaluating an inhibitory effect of an EV71 protease inhibitor, comprising the steps of:
(1) Constructing plasmids for coexpression of modified GFP and EV71 3C protease, wherein the modified GFP is formed by inserting an EV 71C protease cleavage sequence into wild GFP;
(2) Evaluation: spreading the cells to be transfected in a cell culture dish, then adding plasmids of GFP and EV 71C protease which are co-expressed and modified for transfection, culturing the transfected cells, simultaneously adding inhibitors into the cell culture dish, taking the cells without the inhibitors as a control, observing the state of the cells and taking a fluorescent photograph, and detecting the fluorescence intensity; the fluorescence intensity positively reflects the inhibition effect of the inhibitor, and a higher fluorescence intensity represents a stronger inhibition effect of the inhibitor.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202311360921.4A CN117106851B (en) | 2023-10-20 | 2023-10-20 | Screening method for EV71 protease inhibitor and inhibition effect evaluation method |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202311360921.4A CN117106851B (en) | 2023-10-20 | 2023-10-20 | Screening method for EV71 protease inhibitor and inhibition effect evaluation method |
Publications (2)
Publication Number | Publication Date |
---|---|
CN117106851A true CN117106851A (en) | 2023-11-24 |
CN117106851B CN117106851B (en) | 2024-02-06 |
Family
ID=88796930
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN202311360921.4A Active CN117106851B (en) | 2023-10-20 | 2023-10-20 | Screening method for EV71 protease inhibitor and inhibition effect evaluation method |
Country Status (1)
Country | Link |
---|---|
CN (1) | CN117106851B (en) |
Citations (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20040042961A1 (en) * | 2002-07-31 | 2004-03-04 | Robert Menard | Development of an in vivo functional assay for proteases |
CN102649819A (en) * | 2011-02-23 | 2012-08-29 | 中国人民解放军军事医学科学院生物工程研究所 | Screening model of HCV (Hepatitis C Virus) proteolytic enzyme inhibitor |
CN102766607A (en) * | 2012-07-23 | 2012-11-07 | 哈尔滨医科大学 | Fusion protein for screening and evaluating anti-enterovirus 71 medicine and application of fusion protein |
US20180127800A1 (en) * | 2016-10-23 | 2018-05-10 | San Diego State University (SDSU) Foundation, dba San Diego State University Research Foundation | Compositions and methods for identifying zika enzyme inhibitors |
CN115927207A (en) * | 2022-08-19 | 2023-04-07 | 武汉生物制品研究所有限责任公司 | Thermostable enterovirus A group 71 type virus strain and screening method and application thereof |
-
2023
- 2023-10-20 CN CN202311360921.4A patent/CN117106851B/en active Active
Patent Citations (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20040042961A1 (en) * | 2002-07-31 | 2004-03-04 | Robert Menard | Development of an in vivo functional assay for proteases |
CN102649819A (en) * | 2011-02-23 | 2012-08-29 | 中国人民解放军军事医学科学院生物工程研究所 | Screening model of HCV (Hepatitis C Virus) proteolytic enzyme inhibitor |
CN102766607A (en) * | 2012-07-23 | 2012-11-07 | 哈尔滨医科大学 | Fusion protein for screening and evaluating anti-enterovirus 71 medicine and application of fusion protein |
US20180127800A1 (en) * | 2016-10-23 | 2018-05-10 | San Diego State University (SDSU) Foundation, dba San Diego State University Research Foundation | Compositions and methods for identifying zika enzyme inhibitors |
CN115927207A (en) * | 2022-08-19 | 2023-04-07 | 武汉生物制品研究所有限责任公司 | Thermostable enterovirus A group 71 type virus strain and screening method and application thereof |
Non-Patent Citations (2)
Title |
---|
MAJID R. ABEDI ET AL.: "Green fluorescent protein as a scaffold for intracellular presentation of peptides", NUCLEIC ACIDS RESEARCH, vol. 26, no. 2, pages 625 * |
尧晨光等: "EV71 3C蛋白酶表达纯化、活性分析及与抑制剂模拟对接研究", 中国病原生物学杂志, vol. 12, no. 08, pages 722 - 726 * |
Also Published As
Publication number | Publication date |
---|---|
CN117106851B (en) | 2024-02-06 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
Fischl et al. | High-throughput screening using dengue virus reporter genomes | |
Carrillo-Tripp et al. | Challenges associated with research on RNA viruses of insects | |
Lello et al. | Cross-utilisation of template RNAs by alphavirus replicases | |
Trobaugh et al. | Cooperativity between the 3’untranslated region microRNA binding sites is critical for the virulence of eastern equine encephalitis virus | |
Fuller et al. | Rescue of infectious recombinant Hazara nairovirus from cDNA reveals the nucleocapsid protein DQVD caspase cleavage motif performs an essential role other than cleavage | |
Jiang et al. | Engineering recombinant Orsay virus directly in the metazoan host Caenorhabditis elegans | |
Hashimoto et al. | Complete study demonstrating the absence of rhabdovirus in a distinct Sf9 cell line | |
CN112501138A (en) | Method for rapid preparation of infectious RNA viruses | |
Herod et al. | Positive strand RNA viruses differ in the constraints they place on the folding of their negative strand | |
CN117106851B (en) | Screening method for EV71 protease inhibitor and inhibition effect evaluation method | |
CN117088989A (en) | Fluorescent reporter protein | |
CN104789598B (en) | A kind of construction method for the recombinant silkworm cytoplasmic polyhedrosis virus for expressing red fluorescent protein | |
Dalmann et al. | Autonomously replicating RNAs of Bungowannah pestivirus: ERNS is not essential for the generation of infectious particles | |
CN117088987B (en) | Screening method of FMDV protease inhibitor and inhibition effect evaluation method | |
CN117110269B (en) | Screening method of JEV protease inhibitor and inhibition effect evaluation method | |
US8022197B2 (en) | Nucleic acid and gene derived from novel HCV strain and replicon-replicating cell using said gene | |
CN115786280A (en) | Recombinant GI type Japanese encephalitis virus stably expressing red fluorescent protein mCherry and construction method and application thereof | |
CN117106100B (en) | Screening method of PRRSV protease inhibitor and inhibition effect evaluation method | |
CN117092084B (en) | Screening method of WNV protease inhibitor and inhibition effect evaluation method | |
CN117126298B (en) | Screening method of FIPV protease inhibitor and inhibition effect evaluation method | |
CN117106101B (en) | Plasmid and ASFV protease inhibitor screening and drug effect evaluation method | |
York | Searching for relatives of SARS-CoV-2 in bats | |
CN117089575B (en) | Method for screening plasmid and HCV protease inhibitor and evaluating drug effect | |
CN117089576B (en) | Method for screening plasmid and PV protease inhibitor and evaluating drug effect | |
CN117088988B (en) | Fusion protein, plasmid and application thereof in HIV protease inhibitor screening and drug effect evaluation |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PB01 | Publication | ||
PB01 | Publication | ||
SE01 | Entry into force of request for substantive examination | ||
SE01 | Entry into force of request for substantive examination | ||
GR01 | Patent grant | ||
GR01 | Patent grant |