CN113527461A - Horseshoe head bats source antibacterial peptide RF-CATH1 and application thereof - Google Patents
Horseshoe head bats source antibacterial peptide RF-CATH1 and application thereof Download PDFInfo
- Publication number
- CN113527461A CN113527461A CN202110944844.1A CN202110944844A CN113527461A CN 113527461 A CN113527461 A CN 113527461A CN 202110944844 A CN202110944844 A CN 202110944844A CN 113527461 A CN113527461 A CN 113527461A
- Authority
- CN
- China
- Prior art keywords
- cath1
- antibacterial peptide
- antibacterial
- peptide
- horseshoe
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Granted
Links
- 239000003910 polypeptide antibiotic agent Substances 0.000 title claims abstract description 55
- 241000288673 Chiroptera Species 0.000 title abstract description 10
- 230000000844 anti-bacterial effect Effects 0.000 claims abstract description 19
- 239000003814 drug Substances 0.000 claims abstract description 10
- 238000002360 preparation method Methods 0.000 claims abstract description 8
- 230000002401 inhibitory effect Effects 0.000 claims abstract description 6
- 230000012010 growth Effects 0.000 claims abstract description 4
- 239000003755 preservative agent Substances 0.000 claims abstract description 3
- 125000003275 alpha amino acid group Chemical group 0.000 claims abstract 3
- 150000001413 amino acids Chemical class 0.000 claims description 13
- 230000001580 bacterial effect Effects 0.000 claims description 12
- 102000044503 Antimicrobial Peptides Human genes 0.000 claims description 8
- 108700042778 Antimicrobial Peptides Proteins 0.000 claims description 8
- 241000228636 Rhinolophus Species 0.000 claims description 5
- 235000019730 animal feed additive Nutrition 0.000 claims description 2
- 239000000490 cosmetic additive Substances 0.000 claims description 2
- 241000283073 Equus caballus Species 0.000 claims 2
- 230000002335 preservative effect Effects 0.000 claims 1
- 108090000765 processed proteins & peptides Proteins 0.000 abstract description 11
- 241000894006 Bacteria Species 0.000 abstract description 8
- 241000195955 Equisetum hyemale Species 0.000 abstract description 8
- 230000002949 hemolytic effect Effects 0.000 abstract description 7
- 102000004196 processed proteins & peptides Human genes 0.000 abstract description 7
- 229940079593 drug Drugs 0.000 abstract description 6
- 241000233866 Fungi Species 0.000 abstract description 5
- 108090000623 proteins and genes Proteins 0.000 abstract description 5
- 241000192125 Firmicutes Species 0.000 abstract description 4
- 239000002537 cosmetic Substances 0.000 abstract description 4
- 230000003115 biocidal effect Effects 0.000 abstract description 3
- 241001465754 Metazoa Species 0.000 abstract description 2
- 238000010835 comparative analysis Methods 0.000 abstract 1
- 238000012216 screening Methods 0.000 abstract 1
- 239000002299 complementary DNA Substances 0.000 description 9
- 238000003786 synthesis reaction Methods 0.000 description 8
- 239000007788 liquid Substances 0.000 description 7
- 230000015572 biosynthetic process Effects 0.000 description 6
- 238000002156 mixing Methods 0.000 description 6
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 6
- 239000003242 anti bacterial agent Substances 0.000 description 5
- 229940088710 antibiotic agent Drugs 0.000 description 5
- 239000001963 growth medium Substances 0.000 description 5
- 238000004128 high performance liquid chromatography Methods 0.000 description 5
- 239000000203 mixture Substances 0.000 description 5
- 229920001184 polypeptide Polymers 0.000 description 5
- 239000000523 sample Substances 0.000 description 5
- 238000009395 breeding Methods 0.000 description 4
- 230000001488 breeding effect Effects 0.000 description 4
- 238000010276 construction Methods 0.000 description 4
- 239000008367 deionised water Substances 0.000 description 4
- 229910021641 deionized water Inorganic materials 0.000 description 4
- 230000005764 inhibitory process Effects 0.000 description 4
- 210000004072 lung Anatomy 0.000 description 4
- 238000001840 matrix-assisted laser desorption--ionisation time-of-flight mass spectrometry Methods 0.000 description 4
- 238000000034 method Methods 0.000 description 4
- 230000000813 microbial effect Effects 0.000 description 4
- 239000013641 positive control Substances 0.000 description 4
- 239000002244 precipitate Substances 0.000 description 4
- 239000000725 suspension Substances 0.000 description 4
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 3
- 206010018910 Haemolysis Diseases 0.000 description 3
- 229960000723 ampicillin Drugs 0.000 description 3
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 3
- 230000008901 benefit Effects 0.000 description 3
- 210000004027 cell Anatomy 0.000 description 3
- 210000000170 cell membrane Anatomy 0.000 description 3
- 239000003153 chemical reaction reagent Substances 0.000 description 3
- 238000002474 experimental method Methods 0.000 description 3
- VPZXBVLAVMBEQI-UHFFFAOYSA-N glycyl-DL-alpha-alanine Natural products OC(=O)C(C)NC(=O)CN VPZXBVLAVMBEQI-UHFFFAOYSA-N 0.000 description 3
- 230000008588 hemolysis Effects 0.000 description 3
- 230000007246 mechanism Effects 0.000 description 3
- 239000013642 negative control Substances 0.000 description 3
- 239000000843 powder Substances 0.000 description 3
- 239000002243 precursor Substances 0.000 description 3
- 239000012488 sample solution Substances 0.000 description 3
- 239000000243 solution Substances 0.000 description 3
- 230000001954 sterilising effect Effects 0.000 description 3
- 238000004659 sterilization and disinfection Methods 0.000 description 3
- 239000006228 supernatant Substances 0.000 description 3
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 2
- HEDRZPFGACZZDS-UHFFFAOYSA-N Chloroform Chemical compound ClC(Cl)Cl HEDRZPFGACZZDS-UHFFFAOYSA-N 0.000 description 2
- 206010059866 Drug resistance Diseases 0.000 description 2
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 2
- KFZMGEQAYNKOFK-UHFFFAOYSA-N Isopropanol Chemical compound CC(C)O KFZMGEQAYNKOFK-UHFFFAOYSA-N 0.000 description 2
- 230000003698 anagen phase Effects 0.000 description 2
- 230000000845 anti-microbial effect Effects 0.000 description 2
- 229940124350 antibacterial drug Drugs 0.000 description 2
- 239000004599 antimicrobial Substances 0.000 description 2
- 244000052616 bacterial pathogen Species 0.000 description 2
- 239000000872 buffer Substances 0.000 description 2
- 238000004440 column chromatography Methods 0.000 description 2
- 238000011033 desalting Methods 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 230000018109 developmental process Effects 0.000 description 2
- 238000010790 dilution Methods 0.000 description 2
- 239000012895 dilution Substances 0.000 description 2
- 230000000694 effects Effects 0.000 description 2
- 238000001962 electrophoresis Methods 0.000 description 2
- 210000003743 erythrocyte Anatomy 0.000 description 2
- 238000009920 food preservation Methods 0.000 description 2
- 239000012634 fragment Substances 0.000 description 2
- XKUKSGPZAADMRA-UHFFFAOYSA-N glycyl-glycyl-glycine Natural products NCC(=O)NCC(=O)NCC(O)=O XKUKSGPZAADMRA-UHFFFAOYSA-N 0.000 description 2
- 238000011534 incubation Methods 0.000 description 2
- 238000001155 isoelectric focusing Methods 0.000 description 2
- 230000031700 light absorption Effects 0.000 description 2
- 238000009630 liquid culture Methods 0.000 description 2
- 239000002609 medium Substances 0.000 description 2
- 108020004999 messenger RNA Proteins 0.000 description 2
- 244000005700 microbiome Species 0.000 description 2
- 239000004570 mortar (masonry) Substances 0.000 description 2
- 239000000047 product Substances 0.000 description 2
- 238000010839 reverse transcription Methods 0.000 description 2
- 239000007787 solid Substances 0.000 description 2
- 238000012360 testing method Methods 0.000 description 2
- XJOTXKZIRSHZQV-RXHOOSIZSA-N (3S)-3-amino-4-[[(2S,3R)-1-[[(2S)-1-[[(2S)-1-[(2S)-2-[[(2S,3S)-1-[[(1R,6R,12R,17R,20S,23S,26R,31R,34R,39R,42S,45S,48S,51S,59S)-51-(4-aminobutyl)-31-[[(2S)-6-amino-1-[[(1S,2R)-1-carboxy-2-hydroxypropyl]amino]-1-oxohexan-2-yl]carbamoyl]-20-benzyl-23-[(2S)-butan-2-yl]-45-(3-carbamimidamidopropyl)-48-(hydroxymethyl)-42-(1H-imidazol-4-ylmethyl)-59-(2-methylsulfanylethyl)-7,10,19,22,25,33,40,43,46,49,52,54,57,60,63,64-hexadecaoxo-3,4,14,15,28,29,36,37-octathia-8,11,18,21,24,32,41,44,47,50,53,55,58,61,62,65-hexadecazatetracyclo[32.19.8.26,17.212,39]pentahexacontan-26-yl]amino]-3-methyl-1-oxopentan-2-yl]carbamoyl]pyrrolidin-1-yl]-1-oxo-3-phenylpropan-2-yl]amino]-3-(1H-imidazol-4-yl)-1-oxopropan-2-yl]amino]-3-hydroxy-1-oxobutan-2-yl]amino]-4-oxobutanoic acid Chemical compound CC[C@H](C)[C@H](NC(=O)[C@@H]1CCCN1C(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](Cc1cnc[nH]1)NC(=O)[C@@H](NC(=O)[C@@H](N)CC(O)=O)[C@@H](C)O)C(=O)N[C@H]1CSSC[C@H](NC(=O)[C@@H]2CSSC[C@@H]3NC(=O)[C@@H]4CSSC[C@H](NC(=O)[C@H](Cc5ccccc5)NC(=O)[C@@H](NC1=O)[C@@H](C)CC)C(=O)N[C@@H](CSSC[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](Cc1cnc[nH]1)NC3=O)C(=O)NCC(=O)N[C@@H](CCSC)C(=O)N2)C(=O)NCC(=O)N4)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(O)=O XJOTXKZIRSHZQV-RXHOOSIZSA-N 0.000 description 1
- LGQPPBQRUBVTIF-JBDRJPRFSA-N Ala-Ala-Ile Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O LGQPPBQRUBVTIF-JBDRJPRFSA-N 0.000 description 1
- DVJSJDDYCYSMFR-ZKWXMUAHSA-N Ala-Ile-Gly Chemical compound [H]N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(O)=O DVJSJDDYCYSMFR-ZKWXMUAHSA-N 0.000 description 1
- IOFVWPYSRSCWHI-JXUBOQSCSA-N Ala-Thr-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](C)N IOFVWPYSRSCWHI-JXUBOQSCSA-N 0.000 description 1
- YHZQOSXDTFRZKU-WDSOQIARSA-N Arg-Trp-Leu Chemical compound C1=CC=C2C(C[C@@H](C(=O)N[C@@H](CC(C)C)C(O)=O)NC(=O)[C@@H](N)CCCN=C(N)N)=CNC2=C1 YHZQOSXDTFRZKU-WDSOQIARSA-N 0.000 description 1
- 241000409326 Armiger Species 0.000 description 1
- BHQQRVARKXWXPP-ACZMJKKPSA-N Asn-Asp-Glu Chemical compound C(CC(=O)O)[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CC(=O)N)N BHQQRVARKXWXPP-ACZMJKKPSA-N 0.000 description 1
- 208000035143 Bacterial infection Diseases 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 241001360526 Escherichia coli ATCC 25922 Species 0.000 description 1
- FGYPOQPQTUNESW-IUCAKERBSA-N Gln-Gly-Leu Chemical compound CC(C)C[C@@H](C(=O)O)NC(=O)CNC(=O)[C@H](CCC(=O)N)N FGYPOQPQTUNESW-IUCAKERBSA-N 0.000 description 1
- AFODTOLGSZQDSL-PEFMBERDSA-N Glu-Asn-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)N)NC(=O)[C@H](CCC(=O)O)N AFODTOLGSZQDSL-PEFMBERDSA-N 0.000 description 1
- UPOJUWHGMDJUQZ-IUCAKERBSA-N Gly-Arg-Arg Chemical compound NC(=N)NCCC[C@H](NC(=O)CN)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O UPOJUWHGMDJUQZ-IUCAKERBSA-N 0.000 description 1
- QPTNELDXWKRIFX-YFKPBYRVSA-N Gly-Gly-Gln Chemical compound NCC(=O)NCC(=O)N[C@H](C(O)=O)CCC(N)=O QPTNELDXWKRIFX-YFKPBYRVSA-N 0.000 description 1
- XPJBQTCXPJNIFE-ZETCQYMHSA-N Gly-Gly-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)CNC(=O)CN XPJBQTCXPJNIFE-ZETCQYMHSA-N 0.000 description 1
- YWAQATDNEKZFFK-BYPYZUCNSA-N Gly-Gly-Ser Chemical compound NCC(=O)NCC(=O)N[C@@H](CO)C(O)=O YWAQATDNEKZFFK-BYPYZUCNSA-N 0.000 description 1
- CCBIBMKQNXHNIN-ZETCQYMHSA-N Gly-Leu-Gly Chemical compound NCC(=O)N[C@@H](CC(C)C)C(=O)NCC(O)=O CCBIBMKQNXHNIN-ZETCQYMHSA-N 0.000 description 1
- UHPAZODVFFYEEL-QWRGUYRKSA-N Gly-Leu-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)CN UHPAZODVFFYEEL-QWRGUYRKSA-N 0.000 description 1
- MHXKHKWHPNETGG-QWRGUYRKSA-N Gly-Lys-Leu Chemical compound [H]NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(O)=O MHXKHKWHPNETGG-QWRGUYRKSA-N 0.000 description 1
- GGLIDLCEPDHEJO-BQBZGAKWSA-N Gly-Pro-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@@H]1CCCN1C(=O)CN GGLIDLCEPDHEJO-BQBZGAKWSA-N 0.000 description 1
- JBCLFWXMTIKCCB-UHFFFAOYSA-N H-Gly-Phe-OH Natural products NCC(=O)NC(C(O)=O)CC1=CC=CC=C1 JBCLFWXMTIKCCB-UHFFFAOYSA-N 0.000 description 1
- 241000282414 Homo sapiens Species 0.000 description 1
- LKACSKJPTFSBHR-MNXVOIDGSA-N Ile-Gln-Lys Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CCCCN)C(=O)O)N LKACSKJPTFSBHR-MNXVOIDGSA-N 0.000 description 1
- CDGLBYSAZFIIJO-RCOVLWMOSA-N Ile-Gly-Gly Chemical compound CC[C@H](C)[C@H]([NH3+])C(=O)NCC(=O)NCC([O-])=O CDGLBYSAZFIIJO-RCOVLWMOSA-N 0.000 description 1
- NYEYYMLUABXDMC-NHCYSSNCSA-N Ile-Gly-Leu Chemical compound CC[C@H](C)[C@@H](C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)O)N NYEYYMLUABXDMC-NHCYSSNCSA-N 0.000 description 1
- PARSHQDZROHERM-NHCYSSNCSA-N Ile-Lys-Gly Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)O)N PARSHQDZROHERM-NHCYSSNCSA-N 0.000 description 1
- 102100034343 Integrase Human genes 0.000 description 1
- YFBBUHJJUXXZOF-UWVGGRQHSA-N Leu-Gly-Pro Chemical compound CC(C)C[C@H](N)C(=O)NCC(=O)N1CCC[C@H]1C(O)=O YFBBUHJJUXXZOF-UWVGGRQHSA-N 0.000 description 1
- YOKVEHGYYQEQOP-QWRGUYRKSA-N Leu-Leu-Gly Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)NCC(O)=O YOKVEHGYYQEQOP-QWRGUYRKSA-N 0.000 description 1
- IVFUVMSKSFSFBT-NHCYSSNCSA-N Lys-Ile-Gly Chemical compound OC(=O)CNC(=O)[C@H]([C@@H](C)CC)NC(=O)[C@@H](N)CCCCN IVFUVMSKSFSFBT-NHCYSSNCSA-N 0.000 description 1
- VMTYLUGCXIEDMV-QWRGUYRKSA-N Lys-Leu-Gly Chemical group OC(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CCCCN VMTYLUGCXIEDMV-QWRGUYRKSA-N 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 108010079364 N-glycylalanine Proteins 0.000 description 1
- GPLWGAYGROGDEN-BZSNNMDCSA-N Phe-Phe-Ser Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CO)C(O)=O GPLWGAYGROGDEN-BZSNNMDCSA-N 0.000 description 1
- IHCXPSYCHXFXKT-DCAQKATOSA-N Pro-Arg-Glu Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(O)=O IHCXPSYCHXFXKT-DCAQKATOSA-N 0.000 description 1
- 108010076504 Protein Sorting Signals Proteins 0.000 description 1
- 240000008976 Pterocarpus marsupium Species 0.000 description 1
- 235000010453 Pterocarpus marsupium Nutrition 0.000 description 1
- 238000002123 RNA extraction Methods 0.000 description 1
- 108010092799 RNA-directed DNA polymerase Proteins 0.000 description 1
- ZUGXSSFMTXKHJS-ZLUOBGJFSA-N Ser-Ala-Ala Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(O)=O ZUGXSSFMTXKHJS-ZLUOBGJFSA-N 0.000 description 1
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 1
- 241001355168 Tetrastigma Species 0.000 description 1
- 241000488908 Torreya Species 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- 108010076324 alanyl-glycyl-glycine Proteins 0.000 description 1
- 108010047495 alanylglycine Proteins 0.000 description 1
- KOSRFJWDECSPRO-UHFFFAOYSA-N alpha-L-glutamyl-L-glutamic acid Natural products OC(=O)CCC(N)C(=O)NC(CCC(O)=O)C(O)=O KOSRFJWDECSPRO-UHFFFAOYSA-N 0.000 description 1
- 125000000539 amino acid group Chemical group 0.000 description 1
- 230000003321 amplification Effects 0.000 description 1
- 230000010100 anticoagulation Effects 0.000 description 1
- 208000022362 bacterial infectious disease Diseases 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 238000010804 cDNA synthesis Methods 0.000 description 1
- 102000014509 cathelicidin Human genes 0.000 description 1
- 108060001132 cathelicidin Proteins 0.000 description 1
- 230000030833 cell death Effects 0.000 description 1
- 238000005285 chemical preparation method Methods 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 239000003795 chemical substances by application Substances 0.000 description 1
- 238000010367 cloning Methods 0.000 description 1
- 230000007547 defect Effects 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 1
- 238000001035 drying Methods 0.000 description 1
- 239000011536 extraction buffer Substances 0.000 description 1
- 235000013305 food Nutrition 0.000 description 1
- 108010055341 glutamyl-glutamic acid Proteins 0.000 description 1
- 108010067216 glycyl-glycyl-glycine Proteins 0.000 description 1
- 108010054666 glycyl-leucyl-glycyl-glycine Proteins 0.000 description 1
- 108010010147 glycylglutamine Proteins 0.000 description 1
- 108010050848 glycylleucine Proteins 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 102000018511 hepcidin Human genes 0.000 description 1
- 108060003558 hepcidin Proteins 0.000 description 1
- 229940066919 hepcidin Drugs 0.000 description 1
- 108010064235 lysylglycine Proteins 0.000 description 1
- 230000035800 maturation Effects 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 229910052757 nitrogen Inorganic materials 0.000 description 1
- 231100000956 nontoxicity Toxicity 0.000 description 1
- 238000003199 nucleic acid amplification method Methods 0.000 description 1
- 239000002773 nucleotide Substances 0.000 description 1
- 125000003729 nucleotide group Chemical group 0.000 description 1
- 150000003904 phospholipids Chemical class 0.000 description 1
- 239000002504 physiological saline solution Substances 0.000 description 1
- 239000013612 plasmid Substances 0.000 description 1
- 238000003752 polymerase chain reaction Methods 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 108010077112 prolyl-proline Proteins 0.000 description 1
- 102000004169 proteins and genes Human genes 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 239000003161 ribonuclease inhibitor Substances 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23K—FODDER
- A23K20/00—Accessory food factors for animal feeding-stuffs
- A23K20/10—Organic substances
- A23K20/142—Amino acids; Derivatives thereof
- A23K20/147—Polymeric derivatives, e.g. peptides or proteins
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23L—FOODS, FOODSTUFFS, OR NON-ALCOHOLIC BEVERAGES, NOT COVERED BY SUBCLASSES A21D OR A23B-A23J; THEIR PREPARATION OR TREATMENT, e.g. COOKING, MODIFICATION OF NUTRITIVE QUALITIES, PHYSICAL TREATMENT; PRESERVATION OF FOODS OR FOODSTUFFS, IN GENERAL
- A23L3/00—Preservation of foods or foodstuffs, in general, e.g. pasteurising, sterilising, specially adapted for foods or foodstuffs
- A23L3/34—Preservation of foods or foodstuffs, in general, e.g. pasteurising, sterilising, specially adapted for foods or foodstuffs by treatment with chemicals
- A23L3/3454—Preservation of foods or foodstuffs, in general, e.g. pasteurising, sterilising, specially adapted for foods or foodstuffs by treatment with chemicals in the form of liquids or solids
- A23L3/3463—Organic compounds; Microorganisms; Enzymes
- A23L3/3526—Organic compounds containing nitrogen
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/12—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K8/00—Cosmetics or similar toiletry preparations
- A61K8/18—Cosmetics or similar toiletry preparations characterised by the composition
- A61K8/30—Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds
- A61K8/64—Proteins; Peptides; Derivatives or degradation products thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/10—Antimycotics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61Q—SPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
- A61Q17/00—Barrier preparations; Preparations brought into direct contact with the skin for affording protection against external influences, e.g. sunlight, X-rays or other harmful rays, corrosive materials, bacteria or insect stings
- A61Q17/005—Antimicrobial preparations
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23V—INDEXING SCHEME RELATING TO FOODS, FOODSTUFFS OR NON-ALCOHOLIC BEVERAGES AND LACTIC OR PROPIONIC ACID BACTERIA USED IN FOODSTUFFS OR FOOD PREPARATION
- A23V2002/00—Food compositions, function of food ingredients or processes for food or foodstuffs
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
Abstract
The invention discloses a natural antibacterial peptide RF-CATH1 and application thereof in antibiosis. The antibacterial peptide RF-CATH1 is derived from horsetail bats. The mature peptide sequence of the antibacterial peptide is obtained by searching a horsetail batus gene database, screening and analyzing, and the amino acid sequence of the mature peptide sequence is shown as SEQ ID NO.1 in a sequence table. Through comparative analysis, the natural antibacterial peptide RF-CATH1 has obvious difference with the amino acid sequences of all currently known antibacterial peptides, and belongs to a novel antibacterial peptide. The antibacterial peptide RF-CATH1 has strong antibacterial activity on gram-positive bacteria, gram-negative bacteria and fungi, has the characteristics of quick bactericidal action and low hemolytic activity, and can be applied to preparation of antibacterial and bacteria growth inhibiting medicines, preservatives, veterinary medicines, animal feeds and cosmetics.
Description
Technical Field
The invention relates to a natural antibacterial peptide and application thereof, in particular to a natural antibacterial peptide RF-CATH1 derived from horsehead horsetail and application thereof, belonging to the technical field of biomedicine.
Background
The traditional antibiotics have remarkable effects on treating bacterial infection diseases, but in recent years, along with the abuse of the traditional antibiotics in the fields of medicine, breeding industry and the like, microorganisms have stronger and stronger tolerance to the traditional antibiotics, and meanwhile, some super bacteria with extremely strong drug resistance appear, and the problem of microbial drug resistance becomes a problem seriously threatening the health of human beings. There is a continuing need for new antimicrobial agents that can be developed because the resistance to microbial agents has been addressed by the use of new or alternative antimicrobial agents that have not been used by resistant microorganisms and that are further resistant to such new antibiotics after a period of use. The development of a novel antibacterial mechanism medicament is a new direction for solving the problem of microbial tolerance.
The antibacterial peptide is a small molecular polypeptide and has the effect of killing bacteria, fungi, viruses, protozoa and the like. The antibacterial peptide has the characteristics of small molecular weight, simple structure, strong bactericidal activity and the like. The bactericidal mechanism of most antimicrobial peptides is by acting on the phospholipid bilayer on the bacterial cell membrane, destroying the integrity of the cell membrane and forming transmembrane channels in the cell membrane, causing the cell contents to be dissolved out and leading to cell death. This unique bactericidal mechanism is generally not susceptible to microbial resistance. Moreover, the antibacterial peptide has no toxicity to normal cells and tissues of mammals generally and has no residue problem, so the antibacterial peptide is expected to become a novel high-efficiency antibacterial drug and has wide development and application prospects.
Disclosure of Invention
The invention aims to overcome the defects of the traditional antibiotics, provides a natural antibacterial peptide RF-CATH1 from horsetail bats, and further provides an amino acid sequence of the antibacterial peptide and application thereof in the aspect of antibiosis. The horsemanspipe herb derived antibacterial peptide RF-CATH1 has broad-spectrum and efficient antibacterial effect, has strong antibacterial activity on gram-positive bacteria, gram-negative bacteria and fungi, has the characteristics of small molecular weight, simple synthesis and low hemolytic activity, and can be applied to the fields of medicines, cosmetics, food fresh keeping and breeding industry.
In order to realize the purpose of the invention, the invention provides the following technical scheme:
the natural antibacterial peptide RF-CATH1 is an antibacterial peptide from the pterocarpus marsupium of pterodactyla, the antibacterial peptide RF-CATH1 is composed of 41 amino acids, the molecular weight is 4641.32Da, and the isoelectric point is 10.16. The amino acid sequence is Lys Leu Gly Arg Trp Leu Gly Lys Leu Ile Gln Lys Gly Gly Gln Lys Ile Gly Gln Gly Leu Glu Asn Ile Gly Arg Arg Ile Lys Gly Phe Phe Ser Asn Asp Glu Pro Arg Glu Glu Ser shown in SEQ ID NO.1 of the sequence table, and all amino acids are L-type.
The invention also provides a chemical preparation method of the antibacterial peptide RF-CATH1, which comprises the following steps:
according to the amino acid sequence of the mature peptide of the obtained natural antibacterial peptide RF-CATH1, combining the whole sequence by an automatic polypeptide synthesizer (433A, Applied Biosystems), desalting and purifying by HPLC reverse phase column chromatography; the purity is identified by high performance liquid chromatography HPLC method, the molecular weight is determined by matrix assisted laser desorption ionization time of flight mass spectrometry (MALDI-TOF), isoelectric point is determined by isoelectric focusing electrophoresis, and the amino acid sequence structure is determined by an automatic amino acid sequencer.
In addition, the invention provides the application of horseshoe brier source antibacterial peptide RF-CATH1 in preparing antibacterial drugs, and horseshoe brier source antibacterial peptide RF-CATH1 is used as the only effective component or one of the effective components.
The application of horseshoe brier source antibacterial peptide RF-CATH1 in preparing medicines for inhibiting bacterial growth comprises horseshoe brier source antibacterial peptide RF-CATH1 as the only effective component or one of the effective components.
The batus ferrugineus source antibacterial peptide RF-CATH1 is applied to the preparation of preservatives.
The horsemanspipe herb derived antibacterial peptide RF-CATH1 is applied to the preparation of animal feed additives.
The horseshoe batus source antibacterial peptide RF-CATH1 is applied to the preparation of cosmetic additives.
The invention has the advantages of providing the natural antibacterial peptide RF-CATH1 derived from horseshoe brier and the application thereof in the aspect of antibiosis. The antibacterial peptide RF-CATH1 has broad-spectrum and efficient antibacterial action, has the characteristics of small molecular weight, simple synthesis and low hemolytic activity, and can be applied to the fields of medicines, cosmetics, food preservation and breeding industry.
Drawings
FIG. 1 hemolytic activity of RF-CATH 1.
Detailed Description
Example 1:
discovery of natural antibacterial peptide RF-CATH1
1) Extracting total RNA of horsetail batus lung tissues:
firstly, 100mg of horsetail bats lung tissue is taken and put into a mortar, liquid nitrogen is added into the mortar to be ground into powder, the powder is transferred into an EP tube, 1ml of total RNA extraction buffer (Trizol, a product of Life company in America) is added into the powder, the mixture is fully mixed, and then the mixture is centrifuged at 12000rpm for 10min at 4 ℃.
② centrifuging and taking supernatant, adding 0.2ml chloroform solution, mixing vigorously, standing at room temperature for 10 minutes, then centrifuging at 4 ℃, 12000rpm for 10 minutes, and discarding the precipitate.
③ adding isopropanol with the same volume into the supernatant, standing for 10 minutes at room temperature, centrifuging for 10 minutes at 4 ℃ and 12000rpm, collecting the precipitate, washing the precipitate with 75% (V/V) ethanol once, and drying in the air, wherein the precipitate at the bottom of the tube is the total RNA of the skin of the Wuyi torreya.
2) The horsetail batus lung tissue cDNA double-chain synthesis: synthesized using the In-Fusion SMARTERTM directive cDNA Library Construction Kit from CLONTECH.
(1) First strand cDNA Synthesis (reverse transcription of mRNA):
adding 1 mul of horsetail bats lung tissue total RNA, 1 mul of 3 'end one-strand synthesis Primer (3' In-Fusion SMARTer CDS Primer) and 2.5 mul of RNase-free water into an RNase-free PCR tube to make the total volume reach 4.5 mul, mixing uniformly, centrifuging for a short time (2000rpm, 30s), and preserving heat at 72 ℃ for 3 minutes after centrifuging; after incubation, the tubes were incubated at 42 ℃ for 2 minutes.
② adding the following reagents (all prepared In-Fusion SMARTERTM directed cDNA Library Construction Kit of CLONTECH Co., Ltd.) into the centrifuge tube, 2.0. mu.l of 5 Xfirst strand buffer, 0.25. mu.l of 100mM DTT, 1.0. mu.l of 10mM dNTP Mix, 1.0. mu.l of SMARTer V Oligonucleoside, 0.25. mu.l of RNase Inhibitor and 1.0. mu.l of SMARTScribere Reverse Transcriptase, mixing the reagents In the centrifuge tube and centrifuging briefly (2000rpm, 30s), keeping the temperature at 42 ℃ for 90min, and then keeping the temperature at 68 ℃ for 10 min. After the incubation treatment, the centrifuge tube was placed on ice to stop the synthesis of the first strand. Mu.l of the first strand of the synthesized cDNA was taken from the centrifuge tube and used.
(2) Amplifying the second strand by long-terminal polymerase chain reaction (LD-PCR) (all reagents are provided In-Fusion SMARTERTM directive cDNA Library Construction Kit of CLONTECH)
Mu.l of cDNA first strand (reverse transcription of mRNA), 80. mu.l of deionized water, 10. mu.l of 10 × Advantage 2PCR buffer, 2. mu.l of 50 × dNTP Mix, 2. mu.l of 5 'PCR primer, 2. mu.l of CDS III/3' PCR primer and 2. mu.l of 50 × Advantage 2Polymerase Mix were mixed in a PCR tube preheated at 95 ℃.
Amplifying in a PCR instrument according to the following procedures:
at 95 ℃ for 1 min; 18 cycles: 95 deg.C, 15sec, 65 deg.C, 30sec, 68 deg.C, 6 min. After the circulation was completed, the cDNA double strand synthesized in the centrifuge tube was stored at-80 ℃.
(3) Cloning of a horsehead hepcidin encoding gene:
the forward primer 5-FCATH is designed and synthesized according to the signal peptide conserved region of the cDNA sequence of the batcathelicidins family antibacterial peptide submitted in NCBI database: 5'-ATGGAGACCCAGGGGGCCAGCCCG-3', the reverse primer is 3 ' -PCR primer In the In-Fusion SMARTERTM directive cDNA Library Construction Kit of CLONTECH, and the sequence is 5'-CGGGGTACGATGAGACACCAT-3'. The PCR reaction was performed under the following conditions: 95 ℃ for 4min, 95 ℃ for 30sec, 57 ℃ for 30sec and 72 ℃ for 1min, 30 cycles. After the amplification, the target fragment was recovered with a gel recovery kit (Tiangen). The recovered target fragment was ligated to pMD19-T vector (Takara, Dalian) to transform DH 5. alpha. competent cells. Plates were plated and screened for ampicillin, and single colonies were picked and the insert size was determined by PCR using M13 primer. Positive colonies were picked, plasmids were extracted by shake culture, and nucleotide sequencing was performed using an Applied Biosystems DNA sequencer, model ABI PRISM 377.
The gene sequence was expressed using the blastX software of the NCBI website (http:// blast.st-va. NCBI. nlm. nih. gov/blast. cgipram ═ blastX:&PAGE_TYPE＝BlastSearch&LINK _ LOC ═ blustonome) shows that the coded product may be the precursor of horsehead horseshoe caterpillar family antibacterial peptide. The polypeptide precursor sequence encoded by the gene was further modified by protein blast software of NCBI website (http:// blast.st-va. NCBI. nlm. nih. gov/blast. cgiprogram ═ blast)&PAGE_TYPE＝BlastSearch&LINK _ LOC ═ blustonome), and comparing and analyzing with the sequences of the previously discovered antimicrobial peptides of other animal-derived cathelicidins families, and determining that the enzyme cutting site is-N in the maturation process of the antimicrobial peptide132-V133The mature peptide sequence KLGRWLGKLIQKGGQKIGQGLENIGRRIKGFFSNDEPREES (amino acid one letter sequence) of the antibacterial peptide is obtained and named as RF-CATH 1. The amino acid sequence of the RF-CATH1 is obviously different from that of all the currently known antibacterial peptides.
The precursor encoding RF-CATH1 consists of 174 amino acid residues. The sequence length is 618 bases.
Example 2
Chemical synthesis method of antibacterial peptide RF-CATH1
(1) The full sequence of RF-CATH1 was synthesized by HPLC C using an automated polypeptide synthesizer (433A, Applied Biosystems)18Desalting and purifying by reverse phase column chromatography. (2) The molecular weight is determined by conventional matrix-assisted laser desorption ionization time of flight mass spectrometry (MALDI-TOF). (3) The purity of the purified RF-CATH1 was verified by HPLC>95% and isoelectric point of 10.16 by isoelectric focusing electrophoresis, and using automatic amino acid sequencerThe amino acid sequence structure of the polypeptide is determined to be consistent with that of the natural RF-CATH 1.
Example 3:
detection of antibacterial activity of antibacterial peptide RF-CATH1
(1) The test strains preserved on the inclined planes are respectively picked and evenly spread on a MH solid culture medium (purchased from Qingdao Haibo biotechnology, Inc.) plate, a sterilized filter paper sheet with the diameter of 0.5cm is placed on the surface of the culture medium, 10 mul of RF-CATH1 sample solution dissolved in 2mg/ml of sterilized deionized water is dripped, inverted culture is carried out at 37 ℃ for 18-20 hours, and whether the inhibition zone is formed or not is observed. If the sample has antibacterial activity, clear and transparent inhibition zones can be formed around the filter paper sheet, and the larger the inhibition zone is, the stronger the antibacterial activity of the sample is. The results showed that the antimicrobial peptide RF-CATH1 has antimicrobial activity against all the strains listed in table 1.
(2) The Minimum Inhibitory Concentration (Minimum Inhibitory Concentration) was determined by 2-fold dilution: and (3) selecting the bacterial strain with the inhibition zone in the experiment step (1) to carry out an MIC determination experiment. The test strains were inoculated into MH liquid medium (purchased from Qingdao Haibo Biotech Co., Ltd.), then cultured with shaking at 37 ℃ in an incubator to logarithmic growth phase, and then the culture broth of the strains cultured to logarithmic growth phase was diluted to 2X 10 with fresh MH liquid medium5cfu/ml is ready for use.
100 mul MH liquid culture medium is added into each hole of a sterile 96-hole plate in advance, then 100 mul RF-CATH1 sample solution which is diluted to a certain concentration by using the MH liquid culture medium and filtered by a filter membrane with the hole of 0.22 mu m is added into the first hole, after uniform mixing, 100 mul is added into the 2 nd hole, the dilution is carried out in multiple times, 100 mul is sucked out from the 9 th hole and discarded, and the 10 th hole is a control tube. After adding 100. mu.l of the diluted strain culture solution to each well, the 96-well plate was placed in an incubator at 37 ℃ and cultured with slow shaking for 18 hours, and the light absorption was measured at a wavelength of 600 nm. The minimum inhibitory concentration is the lowest sample concentration at which no bacterial growth is visible. The results are shown in Table 1.
As can be seen from Table 1, the antimicrobial peptide RF-CATH1 shows very strong antimicrobial activity against gram-positive bacteria, gram-negative bacteria and fungi, including various clinically isolated pathogenic bacteria. The MIC value was in the range of 4.69-18.75. mu.g/ml.
TABLE 2 antibacterial Activity of horseshoe brier antibacterial peptide RF-CATH1
Example 4:
determination of Sterilization Rate of antimicrobial peptide RF-CATH1
Escherichia coli ATCC25922 was cultured in MH broth (Qingdao Haibo Biotech Co., Ltd.) at 37 ℃ for 12 hours, and then diluted to 10 with fresh MH broth6cfu/ml bacterial suspension. A sample of RF-CATH1 dissolved in sterile deionized water was added to the bacterial suspension to a final concentration of 5 × MIC (46.9 μ g/ml). The bacterial liquid added with the RF-CATH1 sample is placed in an incubator at 37 ℃ for shake culture, 50 mu l of bacterial liquid is taken to dilute 1000 times respectively at 0 minute, 15 minutes, 30 minutes, 60 minutes, 120 minutes and 180 minutes, then 50 mu l of diluted bacterial liquid is taken to coat on an MH solid culture medium, and bacterial colonies are counted after the bacterial liquid is cultured in the incubator at 37 ℃ overnight. Ampicillin was used as a positive control and sterilized deionized water was used as a negative control in this example. The results of the experiment are shown in table 3.
As can be seen from the comparison in Table 2, the sterilization rate of RF-CATH1 was faster than that of the positive control ampicillin, which required 120 minutes to kill all bacteria in 60 minutes.
TABLE 2 Sterilization rate of the antimicrobial peptides RF-CATH1
Example 5:
determination of hemolytic Activity of RF-CATH1
Mixing collected fresh C57 mouse blood with Ashi solution for anticoagulation, and physiological salineWashed 2 times and resuspended to 107-108cell/ml suspension. Mixing the diluted erythrocyte suspension with RF-CATH1 sample solution with certain concentration dissolved in normal saline, keeping the temperature at 37 ℃ for 30min, centrifuging at 1000rpm for 5min, and measuring the light absorption value of the supernatant at the wavelength of 540 nm. The negative control uses physiological saline, the positive control uses TritonX-100, and the percentage of hemolysis is calculated according to the following formula: percent hemolysis H% ═ a sample-a negative control/a positive control × 100%. The results in FIG. 1 show that the percentage of hemolysis is 2.8% and 5.2% at concentrations of RF-CATH1 up to 100. mu.g/ml and 200. mu.g/ml, respectively, indicating that RF-CATH1 has very low hemolytic activity on mammalian erythrocytes.
As can be seen from the above examples, the horseshoe brier antibacterial peptide RF-CATH1 can be obtained by chemical synthesis, and has strong antibacterial activity on gram-positive bacteria, gram-negative bacteria and fungi, including some clinically isolated pathogenic bacteria, and rapid bactericidal action. The antibacterial peptide has the characteristics of small molecular weight, simple synthesis and low hemolytic activity, and can be applied to the fields of medicines, cosmetics, food preservation and breeding industry.
Sequence listing
<110> university of Guizhou Master
<120> horseshoe head bats source antibacterial peptide RF-CATH1 and application thereof
<160> 4
<170> SIPOSequenceListing 1.0
<210> 1
<211> 41
<212> PRT
<213> horseshoe-head bats (Rhinolophus ferummequinum)
<400> 1
Leu Leu Gly Ala Thr Leu Gly Leu Leu Ile Gly Leu Gly Gly Gly Leu
1 5 10 15
Ile Gly Gly Gly Leu Gly Ala Ile Gly Ala Ala Ile Leu Gly Pro Pro
20 25 30
Ser Ala Ala Gly Pro Ala Gly Gly Ser
35 40
<210> 2
<211> 618
<212> DNA
<213> horseshoe-head bats (Rhinolophus ferummequinum)
<400> 2
atggagaccc agggcggcag cccctccttg aggcggtggt cactgttgct actgctgctg 60
ggccgggcca tgcctccagc cactgcccag accctcacat acagggaggc cgtgctccgt 120
gctgtggatg gcttcaacca gcggtcctca gaagctagtc tctaccgcct cctggagcta 180
gaccagccgc ccgagggaga tgagaaccca aacatcccga agcctgtgag cttcacggtg 240
aaggagactg tgtgtcccag gaagctgcgg aggacacagc agccaatgga gcagtgtgac 300
ttcaaggaga atgggctggt gaaacagtgt gtggggacag tcactctgga ccaggtcgat 360
ggctactttg acattaactg tgagaagctc cagaacgtca aactcggcag atggcttggc 420
aaactcatac agaaaggcgg gcagaagatt ggccaagggc ttgaaaacat tggcaggaga 480
atcaaaggtt ttttttcaaa tgatgagccc agggaagagt cctaagggcc tgctttgccc 540
tggcttgggc tactggattc tgaaaaataa attcttgtaa aagcaacttc aaaaaaaaaa 600
agaaaaaaaa aaaaaaaa 618
<210> 3
<211> 24
<212> DNA
<213> horseshoe-head bats (Rhinolophus ferummequinum)
<400> 3
atggagaccc agggggccag cccg 24
<210> 4
<211> 21
<212> DNA
<213> Tetrastigmas macrorhynchus (Hipposphoeros armiger)
<400> 4
cggggtacga tgagacacca t 21
Claims (6)
1. An horseshoe brier source antibacterial peptide RF-CATH1 is characterized in that the antibacterial peptide is derived from horseshoe brier, consists of 41 amino acids, has a molecular weight of 4641.32Da and an isoelectric point of 10.16, an amino acid sequence table of the horseshoe brier source antibacterial peptide is shown in SEQ ID NO.1, and all the amino acids are L-type.
2. The use of batryticatus head source antibacterial peptide RF-CATH1 in the preparation of antibacterial medicine according to claim 1, wherein: horseshoe bats derived antibacterial peptide RF-CATH1 as the only effective component or one of the effective components.
3. The use of batryticatus head-derived antimicrobial peptide RF-CATH1 as claimed in claim 1 in the preparation of a medicament for inhibiting bacterial growth, wherein: horseshoe bats derived antibacterial peptide RF-CATH1 as the only effective component or one of the effective components.
4. Use of batula equine derived antibacterial peptide RF-CATH1 as defined in claim 1 for the preparation of a preservative.
5. Use of batryticatus head source antibacterial peptide RF-CATH1 as claimed in claim 1 in preparing animal feed additive.
6. Use of batula equine derived antibacterial peptide RF-CATH1 as claimed in claim 1 in the preparation of cosmetic additives.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN202110944844.1A CN113527461B (en) | 2021-08-17 | 2021-08-17 | Horseshoe head bats source antibacterial peptide RF-CATH1 and application thereof |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN202110944844.1A CN113527461B (en) | 2021-08-17 | 2021-08-17 | Horseshoe head bats source antibacterial peptide RF-CATH1 and application thereof |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| CN113527461A true CN113527461A (en) | 2021-10-22 |
| CN113527461B CN113527461B (en) | 2022-06-21 |
Family
ID=78122472
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN202110944844.1A Active CN113527461B (en) | 2021-08-17 | 2021-08-17 | Horseshoe head bats source antibacterial peptide RF-CATH1 and application thereof |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN113527461B (en) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN113527461B (en) * | 2021-08-17 | 2022-06-21 | 贵州师范大学 | Horseshoe head bats source antibacterial peptide RF-CATH1 and application thereof |
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20040063107A1 (en) * | 2001-05-04 | 2004-04-01 | Plowman Gregory D. | Novel proteases |
| CN1878789A (en) * | 2003-10-21 | 2006-12-13 | 加利福尼亚大学董事会 | Human cathelicidin antimicrobial peptides |
| US20210046023A1 (en) * | 2018-11-15 | 2021-02-18 | Bluewillow Biologics, Inc. | Persistant topical antimicrobial compositions and methods of using the same |
Family Cites Families (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN113527461B (en) * | 2021-08-17 | 2022-06-21 | 贵州师范大学 | Horseshoe head bats source antibacterial peptide RF-CATH1 and application thereof |
-
2021
- 2021-08-17 CN CN202110944844.1A patent/CN113527461B/en active Active
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20040063107A1 (en) * | 2001-05-04 | 2004-04-01 | Plowman Gregory D. | Novel proteases |
| CN1878789A (en) * | 2003-10-21 | 2006-12-13 | 加利福尼亚大学董事会 | Human cathelicidin antimicrobial peptides |
| US20210046023A1 (en) * | 2018-11-15 | 2021-02-18 | Bluewillow Biologics, Inc. | Persistant topical antimicrobial compositions and methods of using the same |
Non-Patent Citations (3)
| Title |
|---|
| LUO, QINGHUA 等: "Novel Cathelicidin Antimicrobial Peptides from Paa robertingeri.", 《ANNUAL RESEARCH & REVIEW IN BIOLOGY》 * |
| ZEKUAN LU 等: "Novel cathelicidin-derived antimicrobial peptides from Equus asinus", 《THE FEBS JOURNAL》 * |
| 王妍 等: "两栖类动物Cathelicidins家族抗菌肽研究进展", 《动物学杂志》 * |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN113527461B (en) * | 2021-08-17 | 2022-06-21 | 贵州师范大学 | Horseshoe head bats source antibacterial peptide RF-CATH1 and application thereof |
Also Published As
| Publication number | Publication date |
|---|---|
| CN113527461B (en) | 2022-06-21 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| Arockiaraj et al. | Crustin, a WAP domain containing antimicrobial peptide from freshwater prawn Macrobrachium rosenbergii: immune characterization | |
| Pan et al. | Gene expression and localization of the epinecidin-1 antimicrobial peptide in the grouper (Epinephelus coioides), and its role in protecting fish against pathogenic infection | |
| CN106188265B (en) | A kind of antimicrobial peptide Cm-CATH2 and its gene, preparation method and application | |
| Zhuang et al. | Three new piscidins from orange-spotted grouper (Epinephelus coioides): Phylogeny, expression and functional characterization | |
| CN113527461B (en) | Horseshoe head bats source antibacterial peptide RF-CATH1 and application thereof | |
| CN104761629B (en) | A kind of broad-spectrum high efficacy antimicrobial peptide Pb CATH OH1 and its gene, preparation method and application | |
| Huo et al. | Molecular characterization, antibacterial activity and mechanism analyzation of three different piscidins from black rockfish, Sebastes schlegelii | |
| CN113480631B (en) | Horseshoe head bats source antibacterial peptide RF-CATH2 and application thereof | |
| CN113480630B (en) | Hepialus longissimus source antibacterial peptide MS-CATH and application thereof | |
| CN112480227A (en) | Protein for improving pathogenic bacterium resistance of sturgeon and preparation method and application thereof | |
| Arockiaraj et al. | Molecular functions of chaperonin gene, containing tailless complex polypeptide 1 from Macrobrachium rosenbergii | |
| CN112375132B (en) | Antibacterial peptide derived from Taihu whitefish and application thereof | |
| CN101475630B (en) | Bloody noun antibacterial peptide temporin-La, genes thereof and use in pharmacy | |
| Zhuang et al. | Characterization of antibacterial activities and the related mechanisms of a β-defensin in turbot (Scophthalmus maximus) | |
| CN104910266A (en) | Amolops wuyiensis antibacterial peptide as well as encoding gene and application thereof | |
| Kasthuri et al. | Genomic characterization, expression analysis, and antimicrobial function of a glyrichin homologue from rock bream, Oplegnathus fasciatus | |
| CN113801214A (en) | Calipes gigantea source antibacterial peptide HA-CATH and application thereof | |
| Huang et al. | Characterization of the BPI-like gene from a subtracted cDNA library of large yellow croaker (Pseudosciaena crocea) and induced expression by formalin-inactivated Vibrio alginolyticus and Nocardia seriolae vaccine challenges | |
| CN101570760B (en) | Recombinant mouse beta-alexin 3 polypeptide, preparation and use thereof | |
| CN111518189A (en) | Antimicrobial peptide MSPiscidin-3, and coding gene and application thereof | |
| CN108467426B (en) | Taihu lake whitefish host defense peptide and application thereof | |
| CN110923289B (en) | Screening method of drug for treating citrus greening disease | |
| CN111471094B (en) | Antimicrobial peptide MSPiscidin-2, and coding gene and application thereof | |
| CN106432459B (en) | Antibacterial peptide of hypsizigus marmoreus, gene thereof and application thereof in pharmacy | |
| CN106146641B (en) | Rana limnocharis source cathelicidin family antibacterial peptide and its application |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PB01 | Publication | ||
| PB01 | Publication | ||
| SE01 | Entry into force of request for substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| GR01 | Patent grant | ||
| GR01 | Patent grant |