CN113527461B - Horseshoe head bats source antibacterial peptide RF-CATH1 and application thereof - Google Patents

Horseshoe head bats source antibacterial peptide RF-CATH1 and application thereof Download PDF

Info

Publication number
CN113527461B
CN113527461B CN202110944844.1A CN202110944844A CN113527461B CN 113527461 B CN113527461 B CN 113527461B CN 202110944844 A CN202110944844 A CN 202110944844A CN 113527461 B CN113527461 B CN 113527461B
Authority
CN
China
Prior art keywords
cath1
antibacterial peptide
peptide
antibacterial
horseshoe
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Active
Application number
CN202110944844.1A
Other languages
Chinese (zh)
Other versions
CN113527461A (en
Inventor
周江
罗暄巾
王义鹏
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Guizhou Education University
Original Assignee
Guizhou Education University
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Guizhou Education University filed Critical Guizhou Education University
Priority to CN202110944844.1A priority Critical patent/CN113527461B/en
Publication of CN113527461A publication Critical patent/CN113527461A/en
Application granted granted Critical
Publication of CN113527461B publication Critical patent/CN113527461B/en
Active legal-status Critical Current
Anticipated expiration legal-status Critical

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • AHUMAN NECESSITIES
    • A23FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23KFODDER
    • A23K20/00Accessory food factors for animal feeding-stuffs
    • A23K20/10Organic substances
    • A23K20/142Amino acids; Derivatives thereof
    • A23K20/147Polymeric derivatives, e.g. peptides or proteins
    • AHUMAN NECESSITIES
    • A23FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23LFOODS, FOODSTUFFS, OR NON-ALCOHOLIC BEVERAGES, NOT COVERED BY SUBCLASSES A21D OR A23B-A23J; THEIR PREPARATION OR TREATMENT, e.g. COOKING, MODIFICATION OF NUTRITIVE QUALITIES, PHYSICAL TREATMENT; PRESERVATION OF FOODS OR FOODSTUFFS, IN GENERAL
    • A23L3/00Preservation of foods or foodstuffs, in general, e.g. pasteurising, sterilising, specially adapted for foods or foodstuffs
    • A23L3/34Preservation of foods or foodstuffs, in general, e.g. pasteurising, sterilising, specially adapted for foods or foodstuffs by treatment with chemicals
    • A23L3/3454Preservation of foods or foodstuffs, in general, e.g. pasteurising, sterilising, specially adapted for foods or foodstuffs by treatment with chemicals in the form of liquids or solids
    • A23L3/3463Organic compounds; Microorganisms; Enzymes
    • A23L3/3526Organic compounds containing nitrogen
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/12Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K8/00Cosmetics or similar toiletry preparations
    • A61K8/18Cosmetics or similar toiletry preparations characterised by the composition
    • A61K8/30Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds
    • A61K8/64Proteins; Peptides; Derivatives or degradation products thereof
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/04Antibacterial agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/10Antimycotics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61QSPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
    • A61Q17/00Barrier preparations; Preparations brought into direct contact with the skin for affording protection against external influences, e.g. sunlight, X-rays or other harmful rays, corrosive materials, bacteria or insect stings
    • A61Q17/005Antimicrobial preparations
    • AHUMAN NECESSITIES
    • A23FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23VINDEXING SCHEME RELATING TO FOODS, FOODSTUFFS OR NON-ALCOHOLIC BEVERAGES AND LACTIC OR PROPIONIC ACID BACTERIA USED IN FOODSTUFFS OR FOOD PREPARATION
    • A23V2002/00Food compositions, function of food ingredients or processes for food or foodstuffs
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides

Abstract

The invention discloses a natural antibacterial peptide RF-CATH1 and application thereof in antibiosis. The antibacterial peptide RF-CATH1 is derived from horsetail bats. The mature peptide sequence of the antibacterial peptide is obtained by searching a horsetail batus gene database, screening and analyzing, and the amino acid sequence of the mature peptide sequence is shown as SEQ ID NO.1 in a sequence table. Through comparative analysis, the natural antibacterial peptide RF-CATH1 has obvious difference with the amino acid sequences of all currently known antibacterial peptides, and belongs to a novel antibacterial peptide. The antibacterial peptide RF-CATH1 has strong antibacterial activity on gram-positive bacteria, gram-negative bacteria and fungi, has the characteristics of quick bactericidal action and low hemolytic activity, and can be applied to preparation of antibacterial and bacteria growth inhibiting medicines, preservatives, veterinary medicines, animal feeds and cosmetics.

Description

Horseshoe head bats source antibacterial peptide RF-CATH1 and application thereof
Technical Field
The invention relates to a natural antibacterial peptide and application thereof, in particular to a natural antibacterial peptide RF-CATH1 derived from horsehead horsetail and application thereof, belonging to the technical field of biomedicine.
Background
The traditional antibiotics have remarkable effects on treating bacterial infection diseases, but in recent years, along with the abuse of the traditional antibiotics in the fields of medicine, breeding industry and the like, microorganisms have stronger and stronger tolerance to the traditional antibiotics, and meanwhile, some super bacteria with extremely strong drug resistance appear, and the problem of microbial drug resistance becomes a problem seriously threatening the health of human beings. There is a continuing need for new antimicrobial agents that can be developed because the resistance to microbial agents has been addressed by the use of new or alternative antimicrobial agents that have not been used by resistant microorganisms and that are further resistant to such new antibiotics after a period of use. The development of a novel antibacterial mechanism medicament is a new direction for solving the problem of microbial tolerance.
The antibacterial peptide is a small molecular polypeptide and has the effect of killing bacteria, fungi, viruses, protozoa and the like. The antibacterial peptide has the characteristics of small molecular weight, simple structure, strong bactericidal activity and the like. The bactericidal mechanism of most antimicrobial peptides is by acting on the phospholipid bilayer on the bacterial cell membrane, destroying the integrity of the cell membrane and forming transmembrane channels in the cell membrane, causing the cell contents to be dissolved out and leading to cell death. This unique bactericidal mechanism is generally not susceptible to microbial resistance. Moreover, the antibacterial peptide has no toxicity to normal cells and tissues of mammals generally and has no residue problem, so the antibacterial peptide is expected to become a novel high-efficiency antibacterial drug and has wide development and application prospects.
Disclosure of Invention
The invention aims to overcome the defects of the traditional antibiotics, provides a natural antibacterial peptide RF-CATH1 from horsetail bats, and further provides an amino acid sequence of the antibacterial peptide and application thereof in the aspect of antibiosis. The horsemanspipe herb derived antibacterial peptide RF-CATH1 has broad-spectrum and efficient antibacterial effect, has strong antibacterial activity on gram-positive bacteria, gram-negative bacteria and fungi, has the characteristics of small molecular weight, simple synthesis and low hemolytic activity, and can be applied to the fields of medicines, cosmetics, food fresh keeping and breeding industry.
In order to realize the purpose of the invention, the invention provides the following technical scheme:
the natural antibacterial peptide RF-CATH1 is an antibacterial peptide from the pterocarpus marsupium of pterodactyla, the antibacterial peptide RF-CATH1 is composed of 41 amino acids, the molecular weight is 4641.32Da, and the isoelectric point is 10.16. The amino acid sequence is Lys Leu Gly Arg Trp Leu Gly Lys Leu Ile Gln Lys Gly Gly Gln Lys Ile Gly Gln Gly Leu Glu Asn Ile Gly Arg Arg Ile Lys Gly Phe Phe Ser Asn Asp Glu Pro Arg Glu Glu Ser shown in SEQ ID NO.1 of the sequence table, and all amino acids are L-type.
The invention also provides a chemical preparation method of the antibacterial peptide RF-CATH1, which comprises the following steps:
according to the amino acid sequence of the mature peptide of the obtained natural antibacterial peptide RF-CATH1, combining the whole sequence by an automatic polypeptide synthesizer (433A, Applied Biosystems), desalting and purifying by HPLC reverse phase column chromatography; the purity is identified by high performance liquid chromatography HPLC method, the molecular weight is determined by matrix assisted laser desorption ionization time of flight mass spectrometry (MALDI-TOF), isoelectric point is determined by isoelectric focusing electrophoresis, and the amino acid sequence structure is determined by an automatic amino acid sequencer.
In addition, the invention provides the application of horseshoe brier source antibacterial peptide RF-CATH1 in preparing antibacterial drugs, and horseshoe brier source antibacterial peptide RF-CATH1 is used as the only effective component or one of the effective components.
The application of horseshoe brier source antibacterial peptide RF-CATH1 in preparing medicines for inhibiting bacterial growth comprises horseshoe brier source antibacterial peptide RF-CATH1 as the only effective component or one of the effective components.
The batus ferrugineus source antibacterial peptide RF-CATH1 is applied to the preparation of preservatives.
The horsemanspipe herb derived antibacterial peptide RF-CATH1 is applied to the preparation of animal feed additives.
The horseshoe batus source antibacterial peptide RF-CATH1 is applied to the preparation of cosmetic additives.
The invention has the advantages of providing the natural antibacterial peptide RF-CATH1 derived from horseshoe brier and the application thereof in the aspect of antibiosis. The antibacterial peptide RF-CATH1 has broad-spectrum and efficient antibacterial action, has the characteristics of small molecular weight, simple synthesis and low hemolytic activity, and can be applied to the fields of medicines, cosmetics, food preservation and breeding industry.
Drawings
FIG. 1 hemolytic activity of RF-CATH 1.
Detailed Description
Example 1:
discovery of natural antibacterial peptide RF-CATH1
1) Extracting total RNA of horsetail batus lung tissues:
firstly, 100mg of horsetail bats lung tissue is taken and put into a mortar, liquid nitrogen is added into the mortar to be ground into powder, the powder is transferred into an EP tube, 1ml of total RNA extraction buffer (Trizol, a product of Life company in America) is added into the powder, the mixture is fully mixed, and then the mixture is centrifuged at 12000rpm for 10min at 4 ℃.
② centrifuging and taking supernatant, adding 0.2ml chloroform solution, mixing vigorously, standing at room temperature for 10 minutes, then centrifuging at 4 ℃, 12000rpm for 10 minutes, and discarding the precipitate.
③ adding isopropanol with the same volume into the supernatant, standing for 10 minutes at room temperature, centrifuging for 10 minutes at 4 ℃ and 12000rpm, collecting the precipitate, washing the precipitate with 75% (V/V) ethanol once, and drying in the air, wherein the precipitate at the bottom of the tube is the total RNA of the skin of the Wuyi torreya.
2) The horsetail batus lung tissue cDNA double-chain synthesis: synthesized using the In-Fusion SMARTERTM directive cDNA Library Construction Kit from CLONTECH.
(1) First strand cDNA Synthesis (reverse transcription of mRNA):
adding 1 mul of horsetail bats lung tissue total RNA, 1 mul of 3 'end one-strand synthesis Primer (3' In-Fusion SMARTer CDS Primer) and 2.5 mul of RNase-free water into an RNase-free PCR tube to make the total volume reach 4.5 mul, mixing uniformly, centrifuging for a short time (2000rpm, 30s), and preserving heat at 72 ℃ for 3 minutes after centrifuging; after incubation, the tubes were incubated at 42 ℃ for 2 minutes.
② adding the following reagents (all prepared In-Fusion SMARTERTM directed cDNA Library Construction Kit of CLONTECH Co., Ltd.) into the centrifuge tube, 2.0. mu.l of 5 Xfirst strand buffer, 0.25. mu.l of 100mM DTT, 1.0. mu.l of 10mM dNTP Mix, 1.0. mu.l of SMARTer V Oligonucleoside, 0.25. mu.l of RNase Inhibitor and 1.0. mu.l of SMARTScribere Reverse Transcriptase, mixing the reagents In the centrifuge tube and centrifuging briefly (2000rpm, 30s), keeping the temperature at 42 ℃ for 90min, and then keeping the temperature at 68 ℃ for 10 min. After the incubation treatment, the centrifuge tube was placed on ice to stop the synthesis of the first strand. Mu.l of the first strand of the synthesized cDNA was taken from the centrifuge tube and used.
(2) Amplifying the second strand by long-terminal polymerase chain reaction (LD-PCR) (all reagents are provided In-Fusion SMARTERTM directive cDNA Library Construction Kit of CLONTECH)
Mu.l of cDNA first strand (reverse transcription of mRNA), 80. mu.l of deionized water, 10. mu.l of 10 × Advantage 2PCR buffer, 2. mu.l of 50 × dNTP Mix, 2. mu.l of 5 'PCR primer, 2. mu.l of CDS III/3' PCR primer and 2. mu.l of 50 × Advantage 2Polymerase Mix were mixed in a PCR tube preheated at 95 ℃.
Amplifying in a PCR instrument according to the following procedures:
at 95 ℃ for 1 min; 18 cycles: 95 deg.C, 15sec, 65 deg.C, 30sec, 68 deg.C, 6 min. After the circulation was completed, the cDNA double strand synthesized in the centrifuge tube was stored at-80 ℃.
(3) Cloning of a horsehead hepcidin encoding gene:
the forward primer 5-FCATH is designed and synthesized according to the signal peptide conserved region of the cDNA sequence of the batcathelicidins family antibacterial peptide submitted in NCBI database: 5'-ATGGAGACCCAGGGGGCCAGCCCG-3', the reverse primer is 3 ' -PCR primer In the In-Fusion SMARTERTM directive cDNA Library Construction Kit of CLONTECH, and the sequence is 5'-CGGGGTACGATGAGACACCAT-3'. The PCR reaction was performed under the following conditions: 95 ℃ for 4min, 95 ℃ for 30sec, 57 ℃ for 30sec and 72 ℃ for 1min, 30 cycles. After the amplification, the target fragment was recovered with a gel recovery kit (Tiangen). The recovered target fragment was ligated to pMD19-T vector (Takara, Dalian) to transform DH 5. alpha. competent cells. Plates were plated and screened for ampicillin, and single colonies were picked and the insert size was determined by PCR using M13 primer. Positive colonies were picked, plasmids were extracted by shake culture, and nucleotide sequencing was performed using an Applied Biosystems DNA sequencer, model ABI PRISM 377.
The gene sequence was expressed using the blastX software of the NCBI website (http:// blast.st-va. NCBI. nlm. nih. gov/blast. cgipram ═ blastX:&PAGE_TYPE=BlastSearch&LINK _ LOC ═ blustonome) shows that the coded product may be the precursor of horsehead horseshoe caterpillar family antibacterial peptide. The polypeptide precursor sequence encoded by the gene was further modified by protein blast software of NCBI website (http:// blast.st-va. NCBI. nlm. nih. gov/blast. cgiprogram ═ blast)&PAGE_TYPE=BlastSearch&LINK _ LOC ═ blustonome), and comparing and analyzing with the sequences of the previously discovered antimicrobial peptides of other animal-derived cathelicidins families, and determining that the enzyme cutting site is-N in the maturation process of the antimicrobial peptide132-V133The mature peptide sequence KLGRWLGKLIQKGGQKIGQGLENIGRRIKGFFSNDEPREES (amino acid one letter sequence) of the antibacterial peptide is obtained and named as RF-CATH 1. The amino acid sequence of the RF-CATH1 is obviously different from that of all the currently known antibacterial peptides.
The precursor encoding RF-CATH1 consists of 174 amino acid residues. The sequence length is 618 bases.
Figure BDA0003216400050000051
Figure BDA0003216400050000061
Example 2
Chemical synthesis method of antibacterial peptide RF-CATH1
(1) The full sequence of RF-CATH1 was synthesized by HPLC C using an automated polypeptide synthesizer (433A, Applied Biosystems)18Desalting and purifying by reverse phase column chromatography. (2) The molecular weight is measured by using a conventional matrix-assisted laser desorption ionization time of flight mass spectrometry (MALDI-TOF). (3) High performance liquid phase for purified RF-CATH1Purity of the product by chromatographic HPLC>95 percent, the isoelectric point determined by isoelectric focusing electrophoresis is 10.16, and the amino acid sequence structure is determined to be consistent with the natural RF-CATH1 by an automatic amino acid sequencer.
Example 3:
detection of antibacterial activity of antibacterial peptide RF-CATH1
(1) The test strains preserved on the inclined planes are respectively picked and evenly spread on a MH solid culture medium (purchased from Qingdao Haibo biotechnology, Inc.) plate, a sterilized filter paper sheet with the diameter of 0.5cm is placed on the surface of the culture medium, 10 mul of RF-CATH1 sample solution dissolved in 2mg/ml of sterilized deionized water is dripped, inverted culture is carried out at 37 ℃ for 18-20 hours, and whether the inhibition zone is formed or not is observed. If the sample has antibacterial activity, clear and transparent inhibition zones can be formed around the filter paper sheet, and the larger the inhibition zone is, the stronger the antibacterial activity of the sample is. The results showed that the antimicrobial peptide RF-CATH1 has antimicrobial activity against all the strains listed in table 1.
(2) The Minimum Inhibitory Concentration (Minimum Inhibitory Concentration) was determined by 2-fold dilution: and (3) selecting the bacterial strain with the inhibition zone in the experiment step (1) to carry out an MIC determination experiment. The test strains were inoculated into MH liquid medium (purchased from Qingdao Haibo Biotech Co., Ltd.), then cultured with shaking at 37 ℃ in an incubator to logarithmic growth phase, and then the culture broth of the strains cultured to logarithmic growth phase was diluted to 2X 10 with fresh MH liquid medium5cfu/ml is ready for use.
100 mul MH liquid culture medium is added into each hole of a sterile 96-hole plate in advance, then 100 mul RF-CATH1 sample solution which is diluted to a certain concentration by using the MH liquid culture medium and filtered by a filter membrane with the hole of 0.22 mu m is added into the first hole, after uniform mixing, 100 mul is added into the 2 nd hole, the dilution is carried out in multiple times, 100 mul is sucked out from the 9 th hole and discarded, and the 10 th hole is a control tube. After adding 100. mu.l of the diluted strain culture solution to each well, the 96-well plate was placed in an incubator at 37 ℃ and cultured with slow shaking for 18 hours, and the light absorption was measured at a wavelength of 600 nm. The minimum inhibitory concentration is the lowest sample concentration at which no bacterial growth is visible. The results are shown in Table 1.
As can be seen from Table 1, the antimicrobial peptide RF-CATH1 shows very strong antimicrobial activity against gram-positive bacteria, gram-negative bacteria and fungi, including various clinically isolated pathogenic bacteria. The MIC value was in the range of 4.69-18.75. mu.g/ml.
TABLE 1 antibacterial Activity of horseshoe bats antibacterial peptide RF-CATH1
Figure BDA0003216400050000071
Figure BDA0003216400050000081
Example 4:
determination of Sterilization Rate of antimicrobial peptide RF-CATH1
Escherichia coli ATCC25922 was cultured in MH broth (Qingdao Haibo Biotech Co., Ltd.) at 37 ℃ for 12 hours, and then diluted to 10 with fresh MH broth6cfu/ml bacterial suspension. A sample of RF-CATH1 dissolved in sterile deionized water was added to the bacterial suspension to a final concentration of 5 × MIC (46.9 μ g/ml). The bacterial liquid added with the RF-CATH1 sample is placed in an incubator at 37 ℃ for shake culture, 50 mu l of bacterial liquid is taken to dilute 1000 times respectively at 0 minute, 15 minutes, 30 minutes, 60 minutes, 120 minutes and 180 minutes, then 50 mu l of diluted bacterial liquid is taken to coat on an MH solid culture medium, and bacterial colonies are counted after the bacterial liquid is cultured in the incubator at 37 ℃ overnight. Ampicillin was used as a positive control and sterilized deionized water was used as a negative control in this example. The results of the experiment are shown in table 2.
As can be seen from the comparison in Table 2, the sterilization rate of RF-CATH1 was faster than that of the positive control ampicillin, which required 120 minutes to kill all bacteria in 60 minutes.
TABLE 2 Sterilization rate of the antimicrobial peptides RF-CATH1
Figure BDA0003216400050000091
Example 5:
determination of hemolytic Activity of RF-CATH1
The collected fresh C57 mouse blood was mixed with the Ashi solution for anticoagulation, washed 2 times with physiological saline and resuspended to 107-108cell/ml suspension. Mixing the diluted erythrocyte suspension with RF-CATH1 sample solution with certain concentration dissolved in normal saline, keeping the temperature at 37 ℃ for 30min, centrifuging at 1000rpm for 5min, and measuring the light absorption value of the supernatant at the wavelength of 540 nm. The negative control uses physiological saline, the positive control uses TritonX-100, and the percentage of hemolysis is calculated according to the following formula: percent hemolysis H% ═ a sample-a negative control/a positive control × 100%. The results in FIG. 1 show that the percent hemolysis is 2.8% and 5.2% at concentrations of RF-CATH1 up to 100. mu.g/ml and 200. mu.g/ml, respectively, indicating that RF-CATH1 has very low hemolytic activity on mammalian erythrocytes.
As can be seen from the above examples, the horseshoe brier antibacterial peptide RF-CATH1 can be obtained by chemical synthesis, and has strong antibacterial activity on gram-positive bacteria, gram-negative bacteria and fungi, including some clinically isolated pathogenic bacteria, and rapid bactericidal action. The antibacterial peptide has the characteristics of small molecular weight, simple synthesis and low hemolytic activity, and can be applied to the fields of medicines, cosmetics, food preservation and breeding industry.
Sequence listing
<110> university of Guizhou Master
<120> horseshoe head bats source antibacterial peptide RF-CATH1 and application thereof
<160> 4
<170> SIPOSequenceListing 1.0
<210> 1
<211> 41
<212> PRT
<213> horseshoe-head bats (Rhinolophus ferummequinum)
<400> 1
Lys Leu Gly Arg Trp Leu Gly Lys Leu Ile Gln Lys Gly Gly Gln Lys
1 5 10 15
Ile Gly Gln Gly Leu Glu Asn Ile Gly Arg Arg Ile Lys Gly Phe Phe
20 25 30
Ser Asn Asp Glu Pro Arg Glu Glu Ser
35 40
<210> 2
<211> 618
<212> DNA
<213> horseshoe rose (Rhinolophus ferummequinum)
<400> 2
atggagaccc agggcggcag cccctccttg aggcggtggt cactgttgct actgctgctg 60
ggccgggcca tgcctccagc cactgcccag accctcacat acagggaggc cgtgctccgt 120
gctgtggatg gcttcaacca gcggtcctca gaagctagtc tctaccgcct cctggagcta 180
gaccagccgc ccgagggaga tgagaaccca aacatcccga agcctgtgag cttcacggtg 240
aaggagactg tgtgtcccag gaagctgcgg aggacacagc agccaatgga gcagtgtgac 300
ttcaaggaga atgggctggt gaaacagtgt gtggggacag tcactctgga ccaggtcgat 360
ggctactttg acattaactg tgagaagctc cagaacgtca aactcggcag atggcttggc 420
aaactcatac agaaaggcgg gcagaagatt ggccaagggc ttgaaaacat tggcaggaga 480
atcaaaggtt ttttttcaaa tgatgagccc agggaagagt cctaagggcc tgctttgccc 540
tggcttgggc tactggattc tgaaaaataa attcttgtaa aagcaacttc aaaaaaaaaa 600
agaaaaaaaa aaaaaaaa 618
<210> 3
<211> 24
<212> DNA
<213> horseshoe-head bats (Rhinolophus ferummequinum)
<400> 3
atggagaccc agggggccag cccg 24
<210> 4
<211> 21
<212> DNA
<213> horseshoe-head bats (Rhinolophus ferummequinum)
<400> 4
cggggtacga tgagacacca t 21

Claims (6)

1. An horseshoe brier source antibacterial peptide RF-CATH1 is characterized in that the antibacterial peptide is derived from horseshoe brier, consists of 41 amino acids, has a molecular weight of 4641.32Da and an isoelectric point of 10.16, an amino acid sequence table of the horseshoe brier source antibacterial peptide is shown in SEQ ID NO.1, and all the amino acids are L-type.
2. The use of batryticatus head source antibacterial peptide RF-CATH1 in the preparation of antibacterial medicine according to claim 1, wherein: horsemanspipe herb derived antibacterial peptide RF-CATH1 as the only effective component or one of the effective components; the type of strain targeted is gram-positive bacteria, gram-negative bacteria, candida albicans or candida glabrata.
3. The use of batryticatus head-derived antimicrobial peptide RF-CATH1 as claimed in claim 1 in the preparation of a medicament for inhibiting bacterial growth, wherein: horsemanspipe herb derived antibacterial peptide RF-CATH1 as the only effective component or one of the effective components; the bacteria targeted are gram positive or gram negative bacteria.
4. Use of the batryticated horseshoe batryticated plant derived antimicrobial peptide RF-CATH1 as claimed in claim 1 in the preparation of antiseptic.
5. Use of batryticatus head source antibacterial peptide RF-CATH1 as claimed in claim 1 in preparing animal feed additive.
6. Use of batula equine derived antibacterial peptide RF-CATH1 as claimed in claim 1 in the preparation of cosmetic additives.
CN202110944844.1A 2021-08-17 2021-08-17 Horseshoe head bats source antibacterial peptide RF-CATH1 and application thereof Active CN113527461B (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
CN202110944844.1A CN113527461B (en) 2021-08-17 2021-08-17 Horseshoe head bats source antibacterial peptide RF-CATH1 and application thereof

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
CN202110944844.1A CN113527461B (en) 2021-08-17 2021-08-17 Horseshoe head bats source antibacterial peptide RF-CATH1 and application thereof

Publications (2)

Publication Number Publication Date
CN113527461A CN113527461A (en) 2021-10-22
CN113527461B true CN113527461B (en) 2022-06-21

Family

ID=78122472

Family Applications (1)

Application Number Title Priority Date Filing Date
CN202110944844.1A Active CN113527461B (en) 2021-08-17 2021-08-17 Horseshoe head bats source antibacterial peptide RF-CATH1 and application thereof

Country Status (1)

Country Link
CN (1) CN113527461B (en)

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN113527461B (en) * 2021-08-17 2022-06-21 贵州师范大学 Horseshoe head bats source antibacterial peptide RF-CATH1 and application thereof

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN1878789A (en) * 2003-10-21 2006-12-13 加利福尼亚大学董事会 Human cathelicidin antimicrobial peptides
CN113527461A (en) * 2021-08-17 2021-10-22 贵州师范大学 Horseshoe head bats source antibacterial peptide RF-CATH1 and application thereof

Family Cites Families (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20040063107A1 (en) * 2001-05-04 2004-04-01 Plowman Gregory D. Novel proteases
US11369578B2 (en) * 2018-11-15 2022-06-28 Bluewillow Biologics, Inc. Persistent topical antimicrobial compositions and methods of using the same

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN1878789A (en) * 2003-10-21 2006-12-13 加利福尼亚大学董事会 Human cathelicidin antimicrobial peptides
CN113527461A (en) * 2021-08-17 2021-10-22 贵州师范大学 Horseshoe head bats source antibacterial peptide RF-CATH1 and application thereof

Non-Patent Citations (3)

* Cited by examiner, † Cited by third party
Title
Novel Cathelicidin Antimicrobial Peptides from Paa robertingeri.;Luo, Qinghua 等;《Annual Research & Review in Biology》;20191231;第1-10页 *
Novel cathelicidin-derived antimicrobial peptides from Equus asinus;Zekuan Lu 等;《The FEBS Journal》;20100531;第277卷(第10期);第2329-2339页 *
两栖类动物Cathelicidins家族抗菌肽研究进展;王妍 等;《动物学杂志》;20210430;第56卷(第2期);第303-319页 *

Also Published As

Publication number Publication date
CN113527461A (en) 2021-10-22

Similar Documents

Publication Publication Date Title
Supungul et al. Cloning, expression and antimicrobial activity of crustinPm1, a major isoform of crustin, from the black tiger shrimp Penaeus monodon
CN106188265B (en) A kind of antimicrobial peptide Cm-CATH2 and its gene, preparation method and application
Zhuang et al. Three new piscidins from orange-spotted grouper (Epinephelus coioides): Phylogeny, expression and functional characterization
CN113527461B (en) Horseshoe head bats source antibacterial peptide RF-CATH1 and application thereof
CN110156875B (en) Antibacterial peptide H5-p5, and preparation method and application thereof
Vaseeharan et al. Molecular cloning, sequence analysis and expression of Fein-Penaeidin from the haemocytes of Indian white shrimp Fenneropenaeus indicus
CN109134635B (en) Antibacterial peptide with composite bioactivity and preparation method and application thereof
CN104761629B (en) A kind of broad-spectrum high efficacy antimicrobial peptide Pb CATH OH1 and its gene, preparation method and application
CN113321708B (en) Preparation of artificially designed antibacterial peptide and application of artificially designed antibacterial peptide in aquatic products
Huo et al. Molecular characterization, antibacterial activity and mechanism analyzation of three different piscidins from black rockfish, Sebastes schlegelii
CN104177485A (en) Yangtze alligator antimicrobial peptide Alligatorin 6 and application thereof
CN104910266B (en) A kind of Wuyi rapids frog antibacterial peptide and its encoding gene and application
CN113480631B (en) Horseshoe head bats source antibacterial peptide RF-CATH2 and application thereof
CN113480630B (en) Hepialus longissimus source antibacterial peptide MS-CATH and application thereof
CN112480227A (en) Protein for improving pathogenic bacterium resistance of sturgeon and preparation method and application thereof
CN112375132B (en) Antibacterial peptide derived from Taihu whitefish and application thereof
CN101475630B (en) Bloody noun antibacterial peptide temporin-La, genes thereof and use in pharmacy
Zhuang et al. Characterization of antibacterial activities and the related mechanisms of a β-defensin in turbot (Scophthalmus maximus)
CN101570760B (en) Recombinant mouse beta-alexin 3 polypeptide, preparation and use thereof
CN113801214A (en) Calipes gigantea source antibacterial peptide HA-CATH and application thereof
CN110923289B (en) Screening method of drug for treating citrus greening disease
CN111518189A (en) Antimicrobial peptide MSPiscidin-3, and coding gene and application thereof
CN108467426B (en) Taihu lake whitefish host defense peptide and application thereof
CN108409833B (en) Novel candida-killing polypeptide FCP1 and preparation method thereof
CN106432459B (en) Antibacterial peptide of hypsizigus marmoreus, gene thereof and application thereof in pharmacy

Legal Events

Date Code Title Description
PB01 Publication
PB01 Publication
SE01 Entry into force of request for substantive examination
SE01 Entry into force of request for substantive examination
GR01 Patent grant
GR01 Patent grant